Symbol:
Cx3cl1
Name:
C-X3-C motif chemokine ligand 1
RGD ID:
620458
Description:
Enables chemokine activity. Involved in several processes, including cellular response to cytokine stimulus; positive regulation of cell population proliferation; and regulation of signal transduction. Located in several cellular components, including neuron projection; neuronal cell body; and perinuclear region of cytoplasm. Used to study acute pancreatitis; ischemia; and status epilepticus. Biomarker of several diseases, including borna disease; brain disease (multiple); liver disease (multiple); lung disease (multiple); and pulmonary hypertension. Human ortholog(s) of this gene implicated in Cor pulmonale and common cold. Orthologous to human CX3CL1 (C-X3-C motif chemokine ligand 1); PARTICIPATES IN chemokine mediated signaling pathway; cytokine mediated signaling pathway; INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2-acetamidofluorene.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
C-X3-C motif chemokine 1; chemokine (C-X3-C motif) ligand 1; Cx3c; CX3C membrane-anchored chemokine; fractalkine; neurotactin; Scyd1; small inducible cytokine subfamily D 1; small inducible cytokine subfamily D, 1; small-inducible cytokine D1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
CX3CL1 (C-X3-C motif chemokine ligand 1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Cx3cl1 (C-X3-C motif chemokine ligand 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Cx3cl1 (C-X3-C motif chemokine ligand 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
CX3CL1 (C-X3-C motif chemokine ligand 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
CX3CL1 (C-X3-C motif chemokine ligand 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Cx3cl1 (C-X3-C motif chemokine ligand 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
CX3CL1 (C-X3-C motif chemokine ligand 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
LOC103233058 (fractalkine) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Cx3cl1 (C-X3-C motif chemokine ligand 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
SDR39U1 (short chain dehydrogenase/reductase family 39U member 1) HGNC
OMA
Alliance orthologs 3
Mus musculus (house mouse):
Cx3cl1 (C-X3-C motif chemokine ligand 1)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
CX3CL1 (C-X3-C motif chemokine ligand 1)
Alliance
DIOPT (HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
ccl38.1 (chemokine (C-C motif) ligand 38, duplicate 1)
Alliance
DIOPT (Ensembl Compara|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 19 10,233,326 - 10,244,856 (-) NCBI GRCr8 mRatBN7.2 19 10,227,337 - 10,237,826 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 19 10,227,340 - 10,236,833 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 19 10,190,578 - 10,200,058 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 19 10,957,425 - 10,966,906 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 19 10,244,371 - 10,253,854 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 19 10,644,267 - 10,654,861 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 19 10,644,244 - 10,653,800 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 19 10,638,466 - 10,647,951 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 19 10,666,940 - 10,676,424 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 19 10,671,765 - 10,681,250 (-) NCBI Celera 19 10,113,300 - 10,122,786 (-) NCBI Celera Cytogenetic Map 19 p13 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Cx3cl1 Rat 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane decreases expression ISO CX3CL1 (Homo sapiens) 6480464 o and p'-DDT results in decreased expression