Advanced Search (OLGA)

Gene: Ccl2 (C-C motif chemokine ligand 2) Rattus norvegicus

Analyze

Symbol:

Ccl2

Name:

C-C motif chemokine ligand 2

RGD ID:

3645

Description:

Enables chemokine activity and heparin binding activity. Involved in several processes, including cellular response to cytokine stimulus; leukocyte chemotaxis; and positive regulation of leukocyte migration. Located in several cellular components, including axon; perikaryon; and perinuclear region of cytoplasm. Used to study several diseases, including artery disease (multiple); diabetic angiopathy; interstitial lung disease (multiple); kidney disease (multiple); and pancreatitis (multiple). Biomarker of several diseases, including artery disease (multiple); cerebrovascular disease (multiple); liver disease (multiple); lung disease (multiple); and pancreatitis (multiple). Human ortholog(s) of this gene implicated in several diseases, including IgA vasculitis; end stage renal disease; gastrointestinal system cancer (multiple); lupus nephritis; and vasculitis (multiple). Orthologous to human CCL2 (C-C motif chemokine ligand 2); PARTICIPATES IN angiotensin II signaling pathway; vascular endothelial growth factor signaling pathway; granulocyte-macrophage colony-stimulating factor signaling pathway; INTERACTS WITH (+)-pilocarpine; (+)-schisandrin B; (R,R,R)-alpha-tocopherol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

C-C motif chemokine 2; chemokine (C-C motif) ligand 2; immediate-early serum-responsive JE protein; immediate-early serum-responsive protein JE; MCP-1; MCP1; monocyte chemoattractant protein 1; monocyte chemoattractant protein-1; monocyte chemotactic protein 1; Scya2; Sigje; small inducible cytokine A2; Small inducible gene JE; small-inducible cytokine A2

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Allele / Splice:

Ccl2^em1Mcwi

Genetic Models:

SS-Ccl2^em1-/-Mcwi

Candidate Gene For:

Eau3 Eae18b Eau9 Bp374

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	67,503,077 - 67,504,875 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	10	67,503,077 - 67,504,875 (+)	Ensembl				GRCr8
mRatBN7.2	10	67,005,424 - 67,007,222 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	67,005,424 - 67,007,226 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	10	71,626,649 - 71,628,447 (+)	NCBI	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	71,131,996 - 71,133,794 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	66,593,121 - 66,594,919 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0
Dahl_SR_JrHsd	10	70,374,928 - 70,376,726 (+)	NCBI
Lyon_Normotensive	10	71,096,385 - 71,098,183 (+)	NCBI
Lyon_Hypertensive	10	72,770,448 - 72,772,246 (+)	NCBI
F344_StmMcwi	10	72,661,862 - 72,663,659 (+)	NCBI
Rnor_6.0	10	69,412,065 - 69,413,863 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	69,412,017 - 69,413,870 (+)	Ensembl		Rnor_6.0 Ensembl	rn6	Rnor6.0
Rnor_5.0	10	69,047,091 - 69,048,889 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	10	70,256,263 - 70,258,061 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	10	65,952,968 - 65,954,766 (+)	NCBI		Celera
Cytogenetic Map	10	q26	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

abdominal aortic aneurysm (IEP)

Acute Anterior Uveitis (ISO)

Acute Liver Failure (ISO)

Acute Lung Injury (IEP)

acute myeloid leukemia (ISO)

acute necrotizing pancreatitis (IDA,IEP)

Acute-On-Chronic Liver Failure (ISO)

adult respiratory distress syndrome (ISO)

age related macular degeneration (ISS)

aggressive periodontitis (ISO)

alcoholic hepatitis (ISO)

allergic conjunctivitis (ISO)

allergic disease (ISO)

anemia (ISO)

Animal Hepatitis (ISO)

anterior uveitis (IEP,ISO)

anti-basement membrane glomerulonephritis (IDA,IEP)

arteriosclerosis (ISO)

asthma (IEP,ISO)

atherosclerosis (ISO)

autistic disorder (ISO)

autoimmune hepatitis (ISO)

Bacteremia (ISO)

bacterial pneumonia (ISO)

Behcet's disease (ISO)

Binge Drinking (IEP)

bipolar disorder (ISO)

Brain Hypoxia-Ischemia (IEP)

Brain Injuries (IEP,IMP,ISO)

brain ischemia (IEP,ISO)

Bronchial Hyperreactivity (ISO)

bronchiolitis obliterans (IMP)

calcinosis (ISO)

cardiomyopathy (IEP)

Cardiotoxicity (ISO)

cardiovascular system disease (ISO)

carotid artery disease (ISO)

Carotid Artery Injuries (IDA,ISO)

Carrington Syndrome (ISO)

cerebral infarction (ISO)

Chagas disease (IEP)

Chemical and Drug Induced Liver Injury (ISO)

cholangitis (IEP)

Choroidal Neovascularization (ISO)

Chronic Hepatitis B (ISO)

Chronic Hepatitis C (ISO)

Chronic Intermittent Hypoxia (IEP)

chronic obstructive pulmonary disease (ISO)

Chronic Periodontitis (ISO)

Chronic Relapsing Experimental Autoimmune Encephalomyelitis (IEP)

Chronic Tubulointerstitial Nephropathy (IEP)

colitis (IEP)

colon cancer (IEP)

Colonic Neoplasms (ISO)

congenital diaphragmatic hernia (ISO)

congestive heart failure (IEP,ISO)

contact dermatitis (ISO)

Contusions (IEP)

coronary artery disease (IEP,ISO)

Coronavirus infectious disease (ISO)

COVID-19 (ISO)

crescentic glomerulonephritis (IDA,IMP)

Crohn's disease (ISO)

cryptococcosis (ISO)

cutaneous leishmaniasis (ISO)

cystic fibrosis (ISO)

Delayed Hypersensitivity (IEP)

diabetic angiopathy (IDA)

Diabetic Nephropathies (IEP,ISO)

diabetic retinopathy (IEP)

Duchenne muscular dystrophy (ISO)

end stage renal disease (IDA,IEP,ISO)

Endometrial Neoplasms (ISO)

endometriosis (ISO)

endomyocardial fibrosis (IEP)

Endotoxemia (IEP)

Endotoxin-Induced Uveitis (IDA)

Experimental Arthritis (IDA,IEP,IMP)

Experimental Autoimmune Encephalomyelitis (IEP)

Experimental Autoimmune Myocarditis (IEP)

Experimental Autoimmune Orchitis (IEP)

Experimental Autoimmune Uveitis (IEP)

Experimental Autoimmune Uveoretinitis (ISO)

Experimental Diabetes Mellitus (IDA,IEP)

Experimental Liver Cirrhosis (IEP,ISO)

Eye Neoplasms (ISO)

familial hyperlipidemia (ISO)

Febrile Neutropenia (ISO)

fibromyalgia (ISO)

fungal infectious disease (ISO)

gastritis (IDA)

Geographic Atrophy (ISO)

gestational diabetes (ISO)

gliosarcoma (ISO)

glomerulonephritis (ISO)

Granulomatous Interstitial Nephritis (IEP)

Granulomatous Vasculitis (IMP)

Graves ophthalmopathy (ISO)

Guillain-Barre syndrome (ISO)

head and neck squamous cell carcinoma (ISO)

Hearing Loss, Noise-Induced (ISO)

heart valve disease (ISO)

hemarthrosis (ISO)

hemolytic-uremic syndrome (IEP)

hepatic encephalopathy (IEP)

hepatocellular carcinoma (ISO)

herpes simplex (ISO)

herpes simplex virus keratitis (ISO)

human immunodeficiency virus infectious disease (ISO)

Human Influenza (ISO)

Hyperalgesia (IDA,IEP,IMP,ISO)

hyperglycemia (ISO)

hyperhomocysteinemia (IEP)

hyperinsulinism (IEP,ISO)

Hyperoxaluria (ISO)

hypertension (IDA,IEP,ISO)

Hypoxia (IEP)

IgA glomerulonephritis (IEP)

IgA vasculitis (ISO)

Inflammation (IEP,ISO)

Inflammatory Breast Neoplasms (ISO)

influenza (ISO)

Insulin Resistance (ISO)

interstitial lung disease (IMP,ISO)

interstitial nephritis (ISO)

Intestinal Reperfusion Injury (IEP)

intracranial aneurysm (IEP,IMP)

intracranial vasospasm (IEP)

invasive aspergillosis (ISO)

Invasive Pulmonary Aspergillosis (IDA)

ischemia (ISO)

kidney disease (IMP)

Kidney Reperfusion Injury (IDA,ISO)

Kuhnt-Junius degeneration (ISO)

limited scleroderma (ISO)

lipodystrophy (ISO)

liver cirrhosis (IEP,ISO)

liver disease (ISO)

Liver Metastasis (ISO)

Liver Reperfusion Injury (IEP,ISO)

Lower Extremity Deep Vein Thrombosis (ISO)

lung disease (IEP)

Lung Injury (ISO)

lupus nephritis (ISO)

Lyme Neuroborreliosis (ISO)

macular degeneration (ISO)

macular retinal edema (ISO)

membranoproliferative glomerulonephritis (IMP)

metabolic dysfunction and alcohol associated liver disease (ISO)

metabolic dysfunction-associated steatohepatitis (IEP,ISO)

metabolic dysfunction-associated steatotic liver disease (IEP,ISO)

Metabolic Syndrome (ISO)

middle cerebral artery infarction (ISO)

Middle East respiratory syndrome (ISO)

Mouth Neoplasms (ISO)

multiple myeloma (ISO)

Multiple Organ Failure (IEP)

multiple sclerosis (ISO)

myocardial infarction (IDA,IEP,ISO)

Myocardial Ischemia (IEP,ISO)

Myocardial Reperfusion Injury (IEP,ISO)

myocarditis (ISO)

Nasal Polyps (ISO)

Neoplasm Invasiveness (ISO)

Neoplasm Metastasis (ISO)

nephritis (ISO)

obesity (IEP,ISO)

obstructive jaundice (IDA)

obstructive sleep apnea (ISO)

oral squamous cell carcinoma (IEP,ISO)

orchitis (IEP)

Oxygen-Induced Retinopathy (IDA,ISO)

Pain (IDA)

Painful Neuropathy (IEP,ISO)

pancreatitis (IEP,IMP,ISO)

Perennial Allergic Rhinitis (ISO)

peri-implantitis (ISO)

periapical periodontitis (IEP)

Periodontal Cyst (ISO)

periodontitis (IEP)

Peripheral Nerve Injuries (IEP)

Peritoneal Fibrosis (ISO)

Plaque, Atherosclerotic (ISO)

pleural disease (ISO)

pneumocystosis (ISO)

pneumonia (ISO)

portal hypertension (ISO)

Premature Obstetric Labor (ISO)

proliferative diabetic retinopathy (ISO)

Pulmonary Contusion (IEP)

pulmonary edema (IEP)

pulmonary embolism (IEP)

pulmonary emphysema (ISO)

pulmonary fibrosis (IEP,ISO)

pulmonary hypertension (IEP,ISO)

pulmonary tuberculosis (ISO)

Reperfusion Injury (IDA,ISO)

Respiratory Tract Granuloma (IDA,ISO)

Retina Reperfusion Injury (IDA)

retinal degeneration (ISO)

retinal detachment (ISO)

retinitis (ISO)

rheumatoid arthritis (ISO)

sarcoma (IEP)

schizophrenia (ISO)

sciatic neuropathy (IEP,ISO)

Sepsis (IEP)

severe acute respiratory syndrome (ISO)

silicosis (ISO)

skin melanoma (ISO)

spina bifida (ISO)

Spinal Cord Compression (IEP,ISO)

squamous cell carcinoma (ISO)

status epilepticus (IEP,ISO)

steatotic liver disease (ISO)

stroke (IEP,ISO)

systemic lupus erythematosus (ISO)

systemic scleroderma (ISO)

temporal arteritis (ISO)

thrombocytopenia (ISO)

Thyroid Carcinoma, Nonmedullary 1 (ISO)

thyroid gland disease (ISO)

Thyroid Neoplasms (ISO)

toxic shock syndrome (ISO)

transient cerebral ischemia (IDA,IEP)

Transplant Rejection (ISO)

Triple Negative Breast Neoplasms (ISO)

type 1 diabetes mellitus (ISO)

type 2 diabetes mellitus (IEP)

ureteral obstruction (ISO)

uveitis (IEP,ISO)

Vasculitis of the Skin (ISO)

Venous Thrombosis (IEP)

viral pneumonia (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-abscisic acid (ISO)

(+)-catechin (ISO)

(+)-pilocarpine (EXP,ISO)

(+)-schisandrin B (EXP)

(-)-anisomycin (ISO)

(-)-Arctigenin (ISO)

(-)-demecolcine (ISO)

(-)-epigallocatechin 3-gallate (ISO)

(24S)-24-hydroxycholesterol (ISO)

(25R)-cholest-5-ene-3beta,26-diol (ISO)

(2R,4R)-1-[(2S)-5-(diaminomethylideneamino)-2-[(3-methyl-1,2,3,4-tetrahydroquinolin-8-yl)sulfonylamino]-1-oxopentyl]-4-methyl-2-piperidinecarboxylic acid (ISO)

(4Z,7Z,10Z,13Z,15E,19Z)-17-hydroxydocosahexaenoic acid (ISO)

(E)-thiamethoxam (ISO)

(R)-lipoic acid (ISO)

(R,R,R)-alpha-tocopherol (EXP,ISO)

(RS)-norcoclaurine (ISO)

(S)-colchicine (EXP)

(S)-nicotine (EXP,ISO)

1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (ISO)

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (EXP,ISO)

1,2,4-trimethylbenzene (EXP)

1,2-dimethylhydrazine (ISO)

1,3,5-trimethylbenzene (ISO)

1,3-benzothiazole-2-thiol (ISO)

1,4-benzoquinone (ISO)

1,4-naphthoquinone (ISO)

1,4-phenylenediamine (ISO)

1-[2-(3,4-dichlorophenyl)ethyl]-4-methylpiperazine (ISO)

1-chloro-2,4-dinitrobenzene (ISO)

1-fluoro-2,4-dinitrobenzene (ISO)

1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (ISO)

1-naphthyl isothiocyanate (EXP,ISO)

11-deoxycorticosterone (EXP)

13-HPODE (EXP)

14-Deoxy-11,12-didehydroandrographolide (ISO)

15-acetyldeoxynivalenol (ISO)

15-deoxy-Delta(12,14)-prostaglandin J2 (ISO)

17alpha-ethynylestradiol (EXP,ISO)

17beta-estradiol (EXP,ISO)

17beta-estradiol 3-benzoate (EXP)

17beta-hydroxy-5alpha-androstan-3-one (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (EXP,ISO)

2,2',4,4'-Tetrabromodiphenyl ether (EXP,ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3',4,4',5-Pentachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,4'-trichlorobiphenyl (ISO)

2,4,6-trinitrobenzenesulfonic acid (EXP,ISO)

2,4,6-trinitrotoluene (EXP)

2,4-D (EXP,ISO)

2,4-diaminotoluene (ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

2,6-di-tert-butyl-4-methylphenol (ISO)

2-acetamidofluorene (EXP)

2-acetyl-1-alkyl-sn-glycero-3-phosphocholine (ISO)

2-amino-2-deoxy-D-galactopyranose (ISO)

2-amino-2-deoxy-D-glucopyranose (EXP,ISO)

2-Amino-9H-pyrido[2,3-b]indole (ISO)

2-aminopurine (ISO)

2-arachidonoylglycerol (ISO)

2-butoxyethanol (ISO)

2-hydroxypropanoic acid (ISO)

2-tert-butylhydroquinone (ISO)

22-Hydroxycholesterol (ISO)

24,25-Dihydroxyvitamin D (ISO)

26-hydroxycholesterol (ISO)

3'-amino-3'-deoxy-N(6),N(6)-dimethyladenosine (EXP)

3,3',4,4',5-pentachlorobiphenyl (EXP,ISO)

3,3',4,4'-tetrachlorobiphenyl (ISO)

3,4-dihydroxybenzoic acid (ISO)

3-(1H-indol-3-yl)propanoic acid (ISO)

3-[3-(tert-butylsulfanyl)-1-(4-chlorobenzyl)-5-(propan-2-yl)-1H-indol-2-yl]-2,2-dimethylpropanoic acid (EXP)

3-acetyldeoxynivalenol (ISO)

3-chloropropane-1,2-diol (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

3-methylcholanthrene (ISO)

3H-1,2-dithiole-3-thione (EXP)

4',5,7-Trimethoxyflavone (ISO)

4'-hydroxydiclofenac (ISO)

4'-Methoxychalcone (ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

4-(ethoxymethylene)-2-phenyloxazol-5-one (ISO)

4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one (ISO)

4-Hydroxybenzophenone (ISO)

4-hydroxynon-2-enal (ISO)

4-hydroxyphenyl retinamide (ISO)

4-methylhistamine (ISO)

4-nitro-m-cresol (ISO)

4-nitroquinoline N-oxide (ISO)

4-phenylbutyric acid (ISO)

5'-S-methyl-5'-thioadenosine (ISO)

5-fluorouracil (ISO)

6-propyl-2-thiouracil (EXP,ISO)

7,12-dimethyltetraphene (ISO)

7,9-dihydro-1H-purine-2,6,8(3H)-trione (EXP,ISO)

7-ketocholesterol (ISO)

7alpha-hydroxycholesterol (ISO)

8-Br-cAMP (EXP,ISO)

9-cis-retinoic acid (ISO)

9-hydroxycanthin-6-one (ISO)

Abemaciclib (ISO)

acarbose (EXP)

acetaldehyde (ISO)

acetamide (EXP)

acetic acid [2-[[(5-nitro-2-thiazolyl)amino]-oxomethyl]phenyl] ester (ISO)

acetoacetic acid (ISO)

acetylsalicylic acid (EXP,ISO)

acrolein (EXP,ISO)

acrylic acid (EXP)

acrylonitrile (EXP,ISO)

acteoside (ISO)

actinomycin D (ISO)

acyclovir (ISO)

adenine (ISO)

Adenosine, cyclic 3',5'-[hydrogen [p(s)]-phosphorothioate] (ISO)

Aeol 10150 (ISO)

aflatoxin B1 (EXP,ISO)

Aflatoxin G1 (ISO)

AICA ribonucleotide (EXP,ISO)

albendazole (ISO)

alclometasone dipropionate (ISO)

aldehydo-D-glucosamine (EXP,ISO)

aldehydo-D-glucose (EXP,ISO)

aldicarb (EXP)

alexidine (ISO)

all-trans-retinoic acid (EXP,ISO)

all-trans-retinol (EXP,ISO)

allopurinol (EXP,ISO)

alloxan (ISO)

alloxanthine (ISO)

allyl alcohol (ISO)

allyl methyl disulfide (ISO)

alpha-curcumene (ISO)

alpha-hexylcinnamaldehyde (ISO)

alpha-linolenic acid (EXP)

alpha-naphthoflavone (ISO)

aluminium hydroxide (ISO)

aluminium oxide (ISO)

AM6545 (ISO)

ambroxol (EXP)

amiloride (EXP,ISO)

amiodarone (ISO)

amitrole (ISO)

amlexanox (ISO)

amlodipine (EXP)

ammonium chloride (EXP)

amprenavir (ISO)

anagliptin (ISO)

andrographolide (ISO)

Anemoside B4 (ISO)

anthocyanin (ISO)

anthra[1,9-cd]pyrazol-6(2H)-one (EXP,ISO)

antimony(0) (ISO)

antimycin A (ISO)

antirheumatic drug (ISO)

apigenin (ISO)

apocynin (ISO)

Archazolid B (ISO)

argatroban (ISO)

aripiprazole (ISO)

aristolochic acid A (EXP)

aristolochic acids (ISO)

Aroclor 1254 (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

arsenous acid (EXP,ISO)

asbestos (ISO)

aspalathin (ISO)

aspartame (ISO)

astressin 2B (ISO)

atazanavir sulfate (ISO)

atorvastatin calcium (EXP,ISO)

atrazine (EXP)

aurantio-obtusin (ISO)

azathioprine (ISO)

azithromycin (ISO)