of CX3CL1 mRNA CTD PMID:18204070 Cx3cl1 Rat 1,2-dimethylhydrazine multiple interactions ISO Cx3cl1 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of CX3CL1 mRNA CTD PMID:22206623 Cx3cl1 Rat 1,2-dimethylhydrazine decreases expression ISO Cx3cl1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of CX3CL1 mRNA CTD PMID:22206623 Cx3cl1 Rat 17alpha-ethynylestradiol affects expression ISO Cx3cl1 (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of CX3CL1 mRNA CTD PMID:17555576 Cx3cl1 Rat 17beta-estradiol multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in increased expression of CX3CL1 mRNA CTD PMID:26496021 Cx3cl1 Rat 17beta-estradiol increases expression ISO CX3CL1 (Homo sapiens) 6480464 Estradiol results in increased expression of CX3CL1 mRNA CTD PMID:31614463 Cx3cl1 Rat 17beta-estradiol multiple interactions ISO CX3CL1 (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in decreased expression of CX3CL1 mRNA CTD PMID:30165855 Cx3cl1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Cx3cl1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin inhibits the reaction [EGF protein results in increased expression of CX3CL1 mRNA] and Tetrachlorodibenzodioxin promotes the reaction [[Dexamethasone co-treated with rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS1 protein] results in increased expression of CX3CL1 mRNA] CTD PMID:15667827 and PMID:16054899 Cx3cl1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of CX3CL1 mRNA CTD PMID:33387578 Cx3cl1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO CX3CL1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of CX3CL1 mRNA CTD PMID:28351761 Cx3cl1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of CX3CL1 mRNA CTD PMID:22298810 Cx3cl1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO CX3CL1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the expression of CX3CL1 mRNA CTD PMID:22298810 Cx3cl1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Cx3cl1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of CX3CL1 mRNA CTD PMID:19933214 Cx3cl1 Rat 2,3-dimethoxynaphthalene-1,4-dione decreases expression ISO CX3CL1 (Homo sapiens) 6480464 2 more ... CTD PMID:17547211 Cx3cl1 Rat 2,4,6-trinitrobenzenesulfonic acid increases expression ISO Cx3cl1 (Mus musculus) 6480464 Trinitrobenzenesulfonic Acid results in increased expression of CX3CL1 mRNA CTD PMID:15973123 Cx3cl1 Rat 2,4-diaminotoluene increases expression ISO Cx3cl1 (Mus musculus) 6480464 2 and 4-diaminotoluene results in increased expression of CX3CL1 mRNA CTD PMID:20713471 Cx3cl1 Rat 2-acetamidofluorene increases expression EXP 6480464 2-Acetylaminofluorene results in increased expression of CX3CL1 mRNA CTD PMID:17187413 Cx3cl1 Rat 2-methylcholine affects expression ISO CX3CL1 (Homo sapiens) 6480464 beta-methylcholine affects the expression of CX3CL1 mRNA CTD PMID:21179406 Cx3cl1 Rat 3,3',4,4',5-pentachlorobiphenyl increases expression EXP 6480464 3 more ... CTD PMID:19692669 Cx3cl1 Rat 3,3',4,4',5-pentachlorobiphenyl decreases expression ISO CX3CL1 (Homo sapiens) 6480464 3 more ... CTD PMID:28351761 Cx3cl1 Rat 3,3',4,4',5-pentachlorobiphenyl decreases expression EXP 6480464 3 more ... CTD PMID:23196670 Cx3cl1 Rat 3,4-dichloroaniline increases expression EXP 6480464 3 and 4-dichloroaniline results in increased expression of CX3CL1 mRNA CTD PMID:24172598 Cx3cl1 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO Cx3cl1 (Mus musculus) 6480464 [Dexamethasone co-treated with rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS1 protein] results in increased expression of CX3CL1 mRNA more ... CTD PMID:16054899 and PMID:23503329 Cx3cl1 Rat 3-methylcholanthrene increases expression ISO Cx3cl1 (Mus musculus) 6480464 Methylcholanthrene results in increased expression of CX3CL1 mRNA CTD PMID:20713471 Cx3cl1 Rat 4,4'-sulfonyldiphenol decreases expression ISO Cx3cl1 (Mus musculus) 6480464 bisphenol S results in decreased expression of CX3CL1 mRNA CTD PMID:30951980 Cx3cl1 Rat 4-(ethoxymethylene)-2-phenyloxazol-5-one decreases expression ISO Cx3cl1 (Mus musculus) 6480464 Oxazolone results in decreased expression of CX3CL1 mRNA CTD PMID:21404309 Cx3cl1 Rat 4-hydroxyphenyl retinamide increases expression ISO Cx3cl1 (Mus musculus) 6480464 Fenretinide results in increased expression of CX3CL1 mRNA CTD PMID:28973697 Cx3cl1 Rat 8-Br-cAMP increases expression ISO CX3CL1 (Homo sapiens) 6480464 8-Bromo Cyclic Adenosine Monophosphate results in increased expression of CX3CL1 mRNA CTD PMID:22079614 Cx3cl1 Rat acetylsalicylic acid multiple interactions ISO CX3CL1 (Homo sapiens) 6480464 Aspirin inhibits the reaction [TNF results in increased expression of CX3CL1 mRNA] and Aspirin inhibits the reaction [TNF results in increased expression of CX3CL1 protein] CTD PMID:19493461 Cx3cl1 Rat acetylsalicylic acid decreases expression ISO Cx3cl1 (Mus musculus) 6480464 Aspirin results in decreased expression of CX3CL1 mRNA and Aspirin results in decreased expression of CX3CL1 protein CTD PMID:19997773 Cx3cl1 Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of CX3CL1 mRNA CTD PMID:28959563 Cx3cl1 Rat acrylamide decreases expression ISO Cx3cl1 (Mus musculus) 6480464 Acrylamide results in decreased expression of CX3CL1 mRNA CTD PMID:29261810 Cx3cl1 Rat aflatoxin B1 affects expression ISO CX3CL1 (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of CX3CL1 protein CTD PMID:20106945 Cx3cl1 Rat aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of CX3CL1 mRNA CTD PMID:23630614 and PMID:25378103 Cx3cl1 Rat aldehydo-D-glucose increases expression ISO CX3CL1 (Homo sapiens) 6480464 Glucose results in increased expression of CX3CL1 mRNA and Glucose results in increased expression of CX3CL1 protein CTD PMID:19132243 and PMID:31655124 Cx3cl1 Rat aldehydo-D-glucose multiple interactions ISO CX3CL1 (Homo sapiens) 6480464 2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one inhibits the reaction [Glucose results in increased expression of CX3CL1 mRNA] more ... CTD PMID:19132243 Cx3cl1 Rat all-trans-retinoic acid decreases expression EXP 6480464 Tretinoin results in decreased expression of CX3CL1 mRNA CTD PMID:20488242 Cx3cl1 Rat all-trans-retinoic acid decreases expression ISO Cx3cl1 (Mus musculus) 6480464 Tretinoin results in decreased expression of CX3CL1 mRNA CTD PMID:36189433 Cx3cl1 Rat all-trans-retinoic acid decreases expression ISO CX3CL1 (Homo sapiens) 6480464 Tretinoin results in decreased expression of CX3CL1 mRNA CTD PMID:23724009 Cx3cl1 Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of CX3CL1 mRNA CTD PMID:35163327 Cx3cl1 Rat aluminium atom increases expression ISO Cx3cl1 (Mus musculus) 6480464 Aluminum results in increased expression of CX3CL1 mRNA CTD PMID:37544489 Cx3cl1 Rat aluminium(0) increases expression ISO Cx3cl1 (Mus musculus) 6480464 Aluminum results in increased expression of CX3CL1 mRNA CTD PMID:37544489 Cx3cl1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of CX3CL1 mRNA CTD PMID:16483693 Cx3cl1 Rat aripiprazole multiple interactions ISO CX3CL1 (Homo sapiens) 6480464 [Aripiprazole co-treated with Ozone] results in increased expression of CX3CL1 mRNA CTD PMID:31476115 Cx3cl1 Rat aristolochic acid A increases expression ISO CX3CL1 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of CX3CL1 mRNA CTD PMID:33212167 Cx3cl1 Rat aristolochic acid A increases expression EXP 6480464 aristolochic