Azoxymethane (ISO)

Bardoxolone methyl (ISO)

baricitinib (ISO)

barium sulfate (EXP)

bathocuproine disulfonic acid (ISO)

beclomethasone (ISO)

benazepril (EXP)

benzalkonium chloride (ISO)

benzene (EXP,ISO)

benzene-1,2,4-triol (ISO)

benzethonium chloride (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

benzofurans (ISO)

benzoic acid (ISO)

benzylpenicillin (ISO)

berberine (ISO)

Bergenin (ISO)

beta-D-glucan (ISO)

beta-D-glucosamine (EXP,ISO)

beta-naphthoflavone (EXP,ISO)

betamethasone (ISO)

bezafibrate (ISO)

bicalutamide (ISO)

bis(2-chloroethyl) sulfide (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisoprolol (ISO)

bisphenol A (EXP,ISO)

Bisphenol A diglycidyl ether (ISO)

bisphenol AF (ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

bleomycin A2 (EXP,ISO)

boron nitride (ISO)

bortezomib (ISO)

BQ 123 (ISO)

brequinar (ISO)

Brevianamide A (ISO)

bromodichloromethane (ISO)

Bucillamine (ISO)

budesonide (EXP,ISO)

butanal (ISO)

Butylbenzyl phthalate (ISO)

butyric acid (EXP,ISO)

C60 fullerene (EXP)

cadmium atom (EXP,ISO)

cadmium dichloride (EXP,ISO)

cadmium selenide (ISO)

Calcimycin (ISO)

calcitriol (ISO)

calcium atom (ISO)

calcium dichloride (ISO)

calcium oxalate (EXP)

calcium silicate (EXP)

calcium(0) (ISO)

Calphostin C (ISO)

camostat (EXP)

camptothecin (ISO)

cannabidiol (ISO)

capsaicin (EXP,ISO)

capsazepine (ISO)

CARBENOXOLONE (ISO)

carbon nanotube (EXP,ISO)

carbonyl sulfide (EXP)

carmustine (ISO)

carnosine (ISO)

carrageenan (ISO)

catechol (ISO)

celecoxib (EXP,ISO)

cephaeline (ISO)

ceric oxide (EXP,ISO)

cerivastatin (ISO)

ceruletide (ISO)

CGP 52608 (ISO)

chenodeoxycholic acid (ISO)

chlorambucil (ISO)

chlornitrofen (EXP)

chlorobenzene (ISO)

chloroethene (ISO)

chloroform (ISO)

chlorogenic acid (ISO)

chloroquine (ISO)

chlorothalonil (ISO)

chlorpyrifos (EXP)

cholesterol (EXP,ISO)

choline (EXP,ISO)

chondroitin sulfate (ISO)

chromium atom (ISO)

chromium(3+) trichloride (ISO)

chromium(6+) (ISO)

chrysin 5,7-dimethyl ether (ISO)

ciguatoxin CTX1B (ISO)

cilostazol (ISO)

cimetidine (ISO)

cis-caffeic acid (ISO)

cisplatin (EXP,ISO)

citric acid (ISO)

clobenpropit (ISO)

clofibrate (ISO)

clonidine (ISO)

clonidine (amino form) (ISO)

clonidine (imino form) (ISO)

cobalt atom (ISO)

cobalt dichloride (EXP,ISO)

cocaine (EXP,ISO)

codeine (ISO)

compound 48/80 (ISO)

copper atom (EXP,ISO)

copper(0) (EXP,ISO)

copper(II) sulfate (ISO)

cordycepin (ISO)

corticosterone (EXP,ISO)

cortisol (EXP,ISO)

cortisone (ISO)

coumermycin A1 (ISO)

crocidolite asbestos (EXP,ISO)

crotonaldehyde (ISO)

CU-O LINKAGE (ISO)

cucurbitacin B (ISO)

Cuprizon (EXP,ISO)

curcumin (EXP,ISO)

cyanocob(III)alamin (EXP)

cycloheximide (ISO)

cyclophosphamide (EXP,ISO)

cyclosporin A (EXP,ISO)

cyhalothrin (EXP)

D-glucosamine (EXP,ISO)

D-glucose (EXP,ISO)

dantrolene (EXP)

dapagliflozin (EXP)

daunorubicin (ISO)

DDE (ISO)

Decursin (ISO)

deferiprone (EXP,ISO)

deguelin (EXP)

deoxycholic acid (ISO)

Deoxycorticosterone acetate (EXP)

deoxynivalenol (ISO)

dequalinium (ISO)

desferrioxamine B (EXP)

dexamethasone (EXP,ISO)

dexmedetomidine (ISO)

dextran sulfate (ISO)

dextromethorphan (ISO)

diallyl disulfide (ISO)

diallyl trisulfide (ISO)

diarsenic trioxide (EXP,ISO)

dibenziodolium (ISO)

dibutyl phthalate (EXP,ISO)

dichlorine (ISO)

dichloroacetic acid (ISO)

dichromium trioxide (ISO)

diclofenac (EXP,ISO)

Didecyldimethylammonium (ISO)

dienogest (ISO)

diethyl phthalate (ISO)

diethylstilbestrol (EXP,ISO)

digitoxigenin (ISO)

digitoxin (ISO)

digoxigenin (ISO)

digoxin (ISO)

diisobutyl phthalate (ISO)

diisononyl phthalate (ISO)

diisopropyl fluorophosphate (EXP,ISO)

dimemorfan (EXP,ISO)

dimethoate (ISO)

dimethyl fumarate (ISO)

dimethyl sulfoxide (EXP,ISO)

dimethyl-(phenylmethyl)-[2-[2-[4-(2,4,4-trimethylpentan-2-yl)phenoxy]ethoxy]ethyl]ammonium (ISO)

dimethylarsinous acid (ISO)

diminazene diaceturate (ISO)

dinitrogen (ISO)

diosgenin (ISO)

dioxygen (EXP,ISO)

diphenyl diselenide (EXP)

diprotium oxide (EXP,ISO)

dipyridamole (EXP,ISO)

disulfiram (ISO)

dobutamine (ISO)

dodecyldimethylamine N-oxide (ISO)

dorsomorphin (ISO)

doxorubicin (EXP,ISO)

edaravone (EXP,ISO)

efavirenz (ISO)

elemental selenium (ISO)

ellagic acid (ISO)

emetine (ISO)

enalapril (EXP,ISO)

endosulfan (EXP)

entinostat (ISO)

enzacamene (ISO)

ergosta-4,6,8(14),22-tetraen-3-one (ISO)

ergosterol (EXP)

eriodictyol (ISO)

erlotinib hydrochloride (ISO)

erythromycin A (ISO)

esculetin (ISO)

ethambutol (EXP)

ethanol (EXP,ISO)

ethionamide (EXP)

Ethyl icosapentate (ISO)

ethylene glycol (EXP,ISO)

ethylisopropylamiloride (ISO)

eugenol (ISO)

eupatilin (ISO)

euxanthone (ISO)

fasudil (ISO)

febuxostat (ISO)

felodipine (ISO)

fenbendazole (ISO)

fenofibrate (ISO)

fentanyl (EXP)

fenthion (EXP)

fenvalerate (EXP,ISO)

ferric oxide (EXP,ISO)

ferroheme b (ISO)

ferulic acid (ISO)

Fidarestat (ISO)

fingolimod hydrochloride (ISO)

fipronil (EXP)

flavokawain B (ISO)

flavone (ISO)

flavonoids (EXP)

florfenicol (ISO)

flucloxacillin (ISO)

fludrocortisone (ISO)

flumequine (ISO)

fluoranthene (ISO)

fluoxetine (ISO)

Fluridone (ISO)

flutamide (EXP)

fluticasone (ISO)

fluvastatin (EXP)

fluvoxamine (ISO)

folic acid (EXP,ISO)

formaldehyde (ISO)

fructose (EXP,ISO)

fulvestrant (ISO)

furan (EXP)

Fusarenone X (ISO)

gadodiamide hydrate (EXP,ISO)

gadolinium trichloride (EXP)

gallic acid (EXP,ISO)

Garcinol (ISO)

gefitinib (ISO)

gemcitabine (ISO)

gemfibrozil (EXP)

genistein (EXP,ISO)

gentamycin (EXP,ISO)

Gingerenone A (ISO)

glucagon (ISO)

glucose (EXP,ISO)

glutathione (ISO)

glycerol (ISO)

glycidol (EXP)

glycine betaine (EXP)

glycochenodeoxycholic acid (ISO)

glycocholic acid (ISO)

glycodeoxycholic acid (ISO)

glycyrrhizinic acid (ISO)

glyoxylic acid (EXP)

glyphosate (ISO)

gold atom (ISO)

gold(0) (ISO)

gossypol (ISO)

graphene oxide (ISO)

graphite (EXP,ISO)

GW 4064 (ISO)

GW 501516 (ISO)

GW 6471 (EXP)

GW 7647 (ISO)

gypenoside LXXV (ISO)

halothane (EXP)

harmaline (ISO)

heme b (ISO)

hemin (ISO)

heparin (EXP)

hesperetin (ISO)

Hexachloro-1,3-butadiene (EXP)

hexadecanoic acid (EXP,ISO)

Hexadimethrine bromide (EXP)

histamine (ISO)

homocysteine (ISO)

Honokiol (EXP)

HU-308 (ISO)

hydrochlorothiazide (EXP)

hydrogen chloride (EXP)

hydrogen peroxide (ISO)

hydrogen sulfide (ISO)

hydroquinone (ISO)

hydroxamic acid (EXP)

hydroxychloroquine (ISO)

ibuprofen (ISO)

icosanoid (EXP)

imidacloprid (ISO)

imiquimod (ISO)

indinavir (ISO)

indometacin (EXP,ISO)

indoxyl sulfate (EXP,ISO)

iodixanol (ISO)

iodoacetic acid (ISO)

iohexol (ISO)

ionomycin (ISO)

irbesartan (ISO)

iron atom (EXP,ISO)

iron(0) (EXP,ISO)

iron(III) citrate (ISO)

Isoangustone A (ISO)

isoeugenol (ISO)

isoflurane (EXP)

isoprenaline (ISO)

isotretinoin (EXP)

ivermectin (ISO)

Jujuboside A (ISO)

kaempferol (EXP,ISO)

kaempferol 3-O-beta-D-glucoside (ISO)

kainic acid (EXP)

ketoconazole (EXP,ISO)

L-arginine (ISO)

L-ascorbic acid (ISO)

L-methionine (EXP,ISO)

lanatoside C (ISO)

lead diacetate (ISO)

lead(0) (EXP,ISO)

Leonurine (ISO)

leptomycin B (ISO)

leukotriene B4 (ISO)

leukotriene C4 (ISO)

lidocaine (ISO)

lignin (ISO)

limonin (ISO)

linoleic acid (ISO)

linuron (ISO)

lipoic acid (ISO)

lipopolysaccharide (EXP,ISO)

lipoteichoic acid (EXP,ISO)

liquiritigenin (EXP,ISO)

liquiritin (EXP,ISO)

lithium chloride (ISO)

loganin (ISO)

loliolide (ISO)

lopinavir (ISO)

lorcaserin (ISO)

losartan (EXP,ISO)

luteolin (ISO)

LY294002 (ISO)

m-xylene (EXP,ISO)

madecassoside (EXP)

magnesium atom (ISO)

manganese atom (EXP)

manganese(0) (EXP)

manganese(II) chloride (EXP,ISO)

mangiferin (ISO)

manidipine (EXP)

mebendazole (ISO)

Mecamylamine (EXP)

mechlorethamine (EXP)

meclocycline (ISO)

medroxyprogesterone acetate (EXP)

MeIQx (ISO)

melamine (ISO)

melatonin (ISO)

mephedrone (EXP)

mercury dichloride (EXP,ISO)

mesalamine (ISO)

metam (ISO)

metformin (EXP,ISO)

methadone (EXP)

methapyrilene (EXP)

methimazole (EXP,ISO)

methionine sulfoximine (ISO)

methotrexate (EXP,ISO)

methoxyacetic acid (EXP)

methoxychlor (ISO)

methyl beta-cyclodextrin (ISO)

methyl methacrylate (ISO)

methyl salicylate (ISO)

Methylbenzethonium chloride (ISO)

methylglyoxal (ISO)

methylmercury chloride (ISO)

metyrapone (EXP)

mevalonic acid (ISO)

microcystin-LR (ISO)

midazolam (ISO)

mifepristone (EXP)

minocycline (ISO)

mitomycin C (ISO)

MJN110 (ISO)

MK 571 (ISO)

mono(2-ethyl-5-oxohexyl) phthalate (ISO)

mono(2-ethylhexyl) phthalate (EXP,ISO)

monobenzyl phthalate (ISO)

Monobutylphthalate (ISO)

monocrotaline (EXP)

monoethyl phthalate (ISO)

monosodium L-glutamate (ISO)

montelukast (EXP,ISO)

morin (EXP)

morphine (EXP)

Morroniside (ISO)

Muraglitazar (EXP)

mycophenolic acid (EXP)

mycotoxin (ISO)

myricitrin (ISO)

N(gamma)-nitro-L-arginine methyl ester (EXP,ISO)

N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine (ISO)

N,N-dimethylformamide (ISO)

N,O-dimethyltyramine (ISO)

N-[2-(4-bromocinnamylamino)ethyl]isoquinoline-5-sulfonamide (ISO)

N-acetyl-L-cysteine (EXP,ISO)

N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (EXP,ISO)

N-ethyl-5'-carboxamidoadenosine (ISO)

N-methyl-N-nitrosourea (EXP,ISO)

N-nitrosodiethylamine (EXP)

N-nitrosodimethylamine (EXP)

N-tosyl-L-phenylalanyl chloromethyl ketone (EXP,ISO)

naloxone (ISO)

naphthalene (ISO)

naphthalenes (EXP)

naproxen (EXP)

naringin (EXP,ISO)

nebivolol (ISO)

nelfinavir (ISO)

neocuproine (ISO)

neoechinulin A (ISO)

neohesperidin (ISO)

nickel atom (EXP,ISO)

nickel dichloride (ISO)

nickel subsulfide (ISO)

nickel sulfate (ISO)

niclosamide (EXP,ISO)

nicotinamide (ISO)

nicotine (EXP,ISO)

nicotinic acid (EXP,ISO)

nimesulide (EXP,ISO)

nitrofen (EXP)

nitrogen dioxide (ISO)

nitroprusside (ISO)

Nivalenol (ISO)

nocodazole (ISO)

nonane (EXP)

Nonidet P-40 (ISO)

Nonylphenol (ISO)

notoginsenoside R1 (ISO)

NS-398 (ISO)

NSC 23766 (ISO)

obeticholic acid (ISO)

octadecanoic acid (ISO)

okadaic acid (ISO)

olaparib (ISO)

oleic acid (ISO)

oroxylin A (EXP)

ouabain (EXP)

oxalic acid (ISO)

oxaliplatin (EXP)

oxybutynin (ISO)

oxytetracycline (ISO)

ozone (EXP,ISO)

Pachymic acid (ISO)

paclitaxel (ISO)

palmatine (ISO)

paracetamol (EXP,ISO)

paraquat (EXP,ISO)

paricalcitol (EXP,ISO)

parthenolide (EXP,ISO)

PCB138 (ISO)

PD 168393 (ISO)

PD123319 (EXP)

pemetrexed (ISO)

pentachlorophenol (ISO)

pentanal (ISO)

Pentoxifylline (EXP,ISO)

peptidoglycan (ISO)

perfluorononanoic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP,ISO)

perindopril (ISO)

permethrin (ISO)

PF-956980 (ISO)

phenethyl caffeate (ISO)

phenethyl isothiocyanate (ISO)

phenformin (EXP)

phenobarbital (EXP)

phenol (ISO)

phentermine (ISO)

phenylarsine oxide (ISO)

phenylephrine (EXP)

phenytoin (EXP)

phloretin (EXP,ISO)

phlorizin (ISO)

phorbol 13-acetate 12-myristate (ISO)

phosphatidylcholine (ISO)

phthalic anhydride (ISO)

phylloquinone (EXP)

physostigmine (ISO)

phytoestrogen (ISO)

picolinic acid (ISO)

pioglitazone (ISO)

piperidines (ISO)

pirarubicin (EXP)

pirinixic acid (ISO)

pitavastatin (ISO)

pitavastatin(1-) (ISO)

plumbagin (EXP)

poly(I:C) (EXP,ISO)

polymyxin B2 (ISO)

pomalidomide (ISO)

potassium chromate (ISO)

potassium dichromate (ISO)

pravastatin (ISO)

prednisolone (ISO)

pregnenolone 16alpha-carbonitrile (ISO)

probenecid (EXP,ISO)

probucol (ISO)

procyanidin B2 (EXP)

procyanidin B3 (ISO)

progesterone (EXP,ISO)

propan-2-ol (ISO)

propanal (ISO)

propidium (ISO)

Proscillaridin (ISO)

prostaglandin E2 (ISO)

prostaglandin I2 (ISO)

protosappanin A (ISO)

psicose (ISO)

puromycin (ISO)

Pyridostigmine bromide (ISO)

pyrrolidine dithiocarbamate (EXP,ISO)

pyrvinium (ISO)

quartz (EXP,ISO)

quercetin (EXP,ISO)

quercetin 3-O-beta-D-glucofuranoside (EXP)

quercetin 3-O-beta-D-glucopyranoside (EXP)

rac-lactic acid (ISO)

raloxifene (EXP,ISO)

ramipril (ISO)

razoxane (EXP)

reactive oxygen species (EXP,ISO)

rebaudioside A (ISO)

remdesivir (ISO)

resiquimod (ISO)

resolvin D1 (ISO)

resolvin D2 (ISO)

resveratrol (EXP,ISO)

ribavirin (ISO)

rifampicin (EXP)

rimonabant (EXP,ISO)

ritonavir (ISO)

robinin (EXP)

rofecoxib (ISO)

roflumilast (ISO)

rolipram (EXP)

rosuvastatin calcium (EXP)

rotenone (EXP,ISO)

rucaparib (ISO)

rutin (EXP,ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

S-butyl-DL-homocysteine (S,R)-sulfoximine (EXP,ISO)

salicylic acid (EXP,ISO)

Salinomycin (ISO)

Salmeterol xinafoate (ISO)

salubrinal (ISO)

Salvianolic acid A (ISO)

sarin (EXP)

saroglitazar (ISO)

sarpogrelate (ISO)

SB 203580 (EXP,ISO)

SB 431542 (ISO)

SCH772984 (EXP)

scoparone (ISO)

selenium atom (ISO)

serpentine asbestos (EXP,ISO)

sevoflurane (EXP)

silicon dioxide (EXP,ISO)

silver atom (ISO)

silver(0) (ISO)

simvastatin (EXP,ISO)

Sinomenine (ISO)

sirtinol (ISO)

SL-327 (EXP)

sodium arsenate (ISO)

sodium arsenite (EXP,ISO)

sodium atom (EXP)

sodium benzoate (ISO)

sodium chlorate (ISO)

sodium chloride (ISO)

sodium cholate (EXP,ISO)

sodium dichromate (ISO)

sodium dodecyl sulfate (ISO)

sodium fluoride (EXP)

sodium hypochlorite (ISO)

Sodium oleate (ISO)

sodium stibogluconate (ISO)

sparsentan (ISO)

SR 144528 (ISO)

stavudine (ISO)

steviol (ISO)

stevioside (ISO)

streptozocin (EXP,ISO)

styrene (ISO)

succimer (ISO)

sucrose (ISO)

sulfaphenazole (ISO)

sulfapyridine (ISO)

sulfasalazine (EXP)

sulforaphane (ISO)

sulfur dioxide (EXP)

sumatriptan (EXP)

sunitinib (ISO)

superoxide (ISO)

tacrolimus hydrate (EXP,ISO)

tagatose (ISO)

tamoxifen (EXP,ISO)

tartrazine (ISO)

taurocholic acid (ISO)

telmisartan (EXP,ISO)

temozolomide (ISO)

terameprocol (ISO)

terbinafine (ISO)

tert-butyl hydroperoxide (ISO)

Tesaglitazar (EXP)

testosterone (EXP,ISO)

Tetrachlorobisphenol A (ISO)

tetrachloromethane (EXP,ISO)

Tetramethylthiourea (ISO)

tetraphene (ISO)

tetrathiomolybdate(2-) (ISO)

thalidomide (ISO)

thapsigargin (EXP,ISO)

theophylline (ISO)

thiamethoxam (ISO)

thioacetamide (EXP,ISO)

Tiopronin (ISO)

Tiron (ISO)

titanium atom (EXP,ISO)

titanium dioxide (EXP,ISO)

TMC-120A (ISO)

tofacitinib (ISO)

Tolmetin glucuronide (ISO)

toluene (ISO)

toluene 2,4-diisocyanate (ISO)

topotecan (EXP)

trans-caffeic acid (ISO)

trans-isoeugenol (ISO)

trans-piceid (ISO)

tremolite asbestos (ISO)

triamcinolone (ISO)

tributylstannane (ISO)

trichloroethene (EXP,ISO)

triclosan (ISO)

trimellitic anhydride (ISO)

trimethyltin (ISO)

triphenylstannane (ISO)

Triptolide (ISO)

triptonide (ISO)

troglitazone (EXP,ISO)

trovafloxacin (ISO)

Tungsten carbide (ISO)

tunicamycin (ISO)

undecane (EXP)

uranium atom (EXP)

ursodeoxycholic acid (ISO)

vadimezan (ISO)

valproic acid (ISO)

valsartan (EXP,ISO)

vanadyl sulfate (EXP,ISO)

vanillin (ISO)

vemurafenib (ISO)

venetoclax (ISO)

verteporfin (ISO)

vincaleukoblastine (EXP)

vincristine (EXP,ISO)

vitamin E (ISO)

vorinostat (ISO)

water (EXP,ISO)

withaferin A (ISO)

wortmannin (ISO)

xanthohumol (ISO)

XL147 (ISO)

Y-27632 (ISO)

zalcitabine (EXP)

zidovudine (ISO)

zileuton (ISO)

zinc atom (ISO)

zinc nitrate (ISO)

zinc oxide (EXP,ISO)

zinc protoporphyrin (EXP,ISO)

zinc sulfate (ISO)

zinc(0) (ISO)

ziram (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

animal organ regeneration (IEP)

antimicrobial humoral immune response mediated by antimicrobial peptide (IBA)

astrocyte cell migration (ISO)

cellular response to ATP (IEP)

cellular response to dexamethasone stimulus (IEP)

cellular response to estradiol stimulus (IEP)

cellular response to fatty acid (IEP)

cellular response to fibroblast growth factor stimulus (ISO)

cellular response to glucose stimulus (IEP)

cellular response to high density lipoprotein particle stimulus (IEP)

cellular response to insulin stimulus (IEP)

cellular response to interleukin-1 (IEA,IEP,ISO)

cellular response to interleukin-6 (IEP)

cellular response to lipopolysaccharide (IEA,IEP,ISO)

cellular response to lipoprotein particle stimulus (IEP)

cellular response to macrophage colony-stimulating factor stimulus (IEP)

cellular response to platelet-derived growth factor stimulus (IEP)

cellular response to retinoic acid (IEP)

cellular response to tumor necrosis factor (IEA,IEP,ISO)

cellular response to type II interferon (IEA,IEP,ISO)

cellular response to xenobiotic stimulus (IEP)

chemokine (C-C motif) ligand 2 signaling pathway (IEA,ISO)

chemokine-mediated signaling pathway (IBA,IMP,ISO)

chemokinesis (TAS)

chronic inflammatory response (IEP)

cytokine-mediated signaling pathway (IMP,ISO)

cytoskeleton organization (ISO)

energy homeostasis (ISO)

eosinophil chemotaxis (IBA)

glial cell migration (IMP)

helper T cell extravasation (IEA,ISO)

immune response (IEA)

inflammatory response (IBA)

intracellular calcium ion homeostasis (IDA)

leukocyte migration involved in inflammatory response (IMP)

lymphocyte chemotaxis (IDA)

macrophage chemotaxis (IDA,ISO)

mammary gland involution (IEP)

maternal process involved in female pregnancy (IEP)

maternal process involved in parturition (IEP)

monocyte chemotaxis (ISO)

negative regulation of angiogenesis (IEA,ISO)

negative regulation of G1/S transition of mitotic cell cycle (ISO)

negative regulation of glial cell apoptotic process (ISO)

negative regulation of natural killer cell chemotaxis (ISO)

negative regulation of neuron apoptotic process (ISO)

negative regulation of vascular endothelial cell proliferation (ISO)

neutrophil chemotaxis (IMP)

osteoclast differentiation (HEP)

positive chemotaxis (IEA)

positive regulation of apoptotic cell clearance (IEA,ISO)

positive regulation of calcium ion import (ISO)

positive regulation of cell adhesion (IDA)

positive regulation of cell migration (IBA)

positive regulation of cell-cell adhesion (IDA)

positive regulation of cellular extravasation (IDA)

positive regulation of collagen biosynthetic process (IDA)

positive regulation of cytosolic calcium ion concentration (ISO)

positive regulation of endothelial cell apoptotic process (ISO)

positive regulation of endothelial cell proliferation (IMP)

positive regulation of gene expression (IEA,ISO)

positive regulation of glutamate receptor signaling pathway (IGI)

positive regulation of immune complex clearance by monocytes and macrophages (IEA,ISO)

positive regulation of leukocyte mediated cytotoxicity (IMP)

positive regulation of leukocyte migration (IDA,IMP)

positive regulation of macrophage chemotaxis (IDA,IEA,ISO)

positive regulation of monocyte chemotaxis (IDA,IEA,ISO)

positive regulation of protein targeting to membrane (IDA)

positive regulation of synaptic transmission (IDA)

positive regulation of synaptic transmission, glutamatergic (IEA,ISO,ISS)

positive regulation of T cell activation (IEA,ISO)

positive regulation of tumor necrosis factor production (IMP)

positive regulation of wound healing (IMP)

regulation of cell shape (ISO)

regulation of vascular endothelial growth factor production (IEA,ISO)

response to activity (IEP)

response to amino acid (IEP)

response to bacterium (ISO)

response to cyclosporin A (IEP)

response to ethanol (IEP)

response to gamma radiation (IEP)

response to glucocorticoid (IEP)

response to hypoxia (IEP)

response to isolation stress (IEP)

response to lipopolysaccharide (IEP)

response to mechanical stimulus (IEP)

response to progesterone (IEP)

response to tumor necrosis factor (IEP)

response to vitamin B3 (IEP)

response to wounding (ISO)

response to xenobiotic stimulus (IEP)

sensory perception of pain (IEA,ISO,ISS)

transforming growth factor beta receptor signaling pathway (IMP)

vascular endothelial growth factor receptor signaling pathway (IMP)

Cellular Component

axon terminus (IDA)

C-fiber (IDA)

dendrite (IDA)

endocytic vesicle (IDA)

extracellular region (EXP,IBA,IDA,IEA,ISO)

membrane (ISO)

neuronal cell body (IDA)

perikaryon (IDA)

perinuclear region of cytoplasm (IDA)

Molecular Function

CCR chemokine receptor binding (IBA)

CCR2 chemokine receptor binding (IEA,ISO)

chemoattractant activity (IEA,ISO)

chemokine activity (IBA,IDA,IEA,ISO,NAS,TAS)

chemokine receptor binding (ISO)

cytokine activity (IEA,ISO)

G protein-coupled receptor binding (IEA,ISO)

heparin binding (IPI)

Molecular Pathway Annotations Click to see Annotation Detail View

angiotensin II signaling pathway (IEP)

chemokine mediated signaling pathway (IEA)

granulocyte-macrophage colony-stimulating factor signaling pathway (ISO)

interleukin-23 signaling pathway (ISO)

vascular endothelial growth factor signaling pathway (IMP)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

decreased circulating creatinine level (IMP)

increased urine protein level (IMP)

salt-sensitive hypertension (IMP)