acid I results in increased expression of CX3CL1 protein CTD PMID:35690179 Cx3cl1 Rat arsane multiple interactions ISO Cx3cl1 (Mus musculus) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased secretion of CX3CL1 protein CTD PMID:37527016 Cx3cl1 Rat arsenic atom multiple interactions ISO Cx3cl1 (Mus musculus) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased secretion of CX3CL1 protein CTD PMID:37527016 Cx3cl1 Rat arsenite(3-) multiple interactions ISO Cx3cl1 (Mus musculus) 6480464 TRP53 protein affects the reaction [arsenite results in decreased expression of CX3CL1 mRNA] CTD PMID:18929588 Cx3cl1 Rat arsenite(3-) decreases expression ISO Cx3cl1 (Mus musculus) 6480464 arsenite results in decreased expression of CX3CL1 mRNA CTD PMID:18929588 Cx3cl1 Rat arsenous acid decreases expression ISO CX3CL1 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of CX3CL1 mRNA CTD PMID:17547211 Cx3cl1 Rat asperentin increases expression ISO Cx3cl1 (Mus musculus) 6480464 cladosporin results in increased expression of CX3CL1 mRNA CTD PMID:19818335 Cx3cl1 Rat benzo[a]pyrene decreases expression ISO Cx3cl1 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of CX3CL1 mRNA CTD PMID:21569818 Cx3cl1 Rat benzo[a]pyrene increases methylation ISO CX3CL1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of CX3CL1 3' UTR and Benzo(a)pyrene results in increased methylation of CX3CL1 promoter CTD PMID:27901495 Cx3cl1 Rat benzo[a]pyrene decreases expression ISO CX3CL1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of CX3CL1 mRNA CTD PMID:28351761 Cx3cl1 Rat benzo[a]pyrene increases expression ISO Cx3cl1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of CX3CL1 mRNA CTD PMID:22228805 Cx3cl1 Rat benzo[b]fluoranthene affects expression ISO Cx3cl1 (Mus musculus) 6480464 benzo(b)fluoranthene affects the expression of CX3CL1 mRNA CTD PMID:26377693 Cx3cl1 Rat beta-naphthoflavone multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of CX3CL1 mRNA CTD PMID:18164116 Cx3cl1 Rat bis(2-chloroethyl) sulfide increases expression ISO Cx3cl1 (Mus musculus) 6480464 Mustard Gas results in increased expression of CX3CL1 mRNA CTD PMID:19778212 Cx3cl1 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in increased expression of CX3CL1 mRNA CTD PMID:26496021 Cx3cl1 Rat bisphenol A affects expression ISO Cx3cl1 (Mus musculus) 6480464 bisphenol A affects the expression of CX3CL1 mRNA CTD PMID:35341816 Cx3cl1 Rat bisphenol A increases expression ISO Cx3cl1 (Mus musculus) 6480464 bisphenol A results in increased expression of CX3CL1 mRNA CTD PMID:29248573 Cx3cl1 Rat bisphenol A affects expression ISO CX3CL1 (Homo sapiens) 6480464 bisphenol A affects the expression of CX3CL1 mRNA CTD PMID:30903817 Cx3cl1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of CX3CL1 mRNA CTD PMID:25181051 Cx3cl1 Rat bisphenol F decreases expression ISO Cx3cl1 (Mus musculus) 6480464 bisphenol F results in decreased expression of CX3CL1 mRNA CTD PMID:30951980 Cx3cl1 Rat bleomycin A2 increases expression ISO Cx3cl1 (Mus musculus) 6480464 Bleomycin results in increased expression of CX3CL1 protein CTD PMID:30825431 Cx3cl1 Rat bleomycin A2 multiple interactions ISO Cx3cl1 (Mus musculus) 6480464 Cannabidiol analog promotes the reaction [Bleomycin results in increased expression of CX3CL1 protein] and lenabasum inhibits the reaction [Bleomycin results in increased expression of CX3CL1 protein] CTD PMID:30825431 Cx3cl1 Rat Brevianamide A increases expression ISO Cx3cl1 (Mus musculus) 6480464 brevianamide A results in increased expression of CX3CL1 mRNA CTD PMID:19818335 Cx3cl1 Rat cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of CX3CL1 mRNA CTD PMID:33453195 