References

References - curated

#	Reference Title	Reference Citation
1.	Minocycline prevents retinal inflammation and vascular permeability following ischemia-reperfusion injury.	Abcouwer SF, etal., J Neuroinflammation. 2013 Dec 10;10:149. doi: 10.1186/1742-2094-10-149.
2.	Similar pattern of MCP-1 expression in spinal cords and eyes of Lewis rats with experimental autoimmune encephalomyelitis associated anterior uveitis.	Adamus G, etal., J Neurosci Res. 1997 Nov 15;50(4):531-8.
3.	MCP-1 promoter polymorphism in Spanish patients with systemic lupus erythematosus.	Aguilar F, etal., Tissue Antigens. 2001 Nov;58(5):335-8.
4.	ANG II receptor blockade enhances anti-inflammatory macrophages in anti-glomerular basement membrane glomerulonephritis.	Aki K, etal., Am J Physiol Renal Physiol. 2010 Apr;298(4):F870-82. Epub 2010 Jan 13.
5.	Agmatine induces gastric protection against ischemic injury by reducing vascular permeability in rats.	Al Masri AA and El Eter E, World J Gastroenterol. 2012 May 14;18(18):2188-96. doi: 10.3748/wjg.v18.i18.2188.
6.	Plasma high mobility group box 1 protein reflects fibrosis in pediatric nonalcoholic fatty liver disease.	Alisi A, etal., Expert Rev Mol Diagn. 2014 Jul;14(6):763-71. doi: 10.1586/14737159.2014.928205. Epub 2014 Jun 13.
7.	An animal model of age-related macular degeneration in senescent Ccl-2- or Ccr-2-deficient mice.	Ambati J, etal., Nat Med. 2003 Nov;9(11):1390-7. Epub 2003 Oct 19.
8.	MCP-1 gene haplotype association in biopsy proven giant cell arteritis.	Amoli MM, etal., J Rheumatol. 2005 Mar;32(3):507-10.
9.	Impact of monocyte chemoattractant protein-1 deficiency on cerebral aneurysm formation.	Aoki T, etal., Stroke. 2009 Mar;40(3):942-51. Epub 2009 Jan 22.
10.	Predictive value of interleukin-5 and monocyte chemotactic protein-1 for bacteremia in children with febrile neutropenia.	Aquino VM, etal., J Pediatr Hematol Oncol. 2012 Aug;34(6):e241-5. doi: 10.1097/MPH.0b013e31824e498d.
11.	Intraocular expression and release of high-mobility group box 1 protein in retinal detachment.	Arimura N, etal., Lab Invest. 2009 Mar;89(3):278-89. Epub 2009 Jan 12.
12.	Associations of impaired behaviors with elevated plasma chemokines in autism spectrum disorders.	Ashwood P, etal., J Neuroimmunol. 2011 Mar;232(1-2):196-9. doi: 10.1016/j.jneuroim.2010.10.025. Epub 2010 Nov 20.
13.	Elevated circulating levels of C-C chemokines in patients with congestive heart failure.	Aukrust P, etal., Circulation. 1998 Mar 31;97(12):1136-43.
14.	Maternal exposure to particulate matter increases postnatal ozone-induced airway hyperreactivity in juvenile mice.	Auten RL, etal., Am J Respir Crit Care Med. 2009 Dec 15;180(12):1218-26. Epub 2009 Sep 17.
15.	Increased presence of dendritic cells and dendritic cell chemokines in the sinus mucosa of chronic rhinosinusitis with nasal polyps and allergic fungal rhinosinusitis.	Ayers CM, etal., Int Forum Allergy Rhinol. 2011 Jul-Aug;1(4):296-302. doi: 10.1002/alr.20046. Epub 2011 Apr 11.
16.	Pharmacological inhibition of the chemokine CCL2 (MCP-1) diminishes liver macrophage infiltration and steatohepatitis in chronic hepatic injury.	Baeck C, etal., Gut. 2012 Mar;61(3):416-26. doi: 10.1136/gutjnl-2011-300304. Epub 2011 Aug 3.
17.	Effect of exercise on cardiac tissue oxidative and inflammatory mediators in chronic kidney disease.	Bai Y, etal., Am J Nephrol. 2009;29(3):213-21. Epub 2008 Sep 17.
18.	Highly regionalized neuronal expression of monocyte chemoattractant protein-1 (MCP-1/CCL2) in rat brain: evidence for its colocalization with neurotransmitters and neuropeptides.	Banisadr G, etal., J Comp Neurol. 2005 Aug 29;489(3):275-92.
19.	Constitutive neuronal expression of CCR2 chemokine receptor and its colocalization with neurotransmitters in normal rat brain: functional effect of MCP-1/CCL2 on calcium mobilization in primary cultured neurons.	Banisadr G, etal., J Comp Neurol. 2005 Nov 14;492(2):178-92.
20.	Revisiting the prognostic value of monocyte chemotactic protein 1 and interleukin-6 in the sepsis-3 era.	Barre M, etal., J Crit Care. 2018 Feb;43:21-28. doi: 10.1016/j.jcrc.2017.08.024. Epub 2017 Aug 15.
21.	Treating viral exacerbations of chronic obstructive pulmonary disease: insights from a mouse model of cigarette smoke and H1N1 influenza infection.	Bauer CM, etal., PLoS One. 2010 Oct 12;5(10):e13251.
22.	Effect of amphotericin B treatment on kinetics of cytokines and parameters of fungal load in neutropenic rats with invasive pulmonary aspergillosis.	Becker MJ, etal., J Antimicrob Chemother. 2003 Sep;52(3):428-34. Epub 2003 Aug 13.
23.	MCP-1 and CCR2 gene variants in oral squamous cell carcinoma.	Bektas-Kayhan K, etal., Oral Dis. 2012 Jan;18(1):55-9. doi: 10.1111/j.1601-0825.2011.01843.x. Epub 2011 Aug 24.
24.	Delayed functional expression of neuronal chemokine receptors following focal nerve demyelination in the rat: a mechanism for the development of chronic sensitization of peripheral nociceptors.	Bhangoo S, etal., Mol Pain. 2007 Dec 12;3:38.
25.	MCP-1 but not CINC synthesis is increased in rat pancreatic acini in response to cerulein hyperstimulation.	Bhatia M, etal., Am J Physiol Gastrointest Liver Physiol 2002 Jan;282(1):G77-85.
26.	Nonsteroidal anti-inflammatory drug induces proinflammatory damage in gastric mucosa through NF-kappaB activation and neutrophil infiltration: anti-inflammatory role of heme oxygenase-1 against nonsteroidal anti-inflammatory drug.	Bindu S, etal., Free Radic Biol Med. 2013 Dec;65:456-67. doi: 10.1016/j.freeradbiomed.2013.07.027. Epub 2013 Jul 23.
27.	Low plasma levels of monocyte chemoattractant protein-1 (MCP-1), tumor necrosis factor-alpha (TNFalpha), and vascular endothelial growth factor (VEGF) in patients with alpha1-antitrypsin deficiency-related fibromyalgia.	Blanco I, etal., Clin Rheumatol. 2010 Feb;29(2):189-97. doi: 10.1007/s10067-009-1318-5. Epub 2009 Nov 19.
28.	Imbalanced Host Response to SARS-CoV-2 Drives Development of COVID-19.	Blanco-Melo D, etal., Cell. 2020 May 28;181(5):1036-1045.e9. doi: 10.1016/j.cell.2020.04.026. Epub 2020 May 15.
29.	Antifungal and airway remodeling roles for murine monocyte chemoattractant protein-1/CCL2 during pulmonary exposure to Asperigillus fumigatus conidia.	Blease K, etal., J Immunol. 2001 Feb 1;166(3):1832-42.
30.	Chemokine MCP1/CCL2 gene polymorphism influences Henoch-Schonlein purpura susceptibility in Iranian Azeri-Turkish patients.	Bonyadi M, etal., Int J Dermatol. 2015 Nov;54(11):1269-74. doi: 10.1111/ijd.12940. Epub 2015 Jul 30.
31.	TNFalpha inhibits apoptotic cell clearance in the lung, exacerbating acute inflammation.	Borges VM, etal., Am J Physiol Lung Cell Mol Physiol. 2009 Oct;297(4):L586-95. Epub 2009 Jul 31.
32.	Vascular endothelial growth factor and monocyte chemoattractant protein-1 in Behcet's patients with venous thrombosis.	Bozoglu E, etal., Clin Exp Rheumatol. 2005 Jul-Aug;23(4 Suppl 38):S42-8.
33.	Expression of the chemokines MCP-1/JE and cytokine-induced neutrophil chemoattractant in early acute pancreatitis.	Brady M, etal., Pancreas 2002 Oct;25(3):260-9.
34.	Production of monocyte chemotactic protein-1 by rat brain macrophages.	Calvo CF, etal., Eur J Neurosci. 1996 Aug;8(8):1725-34.
35.	Lung inflammation is induced by renal ischemia and reperfusion injury as part of the systemic inflammatory syndrome.	Campanholle G, etal., Inflamm Res. 2010 Oct;59(10):861-9. Epub 2010 Apr 16.
36.	Central nervous system injury triggers hepatic CC and CXC chemokine expression that is associated with leukocyte mobilization and recruitment to both the central nervous system and the liver.	Campbell SJ, etal., Am J Pathol. 2005 May;166(5):1487-97.
37.	Expression of caveolin-1 in human adipose tissue is upregulated in obesity and obesity-associated type 2 diabetes mellitus and related to inflammation.	Catalan V, etal., Clin Endocrinol (Oxf). 2008 Feb;68(2):213-9. Epub 2007 Sep 4.
38.	The MCP-1 -2518 (A to G) single nucleotide polymorphism is not associated with myocardial infarction in the Czech population.	Cermakova Z, etal., Int J Immunogenet. 2005 Oct;32(5):315-8.
39.	Sequential evaluation of serum monocyte chemotactic protein 1 among asymptomatic state and acute exacerbation and remission of asthma in children.	Chan CK, etal., J Asthma. 2009 Apr;46(3):225-8.
40.	Monocyte chemoattractant protein-1 released from alveolar macrophages mediates the systemic inflammation of acute alveolar hypoxia.	Chao J, etal., Am J Respir Cell Mol Biol. 2011 Jul;45(1):53-61. doi: 10.1165/rcmb.2010-0264OC. Epub 2010 Sep 2.
41.	Monocyte chemoattractant protein-1 is expressed in pancreatic islets from prediabetic NOD mice and in interleukin-1 beta-exposed human and rat islet cells.	Chen MC, etal., Diabetologia. 2001 Mar;44(3):325-32.
42.	Role of macrophage infiltration in the orbital fat of patients with Graves' ophthalmopathy.	Chen MH, etal., Clin Endocrinol (Oxf). 2008 Aug;69(2):332-7. doi: 10.1111/j.1365-2265.2008.03219.x. Epub 2008 Feb 12.
43.	CCR2-64I gene polymorphism increase susceptibility to oral cancer.	Chen MK, etal., Oral Oncol. 2011 Jul;47(7):577-82. doi: 10.1016/j.oraloncology.2011.04.008. Epub 2011 May 12.
44.	Cytokine-chemokine networks in experimental mycobacterial and schistosomal pulmonary granuloma formation.	Chiu BC, etal., Am J Respir Cell Mol Biol. 2003 Jul;29(1):106-16. Epub 2003 Jan 10.
45.	The chemokine CCL2 activates p38 mitogen-activated protein kinase pathway in cultured rat hippocampal cells.	Cho J and Gruol DL, J Neuroimmunol. 2008 Aug 13;199(1-2):94-103. Epub 2008 Jun 27.
46.	NIACIN AMELIORATES OXIDATIVE STRESS, INFLAMMATION, PROTEINURIA, AND HYPERTENSION IN RATS WITH CHRONIC RENAL FAILURE.	Cho KH, etal., Am J Physiol Renal Physiol. 2009 May 6.
47.	Effect of Sipjeondaebo-tang on cancer-induced anorexia and cachexia in CT-26 tumor-bearing mice.	Choi YK, etal., Mediators Inflamm. 2014;2014:736563. doi: 10.1155/2014/736563. Epub 2014 May 14.
48.	An investigation of the inflammatory cytokine and chemokine network in systemic sclerosis.	Codullo V, etal., Ann Rheum Dis. 2011 Jun;70(6):1115-21. Epub 2011 Feb 1.
49.	HIV-infected patients with lipodystrophy have higher rates of carotid atherosclerosis: the role of monocyte chemoattractant protein-1.	Coll B, etal., Cytokine. 2006 Apr;34(1-2):51-5. Epub 2006 May 12.
50.	Production and effects of alpha-melanocyte-stimulating hormone during acute lung injury.	Colombo G, etal., Shock. 2007 Mar;27(3):326-33.
51.	HMGB1 neuroimmune signaling and REST-G9a gene repression contribute to ethanol-induced reversible suppression of the cholinergic neuron phenotype.	Crews FT, etal., Mol Psychiatry. 2023 Dec;28(12):5159-5172. doi: 10.1038/s41380-023-02160-6. Epub 2023 Jul 4.
52.	Induction of mast cell activation and CC chemokine responses in remodeling tracheal allografts.	Cruz AC, etal., Am J Respir Cell Mol Biol. 2004 Aug;31(2):154-61. Epub 2004 Apr 1.
53.	Monocyte chemoattractant protein 1 (MCP-1) expression occurs in toxic rat liver injury and human liver disease.	Czaja MJ, etal., J Leukoc Biol. 1994 Jan;55(1):120-6.
54.	Angiotensin AT1 receptor antagonists exert anti-inflammatory effects in spontaneously hypertensive rats.	Dai Q, etal., Br J Pharmacol. 2007 Dec;152(7):1042-8. Epub 2007 Oct 8.
55.	Spinal CCL2 pronociceptive action is no longer effective in CCR2 receptor antagonist-treated rats.	Dansereau MA, etal., J Neurochem. 2008 Jul;106(2):757-69. Epub 2008 Apr 17.
56.	Microglia and macrophages are increased in response to ischemia-induced retinopathy in the mouse retina.	Davies MH, etal., Mol Vis. 2006 May 10;12:467-77.
57.	ETS-1 and ETS-2 are upregulated in a transgenic mouse model of pigmented ocular neoplasm.	De la Houssaye G, etal., Mol Vis. 2008;14:1912-28. Epub 2008 Oct 29.
58.	FT011, a Novel Cardiorenal Protective Drug, Reduces Inflammation, Gliosis and Vascular Injury in Rats with Diabetic Retinopathy.	Deliyanti D, etal., PLoS One. 2015 Jul 29;10(7):e0134392. doi: 10.1371/journal.pone.0134392. eCollection 2015.
59.	Systemic inflammation without gliosis mediates cognitive deficits through impaired BDNF expression in bile duct ligation model of hepatic encephalopathy.	Dhanda S, etal., Brain Behav Immun. 2018 May;70:214-232. doi: 10.1016/j.bbi.2018.03.002. Epub 2018 Mar 5.
60.	MCP-1, CCR2 and CCR5 polymorphisms in Tunisian patients with atopic asthma.	Dhaouadi T, etal., Iran J Allergy Asthma Immunol. 2013 Mar;12(1):29-36. doi: 012.01/ijaai.2936.
61.	Xanthohumol ameliorates atherosclerotic plaque formation, hypercholesterolemia, and hepatic steatosis in ApoE-deficient mice.	Doddapattar P, etal., Mol Nutr Food Res. 2013 Oct;57(10):1718-28. doi: 10.1002/mnfr.201200794. Epub 2013 May 3.
62.	Angiotensin AT1 receptor antagonist irbesartan decreases lesion size, chemokine expression, and macrophage accumulation in apolipoprotein E-deficient mice.	Dol F, etal., J Cardiovasc Pharmacol. 2001 Sep;38(3):395-405.
63.	Upregulation of retinal neuronal MCP-1 in the rodent model of diabetic retinopathy and its function in vitro.	Dong N, etal., Invest Ophthalmol Vis Sci. 2012 Nov 9;53(12):7567-75. doi: 10.1167/iovs.12-9446.
64.	Retinal neuronal MCP-1 induced by AGEs stimulates TNF-alpha expression in rat microglia via p38, ERK, and NF-kappaB pathways.	Dong N, etal., Mol Vis. 2014 May 2;20:616-28. eCollection 2014.
65.	Monocyte chemoattractant protein 1 (MCP-1/CCL2) contributes to thymus atrophy in acute myeloid leukemia.	Driss V, etal., Eur J Immunol. 2015 Feb;45(2):396-406. doi: 10.1002/eji.201444736. Epub 2014 Dec 4.
66.	High-mobility group box-1 and biomarkers of inflammation in the vitreous from patients with proliferative diabetic retinopathy.	El-Asrar AM, etal., Mol Vis. 2011;17:1829-38. Epub 2011 Jul 6.
67.	TNF-alpha inhibition reduces renal injury in DOCA-salt hypertensive rats.	Elmarakby AA, etal., Am J Physiol Regul Integr Comp Physiol. 2008 Jan;294(1):R76-83. Epub 2007 Nov 7.
68.	Expression of chemokine and receptors in Lewis rats with experimental autoimmune anterior uveitis.	Fang IM, etal., Exp Eye Res. 2004 Jun;78(6):1043-55.
69.	The role of the beta chemokines in experimental obliterative bronchiolitis.	Farivar AS, etal., Exp Mol Pathol. 2003 Dec;75(3):210-6.
70.	The role of C-C motif chemokine ligand 2 in the preservation of myogenic tone in the kidney microvasculature of Dahl Salt-Sensitive rats.	Feng W, etal., Kidney Int. 2026 Jun;109(6):1155-1172. doi: 10.1016/j.kint.2026.02.019. Epub 2026 Mar 14.
71.	Serum concentrations and peripheral secretion of the beta chemokines monocyte chemoattractant protein 1 and macrophage inflammatory protein 1alpha in alcoholic liver disease.	Fisher NC, etal., Gut. 1999 Sep;45(3):416-20. doi: 10.1136/gut.45.3.416.
72.	Proinflammatory genetic profiles in subjects with history of ischemic stroke.	Flex A, etal., Stroke. 2004 Oct;35(10):2270-5. Epub 2004 Aug 12.
73.	Pulmonary granuloma formation in the rat is partially dependent on monocyte chemoattractant protein 1.	Flory CM, etal., Lab Invest. 1993 Oct;69(4):396-404.
74.	Immune-compromised state in the rat pancreas after chronic alcohol exposure: the role of peroxisome proliferator-activated receptor gamma.	Fortunato F, etal., J Pathol. 2007 Dec;213(4):441-52.
75.	Inflammation Profiling of Critically Ill Coronavirus Disease 2019 Patients.	Fraser DD, etal., Crit Care Explor. 2020 Jun 22;2(6):e0144. doi: 10.1097/CCE.0000000000000144. eCollection 2020 Jun.
76.	Urinary MCP-1/creatinine in Henoch-Schonlein purpura and its relationship with nephritis.	Fuentes Y, etal., Pediatr Nephrol. 2014 Jun;29(6):1047-52. doi: 10.1007/s00467-013-2740-0. Epub 2014 Jan 12.
77.	Monocyte chemotactic and activating factor/monocyte chemoattractant protein-1-mediated histamine release from human nasal mucosa.	Fujikura T and Otsuka H, Arch Otolaryngol Head Neck Surg. 1998 Dec;124(12):1331-5.
78.	Association of vitreous inflammatory factors with diabetic macular edema.	Funatsu H, etal., Ophthalmology. 2009 Jan;116(1):73-9.
79.	Enhanced expression and production of monocyte chemoattractant protein-1 in myocarditis.	Fuse K, etal., Clin Exp Immunol. 2001 Jun;124(3):346-52.
80.	Monocyte chemoattractant protein-1 is a mediator of acute excitotoxic injury in neonatal rat brain.	Galasso JM, etal., Neuroscience. 2000;101(3):737-44.
81.	Joint effect of MCP-1 genotype GG and MMP-1 genotype 2G/2G increases the likelihood of developing pulmonary tuberculosis in BCG-vaccinated individuals.	Ganachari M, etal., PLoS One. 2010 Jan 25;5(1):e8881.
82.	Spinal injection of TNF-alpha-activated astrocytes produces persistent pain symptom mechanical allodynia by releasing monocyte chemoattractant protein-1.	Gao YJ, etal., Glia. 2010 Nov 15;58(15):1871-80. doi: 10.1002/glia.21056.
83.	Adenosine A2A receptor activation and macrophage-mediated experimental glomerulonephritis.	Garcia GE, etal., FASEB J. 2008 Feb;22(2):445-54. Epub 2007 Sep 26.
84.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
85.	Expression of monocyte chemoattractant protein-1 and macrophage colony-stimulating factor in normal and inflamed rat testis.	Gerdprasert O, etal., Mol Hum Reprod 2002 Jun;8(6):518-24.
86.	Costimulation of fibroblast collagen and transforming growth factor beta1 gene expression by monocyte chemoattractant protein-1 via specific receptors.	Gharaee-Kermani M, etal., J Biol Chem. 1996 Jul 26;271(30):17779-84.
87.	DNA-dependent protein kinase inhibition blocks asthma in mice and modulates human endothelial and CD4(+) T-cell function without causing severe combined immunodeficiency.	Ghonim MA, etal., J Allergy Clin Immunol. 2015 Feb;135(2):425-40. doi: 10.1016/j.jaci.2014.09.005. Epub 2014 Oct 19.
88.	Monocyte chemoattractant protein-1 has prosclerotic effects both in a mouse model of experimental diabetes and in vitro in human mesangial cells.	Giunti S, etal., Diabetologia. 2008 Jan;51(1):198-207. Epub 2007 Oct 30.
89.	Mechanisms of host defense following severe acute respiratory syndrome-coronavirus (SARS-CoV) pulmonary infection of mice.	Glass WG, etal., J Immunol. 2004 Sep 15;173(6):4030-9. doi: 10.4049/jimmunol.173.6.4030.
90.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
91.	Critical protective role for MCP-1 in pneumonic Burkholderia mallei infection.	Goodyear A, etal., J Immunol. 2010 Feb 1;184(3):1445-54. Epub 2009 Dec 30.
92.	Synergistic induction of monocyte chemoattractant protein-1 (MCP-1) by platelet-derived growth factor and interleukin-1.	Goppelt-Struebe M and Stroebel M, FEBS Lett. 1995 Nov 6;374(3):375-8.
93.	Time course of chemokine expression in acutely rejecting rat kidneys.	Grau V, etal., Transplant Proc 1999 May;31(3):1571.
94.	Acute and persisting Th2-like immune response after fractionated colorectal gamma-irradiation.	Gremy O, etal., World J Gastroenterol. 2008 Dec 14;14(46):7075-85.
95.	Concentration of interferon-inducible T cell chemoattractant and monocyte chemotactic protein-1 in serum and cerebrospinal fluid of patients with Lyme borreliosis.	Grygorczuk S, etal., Rocz Akad Med Bialymst. 2005;50:173-8.
96.	Monocyte chemoattractant protein-1 (MCP-1/CCL2) in experimental autoimmune orchitis.	Guazzone VA, etal., J Reprod Immunol 2003 Dec;60(2):143-57.
97.	Chemokine signaling involving chemokine (C-C motif) ligand 2 plays a role in descending pain facilitation.	Guo W, etal., Neurosci Bull. 2012 Apr;28(2):193-207. doi: 10.1007/s12264-012-1218-6.
98.	Relationship among MIF, MCP-1, viral loads, and HBs Ag levels in chronic hepatitis B patients.	Güneş H, etal., Turk J Med Sci. 2015;45(3):634-7.
99.	Cytokine regulation of MCP-1 expression in brain and retinal microvascular endothelial cells.	Harkness KA, etal., J Neuroimmunol. 2003 Sep;142(1-2):1-9.
100.	Serum chemokine and cytokine levels as indicators of disease activity in patients with systemic sclerosis.	Hasegawa M, etal., Clin Rheumatol. 2011 Feb;30(2):231-7. Epub 2010 Nov 4.
101.	A SARS-CoV-2 Infection Model in Mice Demonstrates Protection by Neutralizing Antibodies.	Hassan AO, etal., Cell. 2020 Jun 10. pii: S0092-8674(20)30742-X. doi: 10.1016/j.cell.2020.06.011.
102.	Phagocytic activity and monocyte chemotactic protein expression by pulmonary macrophages in persistent pulmonary cryptococcosis.	He W, etal., Infect Immun 2003 Feb;71(2):930-6.
103.	22-Oxacalcitriol prevents progression of peritoneal fibrosis in a mouse model.	Hirose M, etal., Perit Dial Int. 2013 Mar-Apr;33(2):132-42. doi: 10.3747/pdi.2011.00234. Epub 2012 Oct 2.
104.	Sialic Acid Reduces Acute Endotoxemia-induced Liver Dysfunction in the Rat.	Ho CH, etal., Shock. 2008 Dec 4.
105.	The pathogenesis of pulmonary contusion: an open chest model in the rat.	Hoth JJ, etal., J Trauma. 2006 Jul;61(1):32-44; discussion 44-5.
106.	Monocyte chemoattractant protein-1 -2518 A/G single nucleotide polymorphism in Chinese Han patients with ocular Behcet's disease.	Hou S, etal., Hum Immunol. 2010 Jan;71(1):79-82. doi: 10.1016/j.humimm.2009.09.354. Epub .
107.	Involvement of spinal monocyte chemoattractant protein-1 (MCP-1) in cancer-induced bone pain in rats.	Hu JH, etal., Neurosci Lett. 2012 May 23;517(1):60-3. doi: 10.1016/j.neulet.2012.04.026. Epub 2012 Apr 15.
108.	Clinical features of patients infected with 2019 novel coronavirus in Wuhan, China.	Huang C, etal., Lancet. 2020 Feb 15;395(10223):497-506. doi: 10.1016/S0140-6736(20)30183-5. Epub 2020 Jan 24.
109.	An interferon-gamma-related cytokine storm in SARS patients.	Huang KJ, etal., J Med Virol. 2005 Feb;75(2):185-94. doi: 10.1002/jmv.20255.
110.	Inhibition of microRNA-210 suppresses pro-inflammatory response and reduces acute brain injury of ischemic stroke in mice.	Huang L, etal., Exp Neurol. 2018 Feb;300:41-50. doi: 10.1016/j.expneurol.2017.10.024. Epub 2017 Oct 27.
111.	Chronic ethanol ingestion induces aortic inflammation/oxidative endothelial injury and hypertension in rats.	Husain K, etal., Hum Exp Toxicol. 2010 Oct 4.
112.	The therapeutic effect of nano-encapsulated and nano-emulsion forms of carvacrol on experimental liver fibrosis.	Hussein J, etal., Biomed Pharmacother. 2017 Jun;90:880-887. doi: 10.1016/j.biopha.2017.04.020. Epub 2017 Apr 21.
113.	Homocysteine stimulates monocyte chemoattractant protein-1 expression in the kidney via nuclear factor-kappaB activation.	Hwang SY, etal., Am J Physiol Renal Physiol. 2008 Jan;294(1):F236-44. Epub 2007 Oct 31.
114.	Captopril suppresses inflammation in endotoxin-induced uveitis in rats.	Ilieva I, etal., Exp Eye Res. 2006 Sep;83(3):651-7. Epub 2006 May 12.
115.	Blocking of monocyte chemoattractant protein-1 (MCP-1) activity attenuates the severity of acute pancreatitis in rats.	Ishibashi T, etal., J Gastroenterol. 2008;43(1):79-85. Epub 2008 Feb 24.
116.	Morphological and functional characterization of non-alcoholic fatty liver disease induced by a methionine-choline-deficient diet in C57BL/6 mice.	Itagaki H, etal., Int J Clin Exp Pathol. 2013 Nov 15;6(12):2683-96. eCollection 2013.
117.	Hypoxic-ischemic injury induces monocyte chemoattractant protein-1 expression in neonatal rat brain.	Ivacko J, etal., J Cereb Blood Flow Metab. 1997 Jul;17(7):759-70.
118.	Assessment of genetic effects of polymorphisms in the MCP-1 gene on serum MCP-1 levels and myocardial infarction in Japanese.	Iwai N, etal., Circ J. 2006 Jul;70(7):805-9.
119.	Acute Respiratory Infection in Human Dipeptidyl Peptidase 4-Transgenic Mice Infected with Middle East Respiratory Syndrome Coronavirus.	Iwata-Yoshikawa N, etal., J Virol. 2019 Mar 5;93(6). pii: JVI.01818-18. doi: 10.1128/JVI.01818-18. Print 2019 Mar 15.