Cx3cl1 Rat caffeine decreases phosphorylation ISO CX3CL1 (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of CX3CL1 protein CTD PMID:35688186 Cx3cl1 Rat cannabidiol multiple interactions ISO Cx3cl1 (Mus musculus) 6480464 Cannabidiol analog promotes the reaction [Bleomycin results in increased expression of CX3CL1 protein] CTD PMID:30825431 Cx3cl1 Rat cannabidiol multiple interactions ISO CX3CL1 (Homo sapiens) 6480464 Cannabidiol inhibits the reaction [TNF protein results in increased expression of CX3CL1 mRNA] CTD PMID:31250491 Cx3cl1 Rat capsaicin affects expression EXP 6480464 Capsaicin affects the expression of CX3CL1 protein CTD PMID:22150557 Cx3cl1 Rat capsaicin multiple interactions EXP 6480464 [Naproxen co-treated with Sumatriptan] inhibits the reaction [Capsaicin affects the expression of CX3CL1 protein] more ... CTD PMID:22150557 Cx3cl1 Rat carbon nanotube decreases expression ISO Cx3cl1 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Cx3cl1 Rat ceric oxide increases expression EXP 6480464 ceric oxide results in increased expression of CX3CL1 mRNA CTD PMID:29463257 Cx3cl1 Rat chloroprene decreases expression EXP 6480464 Chloroprene results in decreased expression of CX3CL1 mRNA CTD PMID:23125180 Cx3cl1 Rat chlorpyrifos increases expression ISO Cx3cl1 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of CX3CL1 mRNA CTD PMID:37019170 Cx3cl1 Rat choline multiple interactions ISO Cx3cl1 (Mus musculus) 6480464 [Dietary Fats co-treated with Choline deficiency] results in increased expression of CX3CL1 protein and PANX1 gene mutant form inhibits the reaction [[Dietary Fats co-treated with Choline deficiency] results in increased expression of CX3CL1 protein] CTD PMID:29246445 Cx3cl1 Rat chromium atom decreases expression ISO CX3CL1 (Homo sapiens) 6480464 Chromium results in decreased expression of CX3CL1 mRNA CTD PMID:17547211 Cx3cl1 Rat ciguatoxin CTX1B affects expression ISO Cx3cl1 (Mus musculus) 6480464 Ciguatoxins affects the expression of CX3CL1 mRNA CTD PMID:18353800 Cx3cl1 Rat clofibrate multiple interactions ISO CX3CL1 (Homo sapiens) 6480464 Clofibrate inhibits the reaction [Glucose results in increased expression of CX3CL1 mRNA] and Clofibrate inhibits the reaction [Glucose results in increased expression of CX3CL1 protein] CTD PMID:19132243 Cx3cl1 Rat cobalt atom multiple interactions ISO Cx3cl1 (Mus musculus) 6480464 [Zinc co-treated with Nickel co-treated with Cobalt co-treated with 1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with INS1 protein] results in decreased expression of CX3CL1 mRNA and TNF protein promotes the reaction [[Zinc co-treated with Nickel co-treated with Cobalt co-treated with 1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with INS1 protein] results in decreased expression of CX3CL1 mRNA] CTD PMID:23503329 Cx3cl1 Rat cocaine increases expression EXP 6480464 Cocaine results in increased expression of CX3CL1 mRNA CTD PMID:16076954 Cx3cl1 Rat copper(II) sulfate decreases expression ISO CX3CL1 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of CX3CL1 mRNA CTD PMID:19549813 Cx3cl1 Rat crocidolite asbestos increases expression ISO Cx3cl1 (Mus musculus) 6480464 Asbestos and Crocidolite results in increased expression of CX3CL1 mRNA CTD PMID:29507420 Cx3cl1 Rat cyclophosphamide increases expression EXP 6480464 Cyclophosphamide results in increased expression of CX3CL1 protein CTD PMID:16651033 Cx3cl1 Rat cyclosporin A increases expression ISO CX3CL1 (Homo sapiens) 6480464 Cyclosporine results in increased expression of CX3CL1 mRNA CTD PMID:20106945 Cx3cl1 Rat cyclosporin A decreases expression ISO CX3CL1 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of