120.	Curcumin supplementation lowers TNF-alpha, IL-6, IL-8, and MCP-1 secretion in high glucose-treated cultured monocytes and blood levels of TNF-alpha, IL-6, MCP-1, glucose, and glycosylated hemoglobin in diabetic rats.	Jain SK, etal., Antioxid Redox Signal. 2009 Feb;11(2):241-9.
121.	Distinct chemokine and cytokine gene expression pattern of murine dendritic cells and macrophages in response to Mycobacterium tuberculosis infection.	Jang S, etal., J Leukoc Biol. 2008 Nov;84(5):1264-70. Epub 2008 Aug 14.
122.	Upregulation of monocyte chemotactic protein-1 and CC chemokine receptor 2 in the central nervous system is closely associated with relapse of autoimmune encephalomyelitis in Lewis rats.	Jee Y, etal., J Neuroimmunol. 2002 Jul;128(1-2):49-57.
123.	Association of monocyte chemoattractant protein-1 (MCP-1) 2518A/G polymorphism with proliferative diabetic retinopathy in Korean type 2 diabetes.	Jeon HJ, etal., Yonsei Med J. 2013 May 1;54(3):621-5. doi: 10.3349/ymj.2013.54.3.621.
124.	Expression of monocyte chemoattractant protein-1 in rat dorsal root ganglia and spinal cord in experimental models of neuropathic pain.	Jeon SM, etal., Brain Res. 2009 Jan 28;1251:103-11. Epub 2008 Nov 27.
125.	Expression of monocyte chemoattractant protein-1 and its induction by tumor necrosis factor receptor 1 in sensory neurons in the ventral rhizotomy model of neuropathic pain.	Jeon SM, etal., Neuroscience. 2011 Sep 8;190:354-66. doi: 10.1016/j.neuroscience.2011.06.036. Epub 2011 Jun 25.
126.	MIP-1alpha and MCP-1 Induce Migration of Human Umbilical Cord Blood Cells in Models of Stroke.	Jiang L, etal., Curr Neurovasc Res. 2008 May;5(2):118-24.
127.	Characterization of cytokine/chemokine profiles of severe acute respiratory syndrome.	Jiang Y, etal., Am J Respir Crit Care Med. 2005 Apr 15;171(8):850-7. doi: 10.1164/rccm.200407-857OC. Epub 2005 Jan 18.
128.	[Effects of hydrogen sulfide on vascular inflammation in pulmonary hypertension induced by high pulmonary blood flow: experiment with rats]	Jin HF, etal., Zhonghua Yi Xue Za Zhi. 2008 Aug 19;88(32):2235-9.
129.	Chronic inflammation upregulates chemokine receptors and induces neutrophil migration to monocyte chemoattractant protein-1.	Johnston B, etal., J Clin Invest. 1999 May;103(9):1269-76.
130.	Monocyte chemoattractant protein 1, intercellular adhesion molecule 1, and vascular cell adhesion molecule 1 in exudative age-related macular degeneration.	Jonas JB, etal., Arch Ophthalmol. 2010 Oct;128(10):1281-6. doi: 10.1001/archophthalmol.2010.227.
131.	Potential role of monocyte chemoattractant protein 1/JE in monocyte/macrophage-dependent IgA immune complex alveolitis in the rat.	Jones ML, etal., J Immunol. 1992 Sep 15;149(6):2147-54.
132.	Activation of the Nlrp3 inflammasome in infiltrating macrophages by endocannabinoids mediates beta cell loss in type 2 diabetes.	Jourdan T, etal., Nat Med. 2013 Sep;19(9):1132-40. doi: 10.1038/nm.3265. Epub 2013 Aug 18.
133.	Plasma and whole-blood chemokine levels in patients with Behcet's disease.	Kaburaki T, etal., Graefes Arch Clin Exp Ophthalmol. 2003 May;241(5):353-8. Epub 2003 Apr 23.
134.	Monocyte chemoattractant protein-1 gene delivery enhances antitumor effects of herpes simplex virus thymidine kinase/ganciclovir system in a model of colon cancer.	Kagaya T, etal., Cancer Gene Ther. 2006 Apr;13(4):357-66.
135.	Roles and relationship of macrophages and monocyte chemotactic and activating factor/monocyte chemoattractant protein-1 in the ischemic and reperfused rat heart.	Kakio T, etal., Lab Invest. 2000 Jul;80(7):1127-36.
136.	Lithospermic acid B ameliorates the development of diabetic nephropathy in OLETF rats.	Kang ES, etal., Eur J Pharmacol. 2008 Jan 28;579(1-3):418-25. Epub 2007 Nov 1.
137.	Inhibitor kappa B kinase beta dependent cytokine upregulation in nociceptive neurons contributes to nociceptive hypersensitivity after sciatic nerve injury.	Kanngiesser M, etal., J Pain. 2012 May;13(5):485-97. doi: 10.1016/j.jpain.2012.02.010.
138.	Reciprocal regulation of ATPgammaS-induced monocyte chemoattractant protein-1 production by ERK and p38 MAP kinases in rat corticostriatal slice cultures.	Katayama T, etal., J Neurosci Res. 2009 May 15;87(7):1573-81. doi: 10.1002/jnr.21982.
139.	Diclofenac, a selective COX-2 inhibitor, inhibits DMH-induced colon tumorigenesis through suppression of MCP-1, MIP-1alpha and VEGF.	Kaur J and Sanyal SN, Mol Carcinog. 2011 Jan 25. doi: 10.1002/mc.20736.
140.	Monocyte chemoattractant protein-1-dependent increase of V alpha 14 NKT cells in lungs and their roles in Th1 response and host defense in cryptococcal infection.	Kawakami K, etal., J Immunol. 2001 Dec 1;167(11):6525-32.
141.	Chemokine and chemokine receptor expression during experimental autoimmune uveoretinitis in mice.	Keino H, etal., Graefes Arch Clin Exp Ophthalmol. 2003 Feb;241(2):111-5. Epub 2003 Jan 28.
142.	Higher activity by opaque endometriotic lesions than nonopaque lesions.	Khan KN, etal., Acta Obstet Gynecol Scand. 2004 Apr;83(4):375-82.
143.	Neutrophils and reactive oxygen intermediates mediate glucan-induced pulmonary granuloma formation through the local induction of monocyte chemoattractant protein-1.	Kilgore KS, etal., Lab Invest. 1997 Feb;76(2):191-201.
144.	Depletion of MCP-1 increases development of herpetic stromal keratitis by innate immune modulation.	Kim B, etal., J Leukoc Biol. 2006 Dec;80(6):1405-15. Epub 2006 Sep 22.
145.	Plasma levels of MCP-1 and adiponectin in obstructive sleep apnea syndrome.	Kim J, etal., Arch Otolaryngol Head Neck Surg. 2010 Sep;136(9):896-9.
146.	Expression of monocyte chemoattractant protein-1 and macrophage inflammatory protein-1 after focal cerebral ischemia in the rat.	Kim JS, etal., J Neuroimmunol. 1995 Feb;56(2):127-34.
147.	Histone deacetylase 3 mediates allergic skin inflammation by regulating expression of MCP1 protein.	Kim Y, etal., J Biol Chem. 2012 Jul 27;287(31):25844-59. doi: 10.1074/jbc.M112.348284. Epub 2012 Jun 7.
148.	Alleviation of monocrotaline-induced pulmonary hypertension by antibodies to monocyte chemotactic and activating factor/monocyte chemoattractant protein-1.	Kimura H, etal., Lab Invest. 1998 May;78(5):571-81.
149.	Nicotinic alpha-7 acetylcholine receptor deficiency exacerbates hepatic inflammation and fibrosis in a mouse model of non-alcoholic steatohepatitis.	Kimura K, etal., J Diabetes Investig. 2019 May;10(3):659-666. doi: 10.1111/jdi.12964. Epub 2018 Dec 16.
150.	Circulating levels of MCP-1 are increased in women with gestational diabetes.	Klein K, etal., Prenat Diagn. 2008 Sep;28(9):845-51.
151.	Pioglitazone attenuates diabetic nephropathy through an anti-inflammatory mechanism in type 2 diabetic rats.	Ko GJ, etal., Nephrol Dial Transplant. 2008 Sep;23(9):2750-60. Epub 2008 Apr 3.
152.	The role of monocyte chemoattractant protein-1 in biliary atresia.	Kobayashi H, etal., J Pediatr Surg. 2006 Dec;41(12):1967-72. doi: 10.1016/j.jpedsurg.2006.08.018.
153.	Angiotensin-receptor blockade reduces border zone myocardial monocyte chemoattractant protein-1 expression and macrophage infiltration in post-infarction ventricular remodeling.	Kohno T, etal., Circ J. 2008 Oct;72(10):1685-92. Epub 2008 Aug 28.
154.	Comparison of cytokine levels from undiluted vitreous of untreated patients with retinal vein occlusion.	Koss MJ, etal., Acta Ophthalmol. 2012 Mar;90(2):e98-e103. doi: 10.1111/j.1755-3768.2011.02292.x. Epub 2011 Nov 8.
155.	Association of serum MCP-1 concentration and MCP-1 polymorphism with insulin resistance in Japanese individuals with obese type 2 diabetes.	Kouyama K, etal., Kobe J Med Sci. 2008 Feb 8;53(6):345-54.
156.	Monocyte chemoattractant protein-1 in the aqueous humour of patients with age-related macular degeneration.	Kramer M, etal., Clin Experiment Ophthalmol. 2012 Aug;40(6):617-25. doi: 10.1111/j.1442-9071.2011.02747.x. Epub 2012 Feb 20.
157.	A Monocyte chemoattractant protein-1 (MCP-1) polymorphism and outcome after renal transplantation.	Kruger B, etal., J Am Soc Nephrol. 2002 Oct;13(10):2585-9.
158.	Astrocytic P2Y(1) receptor is involved in the regulation of cytokine/chemokine transcription and cerebral damage in a rat model of cerebral ischemia.	Kuboyama K, etal., J Cereb Blood Flow Metab. 2011 Sep;31(9):1930-41. doi: 10.1038/jcbfm.2011.49. Epub 2011 Apr 13.
159.	Molecular regulation of monocyte chemoattractant protein-1 expression in pancreatic beta-cells.	Kutlu B, etal., Diabetes 2003 Feb;52(2):348-55.
160.	Hypertensive myocardial fibrosis and diastolic dysfunction: another model of inflammation?	Kuwahara F, etal., Hypertension. 2004 Apr;43(4):739-45. Epub 2004 Feb 16.
161.	HIV infection is associated with higher levels of monocyte chemoattractant protein-1 and eotaxin among people with recent hepatitis C virus infection.	Lamoury FM, etal., BMC Infect Dis. 2016 Jun 1;16:241. doi: 10.1186/s12879-016-1567-2.
162.	Cdc42 GTPases facilitate TNF-alpha-mediated secretion of CCL2 from peripheral nerve microvascular endoneurial endothelial cells.	Langert KA, etal., J Peripher Nerv Syst. 2013 Sep;18(3):199-208. doi: 10.1111/jns5.12032.
163.	Oral methylthioadenosine administration attenuates fibrosis and chronic liver disease progression in Mdr2-/- mice.	Latasa MU, etal., PLoS One. 2010 Dec 29;5(12):e15690. doi: 10.1371/journal.pone.0015690.
164.	Effect of glucocorticoid pretreatment on oxidative liver injury and survival in jaundiced rats with endotoxin cholangitis.	Lee CW, etal., World J Surg. 2006 Dec;30(12):2217-26. doi: 10.1007/s00268-006-0143-0.
165.	Blocking the monocyte chemoattractant protein-1/CCR2 chemokine pathway induces permanent survival of islet allografts through a programmed death-1 ligand-1-dependent mechanism.	Lee I, etal., J Immunol. 2003 Dec 15;171(12):6929-35.
166.	Early up-regulation of chemokine expression in fulminant hepatic failure.	Leifeld L, etal., J Pathol. 2003 Mar;199(3):335-44. doi: 10.1002/path.1298.
167.	Melatonin reduces the expression of chemokines in rat with trinitrobenzene sulfonic acid-induced colitis.	Li JH, etal., Saudi Med J. 2008 Aug;29(8):1088-94.
168.	Colchicine Attenuates Inflammatory Cells Infiltration and Extracellular Matrix Accumulation in Diabetic Nephropathy.	Li JJ, etal., Am J Physiol Renal Physiol. 2009 Apr 15.
169.	Blocking of monocyte chemoattractant protein-1 during tubulointerstitial nephritis resulted in delayed neutrophil clearance.	Li P, etal., Am J Pathol. 2005 Sep;167(3):637-49.
170.	Intravenous transfusion of endothelial colony-forming cells attenuates vascular degeneration after cerebral aneurysm induction.	Li S, etal., Brain Res. 2014 Dec 17;1593:65-75. doi: 10.1016/j.brainres.2014.09.077. Epub 2014 Oct 12.
171.	Clinical and pathological investigation of severe COVID-19 patients.	Li S, etal., JCI Insight. 2020 May 19. pii: 138070. doi: 10.1172/jci.insight.138070.
172.	Caveolin-1 increases proinflammatory chemoattractants and blood-retinal barrier breakdown but decreases leukocyte recruitment in inflammation.	Li X, etal., Invest Ophthalmol Vis Sci. 2014 Aug 26;55(10):6224-34. doi: 10.1167/iovs.14-14613.
173.	Effects of bone marrow-derived endothelial progenitor cell transplantation on vein microenvironment in a rat model of chronic thrombosis.	Li XQ, etal., Chin Med J (Engl). 2007 Dec 20;120(24):2245-9.
174.	[Effect of aging on pulmonary ICAM-1 and MCP-1 expressions in rats with lipopolysaccharide- induced acute lung injury].	Lin SP, etal., Nan Fang Yi Ke Da Xue Xue Bao. 2010 Mar;30(3):584-7.
175.	The effect of simvastatin on the serum monocyte chemoattractant protein-1 and intracellular adhesion molecule-1 levels in diabetic rats.	Lin Y, etal., J Diabetes Complications. 2009 May-Jun;23(3):214-8. Epub 2008 Apr 16.
176.	TLR4 mediates inflammation and hepatic fibrosis induced by chronic intermittent hypoxia in rats.	Lin ZP, etal., Mol Med Rep. 2020 Aug;22(2):651-660. doi: 10.3892/mmr.2020.11134. Epub 2020 May 7.
177.	[Relationship between the level of MCP-1 expression in sera of RA patients and ILD].	Ling T, etal., Xi Bao Yu Fen Zi Mian Yi Xue Za Zhi. 2010 Jan;26(1):59-60.
178.	The expression of MCP-1 and CCR2 in induced rats periapical lesions.	Liu L, etal., Arch Oral Biol. 2014 May;59(5):492-9. doi: 10.1016/j.archoralbio.2014.02.008. Epub 2014 Feb 22.
179.	MCP1 -2518 polymorphism and chronic obstructive pulmonary disease in Taiwanese men.	Liu SF, etal., Exp Lung Res. 2010 Jun;36(5):277-83.
180.	Expression of monocyte chemoattractant protein-1 in the cerebral artery after experimental subarachnoid hemorrhage.	Lu H, etal., Brain Res. 2009 Mar 25;1262:73-80. Epub 2009 Jan 21.
181.	Suppression of constitutive but not Il-1beta-inducible expression of monocyte chemoattractant protein-1 in mesangial cells by retinoic acids: intervention in the activator protein-1 pathway.	Lucio-Cazana J, etal., J Am Soc Nephrol. 2001 Apr;12(4):688-94.
182.	Lipoprotein-X stimulates monocyte chemoattractant protein-1 expression in mesangial cells via nuclear factor-kappa B.	Lynn EG, etal., Kidney Int. 2001 Aug;60(2):520-32.
183.	Liu Shen capsule shows antiviral and anti-inflammatory abilities against novel coronavirus SARS-CoV-2 via suppression of NF-κB signaling pathway.	Ma Q, etal., Pharmacol Res. 2020 Apr 30;158:104850. doi: 10.1016/j.phrs.2020.104850.
184.	Involvement of CCL2/CCR2 macrophage recruitment in amodiaquine-induced liver injury.	Mak A and Uetrecht J, J Immunotoxicol. 2019 Jan 21:1-6. doi: 10.1080/1547691X.2018.1516014.
185.	Crucial role of CCL3/MIP-1alpha in the recurrence of autoimmune anterior uveitis induced with myelin basic protein in Lewis rats.	Manczak M, etal., J Autoimmun. 2002 Jun;18(4):259-70.
186.	An essential role for monocyte chemoattractant protein-1 in alcoholic liver injury: regulation of proinflammatory cytokines and hepatic steatosis in mice.	Mandrekar P, etal., Hepatology. 2011 Dec;54(6):2185-97. doi: 10.1002/hep.24599.
187.	Characterization of monocyte chemoattractant protein-1 expression following a kainate model of status epilepticus.	Manley NC, etal., Brain Res. 2007 Nov 28;1182:138-43. Epub 2007 Sep 22.
188.	Monocyte chemoattractant protein-1 (MCP-1) gene transduction: an effective tumor vaccine strategy for non-intracranial tumors.	Manome Y, etal., Cancer Immunol Immunother. 1995 Oct;41(4):227-35.
189.	Paraoxonase-1 is related to inflammation, fibrosis and PPAR delta in experimental liver disease.	Marsillach J, etal., BMC Gastroenterol. 2009 Jan 14;9:3.
190.	Membrane-bound form of monocyte chemoattractant protein-1 enhances antitumor effects of suicide gene therapy in a model of hepatocellular carcinoma.	Marukawa Y, etal., Cancer Gene Ther. 2012 May;19(5):312-9. doi: 10.1038/cgt.2012.3. Epub 2012 Mar 9.
191.	Transforming growth factor-beta1 enhances the secretion of monocyte chemoattractant protein-1 by the IEC-18 intestinal epithelial cell line.	Matagrano LB, etal., In Vitro Cell Dev Biol Anim. 2003 Mar-Apr;39(3-4):183-6.
192.	Circulating monocytes from systemic sclerosis patients with interstitial lung disease show an enhanced profibrotic phenotype.	Mathai SK, etal., Lab Invest. 2010 Jun;90(6):812-23. Epub 2010 Apr 19.
193.	Regulation of oxidative stress and inflammation by hepatic adiponectin receptor 2 in an animal model of nonalcoholic steatohepatitis.	Matsunami T, etal., Int J Clin Exp Pathol. 2010 May 22;3(5):472-81.
194.	Increased monocyte chemoattractant protein 1 (MCP-1/CCL-2) serum level in acute myeloid leukemia.	Mazur G, etal., Neoplasma. 2007;54(4):285-9.
195.	CCL2 polymorphisms are associated with serum monocyte chemoattractant protein-1 levels and myocardial infarction in the Framingham Heart Study.	McDermott DH, etal., Circulation. 2005 Aug 23;112(8):1113-20.
196.	Inactivation of IL-6 and soluble IL-6 receptor by neutrophil derived serine proteases in cystic fibrosis.	McGreal EP, etal., Biochim Biophys Acta. 2010 Jul-Aug;1802(7-8):649-58. Epub 2010 May 7.
197.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
198.	Estrogen modulates inflammatory mediator expression and neutrophil chemotaxis in injured arteries.	Miller AP, etal., Circulation. 2004 Sep 21;110(12):1664-9. Epub 2004 Sep 7.
199.	Persistent airway inflammation and emphysema progression on CT in ex-smokers observed for 4 years.	Miller M, etal., Chest. 2010 Oct 21.
200.	Trehalose: a biophysics approach to modulate the inflammatory response during endotoxic shock.	Minutoli L, etal., Eur J Pharmacol. 2008 Jul 28;589(1-3):272-80. Epub 2008 Apr 12.
201.	Tumor progression is associated with increasing CD11b+ cells and CCL2 in Lewis rat sarcoma.	Mishra R, etal., Anticancer Res. 2015 Feb;35(2):703-11.
202.	In vivo effect of surfactant on inflammatory cytokines during endotoxin-induced lung injury in rodents.	Mittal N and Sanyal SN, J Immunotoxicol. 2011 Oct-Dec;8(4):274-83. Epub 2011 Jul 18.
203.	Anti-inflammatory effect of angiotensin type 1 receptor antagonist on endotoxin-induced uveitis in rats.	Miyazaki A, etal., Graefes Arch Clin Exp Ophthalmol. 2008 May;246(5):747-57. Epub 2007 Dec 18.
204.	Association of polymorphisms in monocyte chemoattractant protein-1 promoter with diabetic kidney failure in Korean patients with type 2 diabetes mellitus.	Moon JY, etal., J Korean Med Sci. 2007 Oct;22(5):810-4.
205.	22-S-Hydroxycholesterol protects against ethanol-induced liver injury by blocking the auto/paracrine activation of MCP-1 mediated by LXRα.	Na TY, etal., J Pathol. 2015 Apr;235(5):710-20. doi: 10.1002/path.4494. Epub 2015 Jan 5.
206.	Monocyte chemoattractant protein 1 mediates retinal detachment-induced photoreceptor apoptosis.	Nakazawa T, etal., Proc Natl Acad Sci U S A. 2007 Feb 13;104(7):2425-30. Epub 2007 Feb 6.
207.	MCP-1 antibody treatment enhances damage and impedes repair of the alveolar epithelium in influenza pneumonitis.	Narasaraju T, etal., Am J Respir Cell Mol Biol. 2010 Jun;42(6):732-43. Epub 2009 Jul 17.
208.	Effect of nanoformulated copper/zinc superoxide dismutase on chronic ethanol-induced alterations in liver and adipose tissue.	Natarajan G, etal., Alcohol. 2019 Sep;79:71-79. doi: 10.1016/j.alcohol.2018.12.005. Epub 2019 Jan 3.
209.	Renal response to repetitive exposure to heme proteins: chronic injury induced by an acute insult.	Nath KA, etal., Kidney Int. 2000 Jun;57(6):2423-33.
210.	Heme protein-induced chronic renal inflammation: suppressive effect of induced heme oxygenase-1.	Nath KA, etal., Kidney Int. 2001 Jan;59(1):106-17.
211.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
212.	Chemokine response in children with SARS.	Ng PC, etal., Arch Dis Child. 2005 Apr;90(4):422-3. doi: 10.1136/adc.2004.053660.
213.	Lipid metabolism and inflammation modulated by Vitamin D in liver of diabetic rats.	Ning C, etal., Lipids Health Dis. 2015 Apr 18;14:31. doi: 10.1186/s12944-015-0030-5.
214.	Monocyte chemoattractant protein-1 (MCP-1) deficiency enhances alternatively activated M2 macrophages and ameliorates insulin resistance and fatty liver in lipoatrophic diabetic A-ZIP transgenic mice.	Nio Y, etal., Diabetologia. 2012 Dec;55(12):3350-8. doi: 10.1007/s00125-012-2710-2. Epub 2012 Sep 16.
215.	Effects of pitavastatin on monocyte chemoattractant protein-1 in hyperlipidemic patients.	Nomura S, etal., Blood Coagul Fibrinolysis. 2009 Sep;20(6):440-7. doi: 10.1097/MBC.0b013e32832e0618.
216.	Monocyte chemoattractant protein-1 is excreted in excessive amounts in the urine of patients with lupus nephritis.	Noris M, etal., Lab Invest. 1995 Dec;73(6):804-9.
217.	Alternatively activated macrophages and collagen remodeling characterize the postpartum involuting mammary gland across species.	O'Brien J, etal., Am J Pathol. 2010 Mar;176(3):1241-55. Epub 2010 Jan 28.
218.	Genetic variants of CC chemokine genes in experimental autoimmune encephalomyelitis, multiple sclerosis and rheumatoid arthritis.	Ockinger J, etal., Genes Immun. 2010 Mar;11(2):142-54. Epub 2009 Oct 29.
219.	Disruption of tumor necrosis factor-alpha gene diminishes the development of atherosclerosis in ApoE-deficient mice.	Ohta H, etal., Atherosclerosis. 2005 May;180(1):11-7. Epub 2005 Jan 20.
220.	Administration of a substituted adamantyl urea inhibitor of soluble epoxide hydrolase protects the kidney from damage in hypertensive Goto-Kakizaki rats.	Olearczyk JJ, etal., Clin Sci (Lond). 2009 Jan;116(1):61-70.
221.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
222.	Prevention of myocardial reperfusion injury in rats by an antibody against monocyte chemotactic and activating factor/monocyte chemoattractant protein-1.	Ono K, etal., Lab Invest. 1999 Feb;79(2):195-203.
223.	Monocyte chemoattractant protein 1 and chemokine receptor CCR2 productions in Guillain-Barre syndrome and experimental autoimmune neuritis.	Orlikowski D, etal., J Neuroimmunol. 2003 Jan;134(1-2):118-27.
224.	Expression of monocyte chemoattractant protein-1 in proximal tubular epithelial cells in a rat model of progressive kidney failure.	Ota T, etal., J Lab Clin Med. 2002 Jul;140(1):43-51.
225.	IL-1 beta, IL-6, KC and MCP-1 are elevated in synovial fluid from haemophilic mice with experimentally induced haemarthrosis.	Ovlisen K, etal., Haemophilia. 2009 May;15(3):802-10.
226.	High-mobility group box-1 protein promotes granulomatous nephritis in adenine-induced nephropathy.	Oyama Y, etal., Lab Invest. 2010 Jun;90(6):853-66. doi: 10.1038/labinvest.2010.64. Epub 2010 Mar 15.
227.	Monocyte chemoattractant protein-1 promoter -2518 polymorphism may have an influence on clinical heterogeneity of bipolar I disorder in the Korean population.	Pae CU, etal., Neuropsychobiology 2004;49(3):111-4.
228.	Endogenous VEGF-A is responsible for mitogenic effects of MCP-1 on vascular smooth muscle cells.	Parenti A, etal., Am J Physiol Heart Circ Physiol. 2004 May;286(5):H1978-84. Epub 2003 Dec 23.
229.	Brown Norway rat asthma model of diphenylmethane-4,4'-diisocyanate (MDI): impact of vehicle for topical induction.	Pauluhn J Regul Toxicol Pharmacol. 2008 Feb;50(1):144-54. Epub 2007 Sep 21.
230.	Possible new role of monocyte chemoattractant protein-1 in hemodialysis patients with cardiovascular disease.	Pawlak K, etal., Am J Nephrol. 2004 Nov-Dec;24(6):635-40. Epub 2004 Dec 22.
231.	Monocyte chemoattractant protein-1 -2518 A/G single nucleotide polymorphism might be associated with renal disease and thrombocytopenia of SLE.	Piotrowski P, etal., J Biomed Biotechnol. 2010;2010:130265. doi: 10.1155/2010/130265. Epub 2010 Apr 21.
232.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
233.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
234.	Monocyte chemoattractant protein-1 increases microglial infiltration and aggressiveness of gliomas.	Platten M, etal., Ann Neurol. 2003 Sep;54(3):388-92.
235.	Inhibition of renal rho kinase attenuates ischemia/reperfusion-induced injury.	Prakash J, etal., J Am Soc Nephrol. 2008 Nov;19(11):2086-97. doi: 10.1681/ASN.2007070794. Epub 2008 Jul 23.
236.	Blockade of endothelin ET(A)/ET(B) receptors favors a role for endothelin during acute Trypanosoma cruzi infection in rats.	Rachid MA, etal., Microbes Infect. 2006 Jul;8(8):2113-9. Epub 2006 Jun 6.
237.	Superimposed gastric aspiration increases the severity of inflammation and permeability injury in a rat model of lung contusion.	Raghavendran K, etal., J Surg Res. 2009 Aug;155(2):273-82. Epub 2008 Sep 16.
238.	The evolution of isolated bilateral lung contusion from blunt chest trauma in rats: cellular and cytokine responses.	Raghavendran K, etal., Shock. 2005 Aug;24(2):132-8.
239.	Inhibition of T cell recruitment and cutaneous delayed-type hypersensitivity-induced inflammation with antibodies to monocyte chemoattractant protein-1.	Rand ML, etal., Am J Pathol. 1996 Mar;148(3):855-64.
240.	Muscle responds to an antibody reactive with the acetylcholine receptor by up-regulating monocyte chemoattractant protein 1: a chemokine with the potential to influence the severity and course of experimental myasthenia gravis.	Reyes-Reyna S, etal., J Immunol 2002 Aug 1;169(3):1579-86.
241.	GOA pipeline	RGD automated data pipeline
242.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
243.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
244.	The temporal expression, cellular localization, and inhibition of the chemokines MIP-2 and MCP-1 after traumatic brain injury in the rat.	Rhodes JK, etal., J Neurotrauma. 2009 Apr;26(4):507-25.
245.	Use of inflammatory molecules to predict the occurrence of fever in onco-hematological patients with neutropenia.	Ribeiro AF, etal., Braz J Med Biol Res. 2013 Feb;46(2):200-6. Epub 2013 Feb 1.
246.	Effects of angiotensin-1 converting enzyme inhibition on oxidative stress and bradykinin receptor expression during doxorubicin-induced cardiomyopathy in rats.	Richard C, etal., J Cardiovasc Pharmacol. 2008 Sep;52(3):278-85.
247.	Increased cytokines, chemokines and soluble adhesion molecules in exhaled breath condensate of asthmatic children.	Robroeks CM, etal., Clin Exp Allergy. 2010 Jan;40(1):77-84.
248.	Melanoma susceptibility and progression: Association study between polymorphisms of the chemokine (CCL2) and chemokine receptors (CX3CR1, CCR5).	Rodero M, etal., J Dermatol Sci. 2007 Apr;46(1):72-6. Epub 2006 Dec 13.
249.	MCP-1 and MIP3-alpha serum levels in acute liver failure and molecular adsorbent recirculating system (MARS) treatment: a pilot study.	Roth GA, etal., Scand J Gastroenterol. 2009;44(6):745-51. doi: 10.1080/00365520902770086.
250.	Therapeutic Effects of Evasin-1, a Chemokine Binding Protein, in Bleomycin-Induced Pulmonary Fibrosis.	Russo RC, etal., Am J Respir Cell Mol Biol. 2010 Sep 10.
251.	Spleen tyrosine kinase promotes acute neutrophil-mediated glomerular injury via activation of JNK and p38 MAPK in rat nephrotoxic serum nephritis.	Ryan J, etal., Lab Invest. 2011 Dec;91(12):1727-38. doi: 10.1038/labinvest.2011.137. Epub 2011 Sep 5.
252.	Gingival levels of monocyte chemoattractant protein-1 (MCP-1) in diabetes mellitus and periodontitis: an experimental study in rats.	Sakallioglu EE, etal., Clin Oral Investig. 2008 Mar;12(1):83-9. Epub 2007 Sep 18.
253.	[The behavior of intra-leukocyte peroxidase after irradiation with radar microwaves in intra-articular exudates].	Santolini BM, etal., Minerva Ortop. 1971 Dec;22(12):459-62.
254.	Hepatitis C virus-induced changes in microRNA 107 (miRNA-107) and miRNA-449a modulate CCL2 by targeting the interleukin-6 receptor complex in hepatitis.	Sarma NJ, etal., J Virol. 2014 Apr;88(7):3733-43. doi: 10.1128/JVI.03060-13. Epub 2014 Jan 15.
255.	Increased expression of CCAAT/enhancer binding protein-beta and -delta and monocyte chemoattractant protein-1 genes in aortas from hyperinsulinaemic rats.	Sato Y, etal., Diabetologia. 2007 Feb;50(2):481-9. Epub 2006 Dec 16.
256.	Perioperative glycine treatment attenuates ischemia/reperfusion injury and ameliorates smooth muscle dysfunction in intestinal transplantation.	Schaefer N, etal., Transplantation. 2008 May 15;85(9):1300-10.
257.	The cannabinoid receptor-1 antagonist rimonabant inhibits platelet activation and reduces pro-inflammatory chemokines and leukocytes in Zucker rats.	Schafer A, etal., Br J Pharmacol. 2008 Jul;154(5):1047-54. Epub 2008 May 12.
258.	Bronchoalveoloar lavage fluid cytokines and chemokines as markers and predictors for the outcome of interstitial lung disease in systemic sclerosis patients.	Schmidt K, etal., Arthritis Res Ther. 2009;11(4):R111. Epub 2009 Jul 17.
259.	Monocyte chemoattractant protein-1 mediates collagen deposition in experimental glomerulonephritis by transforming growth factor-beta.	Schneider A, etal., Kidney Int. 1999 Jul;56(1):135-44.
260.	Monocyte chemoattractant protein-1 and RANTES are chemotactic for graft infiltrating lymphocytes during acute lung allograft rejection.	Sekine Y, etal., Am J Respir Cell Mol Biol. 2000 Dec;23(6):719-26.
261.	CCR2(+) monocytes infiltrate atrophic lesions in age-related macular disease and mediate photoreceptor degeneration in experimental subretinal inflammation in Cx3cr1 deficient mice.	Sennlaub F, etal., EMBO Mol Med. 2013 Nov;5(11):1775-93. doi: 10.1002/emmm.201302692. Epub 2013 Oct 21.
262.	Inhibition of monocyte chemoattractant protein-1 ameliorates rat adjuvant-induced arthritis.	Shahrara S, etal., J Immunol. 2008 Mar 1;180(5):3447-56.
263.	Altered serum transforming growth factor-beta1 and monocyte chemoattractant protein-1 levels in obstructive jaundice.	Sheen-Chen SM, etal., World J Surg. 2004 Oct;28(10):967-70. Epub 2004 Sep 29.
264.	Inhibition of p38 mitogen-activated protein kinase is effective in the treatment of experimental crescentic glomerulonephritis and suppresses monocyte chemoattractant protein-1 but not IL-1beta or IL-6.	Sheryanna A, etal., J Am Soc Nephrol. 2007 Apr;18(4):1167-79. Epub 2007 Feb 21.
265.	Hepatic interferon regulatory factor 8 expression mediates liver ischemia/reperfusion injury in mice.	Shi G, etal., Biochem Pharmacol. 2021 Oct;192:114728. doi: 10.1016/j.bcp.2021.114728. Epub 2021 Aug 13.
266.	Effects of induction therapy on wound healing at bronchial anastomosis sites in rats.	Shirafuji T, etal., Jpn J Thorac Cardiovasc Surg. 2003 Jun;51(6):217-24.
267.	Inhibition of development of experimental aortic abdominal aneurysm in rat model by atorvastatin through inhibition of macrophage migration.	Shiraya S, etal., Atherosclerosis. 2009 Jan;202(1):34-40. Epub 2008 Apr 6.
268.	Hypoxic preconditioning with cobalt attenuates hypobaric hypoxia-induced oxidative damage in rat lungs.	Shukla D, etal., High Alt Med Biol. 2009 Spring;10(1):57-69.
269.	Monocyte chemoattractant protein-1 (CCL-2) integrates mechanical and endocrine signals that mediate term and preterm labor.	Shynlova O, etal., J Immunol. 2008 Jul 15;181(2):1470-9.
270.	Differential expression of chemokines and chemokine receptors in inflammatory periapical diseases.	Silva TA, etal., Oral Microbiol Immunol. 2005 Oct;20(5):310-6.
271.	Interferon-gamma potentiates NMDA receptor signaling in spinal dorsal horn neurons via microglia-neuron interaction.	Sonekatsu M, etal., Mol Pain. 2016 Apr 18;12. pii: 12/0/1744806916644927. doi: 10.1177/1744806916644927. Print 2016.
272.	Kupffer cell depletion protects against the steatosis, but not the liver damage, induced by marginal-copper, high-fructose diet in male rats.	Song M, etal., Am J Physiol Gastrointest Liver Physiol. 2015 Jun 1;308(11):G934-45. doi: 10.1152/ajpgi.00285.2014. Epub 2015 Mar 26.
273.	The evolving systemic and local biomarker milieu at different stages of disease progression in rat adjuvant-induced arthritis.	Stolina M, etal., J Clin Immunol. 2009 Mar;29(2):158-74. Epub 2008 Aug 26.
274.	Atorvastatin enhances interleukin-10 levels and improves cardiac function in rats after acute myocardial infarction.	Stumpf C, etal., Clin Sci (Lond). 2009 Jan;116(1):45-52.
275.	Role of leukotriene B4 receptors in the development of atherosclerosis: potential mechanisms.	Subbarao K, etal., Arterioscler Thromb Vasc Biol. 2004 Feb;24(2):369-75. Epub 2003 Dec 1.
276.	Chemokine CCL2/MCP-1 negatively regulates metastasis in a highly bone marrow-metastatic mouse breast cancer model.	Takahashi M, etal., Clin Exp Metastasis. 2009;26(7):817-28. Epub 2009 Jul 24.
277.	Mizoribine Suppresses the Progression of Experimental Peritoneal Fibrosis in a Rat Model.	Takahashi S, etal., Nephron Exp Nephrol. 2009 Apr 23;112(2):e59-e69.
278.	Urinary monocyte chemoattractant protein-1 (MCP-1) and connective tissue growth factor (CCN2) as prognostic markers for progression of diabetic nephropathy.	Tam FW, etal., Cytokine. 2009 Apr 29.
279.	Prolonged cold ischemia in rat cardiac allografts promotes ischemia-reperfusion injury and the development of graft coronary artery disease in a linear fashion.	Tanaka M, etal., J Heart Lung Transplant. 2005 Nov;24(11):1906-14. Epub 2005 Jul 27.
280.	Enhanced production of monocyte chemoattractant protein-1 in the dorsal root ganglia in a rat model of neuropathic pain: possible involvement in the development of neuropathic pain.	Tanaka T, etal., Neurosci Res. 2004 Apr;48(4):463-9.
281.	Early enhanced expression of interferon-inducible protein-10 (CXCL-10) and other chemokines predicts adverse outcome in severe acute respiratory syndrome.	Tang NL, etal., Clin Chem. 2005 Dec;51(12):2333-40. doi: 10.1373/clinchem.2005.054460. Epub 2005 Sep 29.
282.	Cytokine profiles of bronchoalveolar lavage fluid in patients with pneumocystis pneumonia.	Tasaka S, etal., Microbiol Immunol. 2010 Jul;54(7):425-33.
283.	Eotaxin and monocyte chemoattractant protein-1 in chronic eosinophilic pneumonia.	Tateno H, etal., Eur Respir J. 2001 May;17(5):962-8.
284.	A laboratory model of toxin-induced hemolytic uremic syndrome.	Taylor CM, etal., Kidney Int. 1999 Apr;55(4):1367-74.
285.	Blocking the CCL2-CCR2 Axis Using CCL2-Neutralizing Antibody Is an Effective Therapy for Hepatocellular Cancer in a Mouse Model.	Teng KY, etal., Mol Cancer Ther. 2017 Feb;16(2):312-322. doi: 10.1158/1535-7163.MCT-16-0124. Epub 2016 Dec 15.
286.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
287.	Altered chemokine response in an animal model of multiple organ dysfunction syndrome induced by zymosan.	Thomas NJ, etal., J Pediatr Surg. 2005 Mar;40(3):464-9.
288.	Reduced plaque formation induced by rosiglitazone in an STZ-diabetes mouse model of atherosclerosis is associated with downregulation of adhesion molecules.	Tikellis C, etal., Atherosclerosis. 2008 Jul;199(1):55-64. Epub 2008 Feb 21.
289.	HDL-associated lysosphingolipids inhibit NAD(P)H oxidase-dependent monocyte chemoattractant protein-1 production.	Tolle M, etal., Arterioscler Thromb Vasc Biol. 2008 Aug;28(8):1542-8. doi: 10.1161/ATVBAHA.107.161042. Epub 2008 May 15.
290.	Blocking mast cell-mediated type I hypersensitivity in experimental allergic conjunctivitis by monocyte chemoattractant protein-1/CCR2.	Tominaga T, etal., Invest Ophthalmol Vis Sci. 2009 Nov;50(11):5181-8. doi: 10.1167/iovs.09-3637. Epub 2009 Jun 24.
291.	Cardiopulmonary alterations in mRNA expression for interleukin-1beta, the interleukin-6 superfamily and CXC-chemokines during development of postischaemic heart failure in the rat.	Tonnessen T, etal., Clin Physiol Funct Imaging. 2003 Sep;23(5):263-8.
292.	Immune cell recruitment following acoustic trauma.	Tornabene SV, etal., Hear Res. 2006 Dec;222(1-2):115-24. Epub 2006 Nov 1.
293.	Expression of monocyte chemoattractant protein-1 in the corpus luteum of the rat.	Townson DH, etal., Biol Reprod. 1996 Feb;54(2):513-20.
294.	CCL2 promotes P2X4 receptor trafficking to the cell surface of microglia.	Toyomitsu E, etal., Purinergic Signal. 2012 Jun;8(2):301-10. doi: 10.1007/s11302-011-9288-x. Epub 2012 Jan 6.
295.	Enhanced antitumor effects of a bicistronic adenovirus vector expressing both herpes simplex virus thymidine kinase and monocyte chemoattractant protein-1 against hepatocellular carcinoma.	Tsuchiyama T, etal., Cancer Gene Ther. 2003 Apr;10(4):260-9. doi: 10.1038/sj.cgt.7700571.
296.	Anti-monocyte chemoattractant protein-1 gene therapy prevents dimethylnitrosamine-induced hepatic fibrosis in rats.	Tsuruta S, etal., Int J Mol Med. 2004 Nov;14(5):837-42.
297.	Strong association of a functional polymorphism in the monocyte chemoattractant protein 1 promoter gene with lupus nephritis.	Tucci M, etal., Arthritis Rheum. 2004 Jun;50(6):1842-9.
298.	Chemokine synthesis in the HSV-1-infected cornea and its suppression by interleukin-10.	Tumpey TM, etal., J Leukoc Biol. 1998 Apr;63(4):486-92.
299.	Murine ccl2/cx3cr1 deficiency results in retinal lesions mimicking human age-related macular degeneration.	Tuo J, etal., Invest Ophthalmol Vis Sci. 2007 Aug;48(8):3827-36.
300.	Anti-monocyte chemoattractant protein-1 gene therapy inhibits restenotic changes (neointimal hyperplasia) after balloon injury in rats and monkeys.	Usui M, etal., FASEB J. 2002 Nov;16(13):1838-40. Epub 2002 Sep 5.
301.	The chemokine CCL2 modulates Ca2+ dynamics and electrophysiological properties of cultured cerebellar Purkinje neurons.	van Gassen KL, etal., Eur J Neurosci. 2005 Jun;21(11):2949-57.
302.	Proinflammatory gene expression at chronic periodontitis and peri-implantitis sites in patients with or without type 2 diabetes.	Venza I, etal., J Periodontol. 2010 Jan;81(1):99-108. doi: 10.1902/jop.2009.090358.
303.	Chemokines in acute anterior uveitis.	Verma MJ, etal., Curr Eye Res. 1997 Dec;16(12):1202-8.
304.	Social isolation stress facilitates chemically induced oral carcinogenesis.	Verza FA, etal., PLoS One. 2021 Jan 7;16(1):e0245190. doi: 10.1371/journal.pone.0245190. eCollection 2021.
305.	Increased receptor for advanced glycation end product expression in the human alcoholic prefrontal cortex is linked to adolescent drinking.	Vetreno RP, etal., Neurobiol Dis. 2013 Nov;59:52-62. doi: 10.1016/j.nbd.2013.07.002. Epub 2013 Jul 15.
306.	Fgr deficiency results in defective eosinophil recruitment to the lung during allergic airway inflammation.	Vicentini L, etal., J Immunol. 2002 Jun 15;168(12):6446-54.
307.	Distribution in ocular structures and optic pathways of immunocompetent and glial cells in an experimental allergic encephalomyelitis (EAE) relapsing model.	Villarroya H, etal., J Neurosci Res. 2001 Mar 15;63(6):525-35.
308.	Changes in plasma chemokine C-C motif ligand 2 levels during treatment with eicosapentaenoic acid predict outcome in patients undergoing surgery for colorectal cancer liver metastasis.	Volpato M, etal., Oncotarget. 2016 May 10;7(19):28139-50. doi: 10.18632/oncotarget.8579.
309.	Intervention of crescentic glomerulonephritis by antibodies to monocyte chemotactic and activating factor (MCAF/MCP-1).	Wada T, etal., FASEB J. 1996 Oct;10(12):1418-25.
310.	Persistence of lung inflammation and lung cytokines with high-resolution CT abnormalities during recovery from SARS.	Wang CH, etal., Respir Res. 2005 May 11;6:42. doi: 10.1186/1465-9921-6-42.
311.	Endothelial dysfunction, macrophage infiltration and NADPH oxidase-dependent superoxide production were attenuated by erythropoietin in streptozotocin-induced diabetic rat aorta.	Wang J, etal., Pharmacology. 2013;91(1-2):48-58. doi: 10.1159/000343963. Epub 2012 Nov 15.
312.	Clinical significance and different levels of urinary monocyte chemoattractant protein-1 in type 2 diabetes mellitus.	Wang QY and Chen FQ, Diabetes Res Clin Pract. 2009 Feb;83(2):215-9. Epub 2008 Dec 20.
313.	Triptolide inhibits CC chemokines expressed in rat adjuvant-induced arthritis.	Wang Y, etal., Int Immunopharmacol. 2006 Dec 5;6(12):1825-32. Epub 2006 Aug 31.
314.	Analysis of monocyte chemoattractant protein 1-mediated lung injury using rat lung organ cultures.	Warren JS, etal., Am J Pathol. 1993 Sep;143(3):894-906.
315.	Cardiac inflammation contributes to right ventricular dysfunction following experimental pulmonary embolism in rats.	Watts JA, etal., J Mol Cell Cardiol. 2006 Aug;41(2):296-307. Epub 2006 Jun 30.
316.	Role of the CCL2/MCP-1 -2518A>G gene polymorphism in HLA-B27 associated uveitis.	Wegscheider BJ, etal., Mol Vis. 2005 Nov 1;11:896-900.
317.	Excitatory monocyte chemoattractant protein-1 signaling is up-regulated in sensory neurons after chronic compression of the dorsal root ganglion.	White FA, etal., Proc Natl Acad Sci U S A. 2005 Sep 27;102(39):14092-7. Epub 2005 Sep 20.
318.	Evidence for less irritation to the peritoneal membrane in rats dialyzed with solutions low in glucose degradation products.	Wieczorowska-Tobis K, etal., Perit Dial Int. 2004 Jan-Feb;24(1):48-57.
319.	Identification of a retinal aldosterone system and the protective effects of mineralocorticoid receptor antagonism on retinal vascular pathology.	Wilkinson-Berka JL, etal., Circ Res. 2009 Jan 2;104(1):124-33. doi: 10.1161/CIRCRESAHA.108.176008. Epub 2008 Nov 26.
320.	Influenza A virus infection inhibits the efficient recruitment of Th2 cells into the airways and the development of airway eosinophilia.	Wohlleben G, etal., J Immunol. 2003 May 1;170(9):4601-11.
321.	Existence of a regulatory loop between MCP-1 and TGF-beta in glomerular immune injury.	Wolf G, etal., Am J Physiol Renal Physiol 2002 Nov;283(5):F1075-84.
322.	DNA vaccination with naked DNA encoding MCP-1 and RANTES protects against renal injury in adriamycin nephropathy.	Wu H, etal., Kidney Int. 2005 Jun;67(6):2178-86.
323.	Nifedipine inhibited angiotensin II-induced monocyte chemoattractant protein 1 expression: involvement of inhibitor of nuclear factor kappa B kinase and nuclear factor kappa B-inducing kinase.	Wu L, etal., J Hypertens. 2006 Jan;24(1):123-30.
324.	Regulation of inhibitory protein-kappaB and monocyte chemoattractant protein-1 by angiotensin II type 2 receptor-activated Src homology protein tyrosine phosphatase-1 in fetal vascular smooth muscle cells.	Wu L, etal., Mol Endocrinol. 2004 Mar;18(3):666-78. Epub 2003 Dec 18.
325.	Protein kinase C beta inhibitor LY333531 attenuates intercellular adhesion molecule-1 and monocyte chemotactic protein-1 expression in the kidney in diabetic rats.	Wu Y, etal., J Pharmacol Sci. 2006 Aug;101(4):335-43. Epub 2006 Aug 5.
326.	Estrogen modulates TNF-alpha-induced inflammatory responses in rat aortic smooth muscle cells through estrogen receptor-beta activation.	Xing D, etal., Am J Physiol Heart Circ Physiol. 2007 Jun;292(6):H2607-12. Epub 2007 Jan 19.
327.	[Effects of N-acetylcysteine on mRNA expression of monocyte chemotactic protein and macrophage inflammatory protein 2 in acute necrotizing pancreatitis: experiment with rats]	Xu CF, etal., Zhonghua Yi Xue Za Zhi. 2008 Mar 11;88(10):711-5.
328.	Role of KCa3.1 Channels in Macrophage Polarization and Its Relevance in Atherosclerotic Plaque Instability.	Xu R, etal., Arterioscler Thromb Vasc Biol. 2017 Feb;37(2):226-236. doi: 10.1161/ATVBAHA.116.308461. Epub 2016 Dec 29.
329.	Inhibition of laser-induced choroidal neovascularization by atorvastatin by downregulation of monocyte chemotactic protein-1 synthesis in mice.	Yamada K, etal., Invest Ophthalmol Vis Sci. 2007 Apr;48(4):1839-43.
330.	A synthetic selective inhibitor of factor Xa, DX-9065a, reduces monocyte chemoattractant protein-1 expression after ischemia-reperfusion injury in rat liver.	Yamaguchi Y, etal., Dig Dis Sci. 1999 Dec;44(12):2568-76. doi: 10.1023/a:1026667912632.
331.	Monocyte chemoattractant protein-1 enhances expression of intercellular adhesion molecule-1 following ischemia-reperfusion of the liver in rats.	Yamaguchi Y, etal., Hepatology. 1998 Mar;27(3):727-34.
332.	Role of monocyte chemoattractant protein-1 and its receptor,CCR-2, in the pathogenesis of bleomycin-induced scleroderma.	Yamamoto T and Nishioka K, J Invest Dermatol. 2003 Sep;121(3):510-6.
333.	Tumor-derived monocyte chemoattractant protein-1 induces intratumoral infiltration of monocyte-derived macrophage subpopulation in transplanted rat tumors.	Yamashiro S, etal., Am J Pathol. 1994 Oct;145(4):856-67.
334.	Intradermal injection of monocyte chemoattractant protein-1 induces emigration and differentiation of blood monocytes in rat skin.	Yamashiro S, etal., Int Arch Allergy Immunol. 1998 Jan;115(1):15-23.
335.	Zhongguo Zhong yao za zhi = Zhongguo zhongyao zazhi = China journal of Chinese materia medica	Yang H, etal., Zhongguo Zhong Yao Za Zhi. 2008 Dec;33(23):2817-20.
336.	Chemokine and chemokine receptor expression during colony stimulating factor-1-induced osteoclast differentiation in the toothless osteopetrotic rat: a key role for CCL9 (MIP-1gamma) in osteoclastogenesis in vivo and in vitro.	Yang M, etal., Blood. 2006 Mar 15;107(6):2262-70. doi: 10.1182/blood-2005-08-3365. Epub 2005 Nov 22.
337.	Plasma IP-10 and MCP-3 levels are highly associated with disease severity and predict the progression of COVID-19.	Yang Y, etal., J Allergy Clin Immunol. 2020 Apr 29. pii: S0091-6749(20)30576-5. doi: 10.1016/j.jaci.2020.04.027.
338.	Chemokine gene polymorphisms in idiopathic anterior uveitis.	Yeo TK, etal., Cytokine. 2006 Jul;35(1-2):29-35. Epub 2006 Sep 6.
339.	Indole-3-propionic acid suppresses indoxyl sulfate-induced expression of fibrotic and inflammatory genes in proximal tubular cells.	Yisireyili M, etal., Nagoya J Med Sci. 2017 Nov;79(4):477-486. doi: 10.18999/nagjms.79.4.477.
340.	Aqueous humor levels of asymmetric dimethylarginine (ADMA) are positively associated with monocyte chemoattractant protein-1 (MCP-1) in patients with uveitis.	Yoshida Y, etal., Br J Ophthalmol. 2008 Jan;92(1):93-4. Epub 2007 Jun 25.
341.	Molecular cloning of rat monocyte chemoattractant protein-1 (MCP-1) and its expression in rat spleen cells and tumor cell lines.	Yoshimura T, etal., Biochem Biophys Res Commun 1991 Jan 31;174(2):504-9.
342.	Chemokine MCP1/CCL2 and RANTES/CCL5 gene polymorphisms influence Henoch-Schonlein purpura susceptibility and severity.	Yu HH, etal., J Formos Med Assoc. 2015 Apr;114(4):347-52. doi: 10.1016/j.jfma.2012.12.007. Epub 2013 Feb 1.
343.	The role of redox status on chemokine expression in acute pancreatitis.	Yubero S, etal., Biochim Biophys Acta. 2009 Feb;1792(2):148-54. Epub 2008 Dec 9.
344.	Targeting peripheral immune response reduces the severity of necrotizing acute pancreatitis.	Yubero S, etal., Crit Care Med. 2009 Jan;37(1):240-5. doi: 10.1097/CCM.0b013e31819320fc.
345.	Sinomenine, an antirheumatic alkaloid, ameliorates clinical signs of disease in the Lewis rat model of acute experimental autoimmune encephalolmyelitis.	Zeng Y, etal., Biol Pharm Bull. 2007 Aug;30(8):1438-44.
346.	[Effects of astragalus on renal tubulointerestitial lesions and expression of NF-kappaB and MCP-1 in renal tissues in rat experimental IgA nephropathy]	Zhang GZ, etal., Zhongguo Dang Dai Er Ke Za Zhi. 2008 Apr;10(2):173-8.
347.	Exosome-mediated targeted delivery of miR-210 for angiogenic therapy after cerebral ischemia in mice.	Zhang H, etal., J Nanobiotechnology. 2019 Feb 19;17(1):29. doi: 10.1186/s12951-019-0461-7.
348.	CCL2-CCR2 signaling promotes hepatic ischemia/reperfusion injury.	Zhang J, etal., J Surg Res. 2016 May 15;202(2):352-62. doi: 10.1016/j.jss.2016.02.029. Epub 2016 Mar 3.
349.	Lung monocyte chemoattractant protein-1 gene expression in bleomycin-induced pulmonary fibrosis.	Zhang K, etal., J Immunol. 1994 Nov 15;153(10):4733-41.
350.	Chemokine CCL2 and its receptor CCR2 in the medullary dorsal horn are involved in trigeminal neuropathic pain.	Zhang ZJ, etal., J Neuroinflammation. 2012 Jul 9;9:136. doi: 10.1186/1742-2094-9-136.
351.	Anti-monocyte chemoattractant protein 1 gene therapy attenuates experimental chronic pancreatitis induced by dibutyltin dichloride in rats.	Zhao HF, etal., Gut. 2005 Dec;54(12):1759-67.
352.	The role of KCa3.1 channels in cardiac fibrosis induced by pressure overload in rats.	Zhao LM, etal., Pflugers Arch. 2015 Nov;467(11):2275-85. doi: 10.1007/s00424-015-1694-4. Epub 2015 Feb 27.
353.	Combined association of CCR2-V64I and MCP-1-2518A/G polymorphisms with generalised aggressive periodontitis in Chinese.	Zhu XL, etal., Chin J Dent Res. 2010;13(2):109-14.
354.	Serum monocyte chemoattractant protein-1 concentrations associate with diabetes status but not arterial stiffness in children with type 1 diabetes.	Zineh I, etal., Diabetes Care. 2009 Mar;32(3):465-7. Epub 2008 Dec 17.
355.	Therapeutic effects of dichloromethane fraction of Securidaca inappendiculata on adjuvant-induced arthritis in rat.	Zuo J, etal., J Ethnopharmacol. 2014 Apr 28;153(2):352-8. doi: 10.1016/j.jep.2014.02.015. Epub 2014 Feb 26.