CX3CL1 mRNA CTD PMID:25562108 Cx3cl1 Rat D-glucose multiple interactions ISO CX3CL1 (Homo sapiens) 6480464 2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one inhibits the reaction [Glucose results in increased expression of CX3CL1 mRNA] more ... CTD PMID:19132243 Cx3cl1 Rat D-glucose increases expression ISO CX3CL1 (Homo sapiens) 6480464 Glucose results in increased expression of CX3CL1 mRNA and Glucose results in increased expression of CX3CL1 protein CTD PMID:19132243 and PMID:31655124 Cx3cl1 Rat deoxynivalenol increases expression ISO CX3CL1 (Homo sapiens) 6480464 deoxynivalenol results in increased expression of CX3CL1 mRNA CTD PMID:22846391 Cx3cl1 Rat dexamethasone multiple interactions ISO Cx3cl1 (Mus musculus) 6480464 [Dexamethasone co-treated with rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS1 protein] results in increased expression of CX3CL1 mRNA more ... CTD PMID:16054899 and PMID:23503329 Cx3cl1 Rat dexamethasone decreases expression ISO Cx3cl1 (Mus musculus) 6480464 Dexamethasone results in decreased expression of CX3CL1 mRNA CTD PMID:22733784 Cx3cl1 Rat dexamethasone increases expression ISO Cx3cl1 (Mus musculus) 6480464 Dexamethasone results in increased expression of CX3CL1 mRNA CTD PMID:21041162 Cx3cl1 Rat diarsenic trioxide decreases expression ISO CX3CL1 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of CX3CL1 mRNA CTD PMID:17547211 Cx3cl1 Rat dibenz[a,h]anthracene decreases expression ISO Cx3cl1 (Mus musculus) 6480464 1 more ... CTD PMID:26377693 Cx3cl1 Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of CX3CL1 mRNA CTD PMID:21266533 Cx3cl1 Rat dibutyl phthalate increases expression ISO Cx3cl1 (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of CX3CL1 mRNA CTD PMID:21266533 Cx3cl1 Rat dicyclanil increases expression ISO Cx3cl1 (Mus musculus) 6480464 dicyclanil results in increased expression of CX3CL1 mRNA CTD PMID:15664270 Cx3cl1 Rat dioxygen increases response to substance ISO CX3CL1 (Homo sapiens) 6480464 Oxygen deficiency results in increased susceptibility to CX3CL1 protein CTD PMID:17476338 Cx3cl1 Rat diuron increases expression EXP 6480464 Diuron metabolite results in increased expression of CX3CL1 mRNA CTD PMID:24172598 Cx3cl1 Rat dorsomorphin multiple interactions ISO CX3CL1 (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of CX3CL1 mRNA CTD PMID:27188386 Cx3cl1 Rat doxorubicin decreases expression ISO CX3CL1 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of CX3CL1 mRNA CTD PMID:29803840 Cx3cl1 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of CX3CL1 mRNA CTD PMID:29391264 Cx3cl1 Rat enzacamene increases expression ISO CX3CL1 (Homo sapiens) 6480464 enzacamene results in increased expression of CX3CL1 mRNA CTD PMID:30597193 Cx3cl1 Rat ethanol affects expression EXP 6480464 Ethanol affects the expression of CX3CL1 mRNA CTD PMID:11772933 Cx3cl1 Rat ethanol multiple interactions ISO Cx3cl1 (Mus musculus) 6480464 [Carbon Tetrachloride co-treated with Ethanol] results in increased expression of CX3CL1 mRNA and Ethanol affects the expression of and affects the splicing of CX3CL1 mRNA CTD PMID:30319688 and PMID:30517762 Cx3cl1 Rat fenofibrate multiple interactions ISO CX3CL1 (Homo sapiens) 6480464 Fenofibrate inhibits the reaction [Glucose results in increased expression of CX3CL1 mRNA] and Fenofibrate inhibits the reaction [Glucose results in increased expression of CX3CL1 protein] CTD PMID:19132243 Cx3cl1 Rat fenvalerate decreases expression EXP 6480464 fenvalerate results in decreased expression of CX3CL1 mRNA CTD PMID:30307764 Cx3cl1 Rat fipronil increases expression EXP 6480464 fipronil results in increased expression of CX3CL1 mRNA CTD