Additional References at PubMed

PMID:2106664	PMID:7545673	PMID:8631787	PMID:8662823	PMID:9366570	PMID:9407497	PMID:10072545	PMID:10925302	PMID:12071442	PMID:12135683	PMID:12196270	PMID:12207323
PMID:12271471	PMID:12377739	PMID:12390882	PMID:12409843	PMID:12753088	PMID:12761250	PMID:12870648	PMID:12899200	PMID:14978197	PMID:15178559	PMID:15183841	PMID:15205118
PMID:15240134	PMID:15504940	PMID:15829559	PMID:15880558	PMID:15917991	PMID:15930146	PMID:16102724	PMID:16132691	PMID:16265704	PMID:16282363	PMID:16638301	PMID:16758320
PMID:16797058	PMID:16886721	PMID:16968890	PMID:17164575	PMID:17191078	PMID:17303665	PMID:17403137	PMID:17460389	PMID:17516154	PMID:17530714	PMID:17581219	PMID:17632282
PMID:17690108	PMID:17883394	PMID:17916652	PMID:17977946	PMID:18024959	PMID:18048593	PMID:18049032	PMID:18157868	PMID:18185105	PMID:18256274	PMID:18338959	PMID:18413206
PMID:18420193	PMID:18421085	PMID:18441197	PMID:18554968	PMID:18563318	PMID:18586982	PMID:18622025	PMID:18629611	PMID:18726687	PMID:18942743	PMID:18957386	PMID:19050284
PMID:19125409	PMID:19139201	PMID:19207862	PMID:19211873	PMID:19215923	PMID:19238998	PMID:19389872	PMID:19404405	PMID:19443842	PMID:19477239	PMID:19535570	PMID:19604316
PMID:19627007	PMID:19627010	PMID:19683237	PMID:19736311	PMID:19823951	PMID:19950591	PMID:20003523	PMID:20034406	PMID:20034917	PMID:20041150	PMID:20081877	PMID:20150963
PMID:20356868	PMID:20368270	PMID:20384770	PMID:20395830	PMID:20420568	PMID:20538789	PMID:20571857	PMID:20691665	PMID:21105875	PMID:21115617	PMID:21147091	PMID:21162127
PMID:21302491	PMID:21317391	PMID:21351537	PMID:21367920	PMID:21418993	PMID:21487675	PMID:21490228	PMID:21600925	PMID:21729288	PMID:21858029	PMID:21868333	PMID:21963836
PMID:21963947	PMID:22005927	PMID:22326498	PMID:22328150	PMID:22328773	PMID:22417871	PMID:22527942	PMID:22595559	PMID:22801372	PMID:22812249	PMID:22960654	PMID:23012479
PMID:23049171	PMID:23056550	PMID:23129286	PMID:23187120	PMID:23242502	PMID:23291264	PMID:23339567	PMID:23395675	PMID:23400803	PMID:23460341	PMID:23519994	PMID:23594826
PMID:23831969	PMID:23892723	PMID:24006456	PMID:24037783	PMID:24420912	PMID:24462503	PMID:24464584	PMID:24637038	PMID:24724624	PMID:24980870	PMID:25329075	PMID:25449579
PMID:25466836	PMID:25567426	PMID:25575056	PMID:25651887	PMID:25672988	PMID:25780042	PMID:25817785	PMID:25830624	PMID:26062549	PMID:26138996	PMID:26402697	PMID:26432893
PMID:26556523	PMID:26644089	PMID:26974138	PMID:26979053	PMID:27104804	PMID:27160403	PMID:27429111	PMID:27693081	PMID:27862629	PMID:28033741	PMID:28272428	PMID:28286770
PMID:28587818	PMID:29142497	PMID:29295871	PMID:29637744	PMID:29993042	PMID:30151700	PMID:30201767	PMID:30353658	PMID:30687013	PMID:30980241	PMID:31005664	PMID:31075560
PMID:31287373	PMID:31366997	PMID:31438731	PMID:31805255	PMID:31883300	PMID:31914700	PMID:31992448	PMID:32150444	PMID:32422289	PMID:32454160	PMID:32650794	PMID:32741247
PMID:32820306	PMID:33181267	PMID:33577025	PMID:33941753	PMID:34773653	PMID:34830041	PMID:35094663	PMID:36219898	PMID:36470227	PMID:37437927	PMID:37497210	PMID:38148075
PMID:39136140	PMID:39478585

Genomics

Comparative Map Data

Ccl2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	67,503,077 - 67,504,875 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	10	67,503,077 - 67,504,875 (+)	Ensembl				GRCr8
mRatBN7.2	10	67,005,424 - 67,007,222 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	67,005,424 - 67,007,226 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	10	71,626,649 - 71,628,447 (+)	NCBI	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	71,131,996 - 71,133,794 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	66,593,121 - 66,594,919 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0
Dahl_SR_JrHsd	10	70,374,928 - 70,376,726 (+)	NCBI
Lyon_Normotensive	10	71,096,385 - 71,098,183 (+)	NCBI
Lyon_Hypertensive	10	72,770,448 - 72,772,246 (+)	NCBI
F344_StmMcwi	10	72,661,862 - 72,663,659 (+)	NCBI
Rnor_6.0	10	69,412,065 - 69,413,863 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	69,412,017 - 69,413,870 (+)	Ensembl		Rnor_6.0 Ensembl	rn6	Rnor6.0
Rnor_5.0	10	69,047,091 - 69,048,889 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	10	70,256,263 - 70,258,061 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	10	65,952,968 - 65,954,766 (+)	NCBI		Celera
Cytogenetic Map	10	q26	NCBI

CCL2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	17	34,255,285 - 34,257,203 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	17	34,255,274 - 34,257,208 (+)	Ensembl		GRCh38.p14 Ensembl	hg38	GRCh38
GRCh37	17	32,582,304 - 32,584,222 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	17	29,606,409 - 29,608,335 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	17	29,606,408 - 29,608,331	NCBI
Celera	17	29,492,130 - 29,494,042 (+)	NCBI		Celera
Cytogenetic Map	17	q12	NCBI
HuRef	17	28,767,599 - 28,769,525 (+)	NCBI		HuRef
CHM1_1	17	32,646,183 - 32,648,095 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	17	35,201,562 - 35,203,480 (+)	NCBI		T2T-CHM13v2.0

Ccl2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	81,926,403 - 81,928,278 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	81,926,397 - 81,928,279 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	11	82,035,577 - 82,037,452 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	82,035,571 - 82,037,453 (+)	Ensembl		GRCm38.p6 Ensembl	mm10	GRCm38
MGSCv37	11	81,849,079 - 81,850,954 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	11	81,851,769 - 81,853,422 (+)	NCBI		MGSCv36	mm8
Celera	11	91,649,026 - 91,650,901 (+)	NCBI		Celera
Cytogenetic Map	11	B5	NCBI
cM Map	11	49.82	NCBI

CCL2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	19	30,208,206 - 30,210,212 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	17	32,089,476 - 32,091,422 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	17	22,528,154 - 22,530,091 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	17	22,821,336 - 22,823,271 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	17	22,820,890 - 22,823,384 (-)	Ensembl		PanPan1.1 Ensembl	panPan2	panpan1.1

CCL2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	9	39,008,187 - 39,009,932 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	9	38,231,467 - 38,233,216 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	9	39,822,383 - 39,824,132 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
UMICH_Zoey_3.1	9	38,608,720 - 38,610,469 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	9	38,897,447 - 38,899,196 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	9	38,976,777 - 38,978,526 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

CCL2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	12	40,798,109 - 40,800,026 (-)	Ensembl		Sscrofa11.1 Ensembl	susScr11	Sscrofa11.1
Sscrofa11.1	12	40,798,109 - 40,800,013 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	12	42,514,202 - 42,516,108 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

LOC103242710
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mChlSab1.0.hap1	16	32,541,142 - 32,543,049 (+)	NCBI		mChlSab1.0.hap1
Vero_WHO_p1.0	NW_023666075	2,254,637 - 2,256,540 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0
ChlSab1.1	16	27,763,354 - 27,765,437 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	16	27,763,555 - 27,765,416 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM

Variants

Variants in Ccl2
12 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	28
Count of miRNA genes:	21
Interacting mature miRNAs:	28
Transcripts:	ENSRNOT00000009448
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1549846	Scl47	Serum cholesterol level QTL 47	3.6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	10	51071897	96071897	Rat
152025229	Scl83	Serum cholesterol level QTL 83	4.33		blood cholesterol amount (VT:0000180)		10	36211556	69161158	Rat
1578779	Tcas10	Tongue tumor susceptibility QTL 10	3.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	10	31796281	76796281	Rat
631565	Hcuc4	Hepatic copper content QTL 4	4.15		liver copper amount (VT:0003065)	liver copper weight to liver dry weight ratio (CMO:0001512)	10	67439473	73950209	Rat
152025227	Bw195	Body weight QTL 195	5.73		body mass (VT:0001259)		10	47489017	69161158	Rat
1298069	Bp168	Blood pressure QTL 168	5.5		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	10	27023535	98502431	Rat
8657410	Bp374	Blood pressure QTL 374			heart left ventricle size trait (VT:0002753)	heart left ventricle end-diastolic diameter (CMO:0000982)	10	67476608	107713808	Rat
2293669	Bmd33	Bone mineral density QTL 33	4.5	0.0001	femur strength trait (VT:0010010)	femoral neck polar moment of inertia (CMO:0001670)	10	27443787	72443787	Rat
152025224	Bw193	Body weight QTL 193	6.47		body mass (VT:0001259)		10	52162433	75582749	Rat
61449	Ciaa2	CIA Autoantibody QTL 2	7.1		blood autoantibody amount (VT:0003725)	calculated serum anti-type 2 collagen antibody titer (CMO:0001279)	10	63719161	107713808	Rat
631552	Vetf2	Vascular elastic tissue fragility QTL 2	4.5	0.0002	aorta elastic tissue integrity trait (VT:0010556)	artery internal elastic lamina non-tumorous lesion count (CMO:0001913)	10	35509383	91417879	Rat
631557	Bp136	Blood pressure QTL 136		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	56868440	76129113	Rat
61325	Aia5	Adjuvant induced arthritis QTL 5		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23948641	107713808	Rat
1298078	Stresp5	Stress response QTL 5	2.99	0.00025	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	42546145	107713808	Rat
2293679	Bmd30	Bone mineral density QTL 30	3.5	0.0001	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	10	27443787	72443787	Rat
1549831	Bss6	Bone structure and strength QTL 6	4		lumbar vertebra strength trait (VT:0010574)	vertebra ultimate force (CMO:0001678)	10	58073360	103073360	Rat
12903252	Cm113	Cardiac mass QTL 113		0.047	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	66817119	107713808	Rat
70164	Bw21	Body weight QTL 21	4.36	0.00005	body mass (VT:0001259)	body weight (CMO:0000012)	10	54296336	99451733	Rat
2298548	Neuinf7	Neuroinflammation QTL 7	3.4		nervous system integrity trait (VT:0010566)	spinal cord RT1-B protein level (CMO:0002132)	10	64939013	107713808	Rat
61463	Bp12	Blood pressure QTL 12	6.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	41831278	86831278	Rat
1579919	Bp281	Blood pressure QTL 281		0.01	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	50464802	95464802	Rat
2300218	Hpcl2	Hepatic cholesterol level QTL 2			liver cholesterol amount (VT:0010498)	liver cholesterol level (CMO:0001597)	10	45529164	96099749	Rat
8694173	Bw149	Body weight QTL 149	4.38	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	10	44939359	89939359	Rat
70171	Cari1	Carrageenan-induced inflammation QTL 1	4.9	0.0005	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	10	54296227	107713808	Rat
12903269	Am15	Aortic mass QTL 15		0.042	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	10	66817119	107713808	Rat
10450493	Bp382	Blood pressure QTL 382		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	50860288	95860288	Rat
724527	Bp148	Blood pressure QTL 148		0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	28950353	73950353	Rat
12903266	Cm114	Cardiac mass QTL 114		0.02	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	10	66817119	107713808	Rat
2300171	Bmd58	Bone mineral density QTL 58	4.9	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	27443787	72443787	Rat
61354	Pia10	Pristane induced arthritis QTL 10		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23948641	107713808	Rat
2301967	Cm73	Cardiac mass QTL 73	4.55		heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	14991535	86964295	Rat
2313103	Bss80	Bone structure and strength QTL 80	2	0.0001	tibia strength trait (VT:1000284)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	10	62556066	107556066	Rat
70188	BpQTLcluster1	Blood pressure QTL cluster 1	4.864		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	42823274	87823274	Rat
12880372	Am12	Aortic mass QTL 12		0.003	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	10	66817119	107713808	Rat
2313105	Bss79	Bone structure and strength QTL 79	1.8	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	62556066	107556066	Rat
12880375	Kidm66	Kidney mass QTL 66		0.009	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	10	66817119	107713808	Rat
1357344	Bp249	Blood pressure QTL 249		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	67241334	98502431	Rat
9589030	Epfw9	Epididymal fat weight QTL 9	19.24	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	10	44939359	89939359	Rat
2293652	Bmd22	Bone mineral density QTL 22	4.9	0.0001	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	10	27443787	72443787	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14991535	107556066	Rat
12880370	Cm105	Cardiac mass QTL 105		0.008	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	10	66817119	107713808	Rat
70198	BpQTLcluster9	Blood pressure QTL cluster 9	2.94		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	42823274	87823274	Rat
12880371	Cm106	Cardiac mass QTL 106		0.007	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	66817119	107713808	Rat
2306970	Anxrr22	Anxiety related response QTL 22	5.95		fear/anxiety-related behavior trait (VT:1000241)	number of periods of voluntary immobility (CMO:0001045)	10	61843496	98710773	Rat
11565453	Kidm58	Kidney mass QTL 58		0.002	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	10	66817119	107713808	Rat
7387312	Bw125	Body weight QTL 125	3	0.0047	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight (CMO:0000356)	10	65390777	107713808	Rat
2317029	Aia19	Adjuvant induced arthritis QTL 19	2.98		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	10	67476608	73695498	Rat
724556	Pur2	Proteinuria QTL 2	5.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	22931373	91127454	Rat
8662860	Vetf10	Vascular elastic tissue fragility QTL 10			artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	10	6660923	73950353	Rat
2306792	Ean4	Experimental allergic neuritis QTL 4	4		nervous system integrity trait (VT:0010566)	IFNG-secreting splenocyte count (CMO:0002122)	10	49495492	94495492	Rat
61387	Bp1	Blood pressure QTL 1	5.1		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	52269185	107713808	Rat
2317039	Aia6	Adjuvant induced arthritis QTL 6	4.31		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	10	67476608	73695498	Rat
1354587	Kidm21	Kidney mass QTL 21	3.3		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	10	15533012	73695498	Rat
634329	Pia15	Pristane induced arthritis QTL 15	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	24662123	73695339	Rat
2298481	Eau9	Experimental allergic uveoretinitis QTL 9		0.0169	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	10	64139597	83061459	Rat
2298480	Eau7	Experimental allergic uveoretinitis QTL 7		0.0049	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	10	35509383	80509383	Rat
1358915	Stresp7	Stress response QTL 7	3.52		blood norepinephrine amount (VT:0005663)	plasma norepinephrine level (CMO:0001010)	10	65307813	107713808	Rat
70363	Bp71	Blood pressure QTL 71		0.04	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	61843496	106843496	Rat
61402	Niddm3	Non-insulin dependent diabetes mellitus QTL 3	4.58		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	61843633	83061236	Rat
1331791	Cm31	Cardiac mass QTL 31	3.84606		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	29800910	91417879	Rat
2289985	Bp305	Blood pressure QTL 305			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	29076978	74076978	Rat
631530	Tls3	T-lymphoma susceptibility QTL 3	0	0.0001	thymus integrity trait (VT:0010555)	percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911)	10	27587226	96099902	Rat
1354608	Cm33	Cardiac mass QTL 33	2.8		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	10	55307972	93608131	Rat
1558643	Cm44	Cardiac mass QTL 44	4.8	0.0000368	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	61843496	100198886	Rat
8552805	Bw145	Body weight QTL 145	2.2		body mass (VT:0001259)	change in body weight to body weight ratio (CMO:0002216)	10	43608793	88608793	Rat
631267	Cia20	Collagen induced arthritis QTL 20	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23948641	107713808	Rat
1331839	Eae18b	Experimental allergic encephalomyelitis QTL 18b	5.8	0.03	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	10	61746532	68282731	Rat
2293705	Bmd25	Bone mineral density QTL 25	7.1	0.0001	femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	10	27443787	72443787	Rat
631269	Cia22	Collagen induced arthritis QTL 22	8.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40535708	107713808	Rat
1576308	Schws1	Schwannoma susceptibility QTL 1		0.0041	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	10	40535708	107713808	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14991535	107713808	Rat
7207811	Bmd90	Bone mineral density QTL 90	5.2		femur size trait (VT:1000369)	femoral neck cross-sectional area (CMO:0001697)	10	49943710	94943710	Rat
631270	Cia23	Collagen induced arthritis QTL 23	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40535708	107713808	Rat
1581559	Eae18	Experimental allergic encephalomyelitis QTL 18		0.00002	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	10	66108888	107555881	Rat
1576311	Pia26	Pristane induced arthritis QTL 26			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	31129113	76129113	Rat
7411614	Foco18	Food consumption QTL 18		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	10	44939359	89939359	Rat
6893336	Cm75	Cardiac mass QTL 75	0.1	0.87	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	10	61843496	100198886	Rat
631547	Bp87	Blood pressure QTL 87	4.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	47869129	92869129	Rat
61427	Cia16	Collagen induced arthritis QTL 16	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	6864618	96620484	Rat
2292436	Bp310	Blood pressure QTL 310			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	50604677	95604677	Rat
12880050	Am10	Aortic mass QTL 10		0.016	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	10	39503487	84503487	Rat
6893342	Cm78	Cardiac mass QTL 78	0.1	0.88	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	10	35509383	88177745	Rat
634354	Rends3	Renal damage susceptibility QTL 3		0.05	kidney blood vessel morphology trait (VT:0000530)	organ lesion measurement (CMO:0000677)	10	61997479	106997479	Rat
2301405	Cm69	Cardiac mass QTL 69		0.031	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	10	66817119	107713808	Rat
631542	Bp82	Blood pressure QTL 82	6.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	27023535	99451848	Rat

Markers in Region

D10Kyo2

No map positions available.

PMC145384P1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	67,006,270 - 67,006,928 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	69,412,912 - 69,413,569	NCBI	Rnor6.0
Rnor_5.0	10	69,047,938 - 69,048,595	UniSTS	Rnor5.0
RGSC_v3.4	10	70,257,110 - 70,257,767	UniSTS	RGSC3.4
Celera	10	65,953,815 - 65,954,472	UniSTS
Cytogenetic Map	10	q26	UniSTS

Scya2

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	67,005,939 - 67,006,013 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	69,412,581 - 69,412,654	NCBI	Rnor6.0
Rnor_5.0	10	69,047,607 - 69,047,680	UniSTS	Rnor5.0
RGSC_v3.4	10	70,256,779 - 70,256,852	UniSTS	RGSC3.4
Celera	10	65,953,484 - 65,953,557	UniSTS
Cytogenetic Map	10	q26	UniSTS

RH134870

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	67,006,913 - 67,007,108 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	69,413,555 - 69,413,749	NCBI	Rnor6.0
Rnor_5.0	10	69,048,581 - 69,048,775	UniSTS	Rnor5.0
RGSC_v3.4	10	70,257,753 - 70,257,947	UniSTS	RGSC3.4
Celera	10	65,954,458 - 65,954,652	UniSTS
Cytogenetic Map	10	q26	UniSTS

Genetic Models

This gene Ccl2 is modified in the following models/strains:

SS-Ccl2^em1-/-Mcwi

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

adipose tissue	alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	entire extraembryonic component	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	pharyngeal arch	renal system	reproductive system	respiratory system	sensory system	visual system
276	146	722	1583	3268	961	1676	120	825	445	807	156	5186	2519	443	3184	36	1319	693	904	130	128

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_031530	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC123203	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF058786	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF079313	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M57441	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X17053	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000009448 ⟹ ENSRNOP00000009448

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	10	67,503,077 - 67,504,875 (+)	Ensembl
mRatBN7.2 Ensembl	10	67,005,424 - 67,007,226 (+)	Ensembl
Rnor_6.0 Ensembl	10	69,412,017 - 69,413,870 (+)	Ensembl

RefSeq Acc Id:

NM_031530 ⟹ NP_113718

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	67,503,077 - 67,504,875 (+)	NCBI
mRatBN7.2	10	67,005,424 - 67,007,222 (+)	NCBI
Dahl_SR_JrHsd	10	70,374,928 - 70,376,726 (+)	NCBI
Lyon_Normotensive	10	71,096,385 - 71,098,183 (+)	NCBI
Lyon_Hypertensive	10	72,770,448 - 72,772,246 (+)	NCBI
F344_StmMcwi	10	72,661,862 - 72,663,659 (+)	NCBI
Rnor_6.0	10	69,412,065 - 69,413,863 (+)	NCBI
Rnor_5.0	10	69,047,091 - 69,048,889 (+)	NCBI
RGSC_v3.4	10	70,256,263 - 70,258,061 (+)	RGD
Celera	10	65,952,968 - 65,954,766 (+)	RGD

Sequence:

show sequence

GCAGAGACACAGACAGAGGCCAGCCCAGAAACCAGCCAACTCTCACTGAAGCCAGATCTCTCTT
CCTCCACCACTATGCAGGTCTCTGTCACGCTTCTGGGCCTGTTGTTCACAGTTGCTGCCTGTAG
CATCCACGTGCTGTCTCAGCCAGATGCAGTTAATGCCCCACTCACCTGCTGCTACTCATTCACT
GGCAAGATGATCCCAATGAGTCGGCTGGAGAACTACAAGAGAATCACCAGCAGCAGGTGTCCCA
AAGAAGCTGTAGTATTTGTCACCAAGCTCAAGAGAGAGATCTGTGCTGACCCCAATAAGGAATG
GGTCCAGAAGTACATTAGAAAACTGGACCAGAACCAAGTGAGATCAGAAACTACAGTCTTCTAT
AAAATTGCATCAACCCTAAGGACTTCAGCACCTTTGAATGTGAACTTGACCCATAAATCTGAAG
CTAATGCATCCACTCTCTTTTCCACAACCACCTCAAGCACTTCTGTAGAAGTGACCAGTATGAC
AGAGAACTAGTGTGATTTGGAATGTGATGCCTTAAGTAATGTTAAACTTATTTAACTTATTGAT
ATTACACTATTCCCTTCCATGAATACTAGAAATCCTTAAATGCAAGATGTAGATCCATTTTTTT
ATTTCTCTGTGAATCCTGGTTCAACACTTTCAATGTATGAGAGATGAATGGGTAAACTTTGTGT
TTGAGAGTCCAAGGTATTGTTTAAAATATTATTATGGATATTCCTAATTATTAAAAGAAATATA
TTATTTTTGTAC

hide sequence

Protein Sequences


Protein RefSeqs	NP_113718	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA63496	(Get FASTA)	NCBI Sequence Viewer
	AAC15187	(Get FASTA)	NCBI Sequence Viewer
	CAA34901	(Get FASTA)	NCBI Sequence Viewer
	EDM05437	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000009448
	ENSRNOP00000009448.1
	ENSRNOP00055036150
	ENSRNOP00060027325
	ENSRNOP00065026364
GenBank Protein	P14844	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_113718 ⟸ NM_031530
- Peptide Label:	precursor
- UniProtKB:	Q549R5 (UniProtKB/Swiss-Prot), P14844 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MQVSVTLLGLLFTVAACSIHVLSQPDAVNAPLTCCYSFTGKMIPMSRLENYKRITSSRCPKEAV VFVTKLKREICADPNKEWVQKYIRKLDQNQVRSETTVFYKIASTLRTSAPLNVNLTHKSEANAS TLFSTTTSSTSVEVTSMTEN hide sequence

Ensembl Acc Id:

ENSRNOP00000009448 ⟸ ENSRNOT00000009448

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P14844-F1-model_v2	AlphaFold	P14844	1-148	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13697507

Promoter ID:

EPDNEW_R8032

Type:

multiple initiation site

Name:

Ccl2_1

Description:

C-C motif chemokine ligand 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	10	69,412,065 - 69,412,125	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:3645	AgrOrtholog
BioCyc Gene	G2FUF-23937	BioCyc
Ensembl Genes	ENSRNOG00000007159	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
	ENSRNOG00055025618	UniProtKB/Swiss-Prot
	ENSRNOG00060019323	UniProtKB/Swiss-Prot
	ENSRNOG00065019591	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000009448	ENTREZGENE
	ENSRNOT00000009448.5	UniProtKB/Swiss-Prot
	ENSRNOT00055044192	UniProtKB/Swiss-Prot
	ENSRNOT00060033398	UniProtKB/Swiss-Prot
	ENSRNOT00065032989	UniProtKB/Swiss-Prot
Gene3D-CATH	2.40.50.40	UniProtKB/Swiss-Prot
InterPro	Chemokine_b/g/d	UniProtKB/Swiss-Prot
	Chemokine_CC_CS	UniProtKB/Swiss-Prot
	Chemokine_IL8-like_dom	UniProtKB/Swiss-Prot
	Interleukin_8-like_sf	UniProtKB/Swiss-Prot
KEGG Report	rno:24770	UniProtKB/Swiss-Prot
NCBI Gene	24770	ENTREZGENE
PANTHER	C-C MOTIF CHEMOKINE 2	UniProtKB/Swiss-Prot
	PTHR12015	UniProtKB/Swiss-Prot
Pfam	IL8	UniProtKB/Swiss-Prot
PhenoGen	Ccl2	PhenoGen
PROSITE	SMALL_CYTOKINES_CC	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000007159	RatGTEx
	ENSRNOG00055025618	RatGTEx
	ENSRNOG00060019323	RatGTEx
	ENSRNOG00065019591	RatGTEx
SMART	SCY	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF54117	UniProtKB/Swiss-Prot
TIGR	TC205265
UniProt	CCL2_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q549R5	ENTREZGENE
UniProt Secondary	Q549R5	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-03-08	Ccl2	C-C motif chemokine ligand 2	Ccl2	chemokine (C-C motif) ligand 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-02-26	Ccl2	chemokine (C-C motif) ligand 2	Scya2	small inducible cytokine A2	Symbol and Name updated	625702	APPROVED
2002-06-10	Scya2	small inducible cytokine A2			Name updated	70585	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_expression	increases slightly during renal allografts and isografts	61510
gene_expression	mRNA is isolated from the glomeruli of perfused kidneys	625742
gene_physical_interaction	may bind with Tgf beta during glomerular immune injury	625742
gene_process	induces Tgf-beta expression	625742
gene_regulation	expression is upregulated by NF-kappaB in an IL-1beta-induced manner	634051
gene_regulation	expression is upregulated by Con A	634050
gene_regulation	protein synthesis is increased by cerulein hyperstimulation in rat pancreatic acini through a calcium-dependent mechanism involving NF-kB activation	625742
gene_regulation	antibody against acetylcholine receptor increases protein production both in cultured LE1 myocytes and in skeletal muscle in Lewis rats	625742

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

Mammalian Phenotype

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

Mammalian Phenotype