PMID:31881178 Cx3cl1 Rat folic acid multiple interactions ISO Cx3cl1 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of CX3CL1 mRNA CTD PMID:22206623 Cx3cl1 Rat fructose increases expression ISO CX3CL1 (Homo sapiens) 6480464 Fructose results in increased expression of CX3CL1 mRNA CTD PMID:31655124 Cx3cl1 Rat furan decreases methylation EXP 6480464 furan results in decreased methylation of CX3CL1 gene CTD PMID:27387713 Cx3cl1 Rat furan increases expression EXP 6480464 furan results in increased expression of CX3CL1 mRNA CTD PMID:27387713 Cx3cl1 Rat gamma-aminobutyric acid affects expression EXP 6480464 gamma-Aminobutyric Acid affects the expression of CX3CL1 mRNA CTD PMID:26924987 Cx3cl1 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of CX3CL1 mRNA CTD PMID:33387578 Cx3cl1 Rat glucose multiple interactions ISO CX3CL1 (Homo sapiens) 6480464 2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one inhibits the reaction [Glucose results in increased expression of CX3CL1 mRNA] more ... CTD PMID:19132243 Cx3cl1 Rat glucose increases expression ISO CX3CL1 (Homo sapiens) 6480464 Glucose results in increased expression of CX3CL1 mRNA and Glucose results in increased expression of CX3CL1 protein CTD PMID:19132243 and PMID:31655124 Cx3cl1 Rat graphene oxide decreases expression ISO Cx3cl1 (Mus musculus) 6480464 graphene oxide results in decreased expression of CX3CL1 mRNA CTD PMID:33227293 Cx3cl1 Rat hydrogen peroxide multiple interactions EXP 6480464 CX3CL1 inhibits the reaction [Vehicle Emissions results in increased abundance of Hydrogen Peroxide] CTD PMID:21561831 Cx3cl1 Rat ibuprofen affects expression ISO CX3CL1 (Homo sapiens) 6480464 Ibuprofen affects the expression of CX3CL1 mRNA CTD PMID:17070997 Cx3cl1 Rat ketamine increases expression EXP 6480464 Ketamine results in increased expression of CX3CL1 mRNA CTD PMID:20080153 Cx3cl1 Rat lead diacetate increases secretion EXP 6480464 lead acetate results in increased secretion of CX3CL1 protein CTD PMID:17047031 Cx3cl1 Rat lead(0) affects expression ISO CX3CL1 (Homo sapiens) 6480464 Lead affects the expression of CX3CL1 mRNA CTD PMID:28903495 Cx3cl1 Rat lipopolysaccharide multiple interactions ISO CX3CL1 (Homo sapiens) 6480464 2'-hydroxyflavanone inhibits the reaction [Lipopolysaccharides results in increased secretion of CX3CL1 protein] more ... CTD PMID:32800949 and PMID:35811015 Cx3cl1 Rat lipopolysaccharide increases expression ISO CX3CL1 (Homo sapiens) 6480464 Lipopolysaccharides results in increased expression of CX3CL1 mRNA CTD PMID:35811015 Cx3cl1 Rat lipopolysaccharide increases expression ISO Cx3cl1 (Mus musculus) 6480464 Lipopolysaccharides results in increased expression of CX3CL1 mRNA CTD PMID:26582142 Cx3cl1 Rat lipopolysaccharide multiple interactions ISO Cx3cl1 (Mus musculus) 6480464 (+)-JQ1 compound inhibits the reaction [Lipopolysaccharides results in increased expression of CX3CL1 mRNA] CTD PMID:26582142 Cx3cl1 Rat lipopolysaccharide increases secretion ISO CX3CL1 (Homo sapiens) 6480464 Lipopolysaccharides results in increased secretion of CX3CL1 protein CTD PMID:32800949 Cx3cl1 Rat manganese(II) chloride increases expression EXP 6480464 manganese chloride results in increased expression of CX3CL1 mRNA CTD PMID:28801915 Cx3cl1 Rat mechlorethamine increases expression EXP 6480464 Mechlorethamine results in increased expression of CX3CL1 mRNA CTD PMID:26273949 Cx3cl1 Rat methadone increases secretion EXP 6480464 Methadone results in increased secretion of CX3CL1 protein CTD PMID:20178837 Cx3cl1 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of CX3CL1 gene CTD PMID:35440735 Cx3cl1 Rat methylmercury chloride decreases expression ISO Cx3cl1 (Mus musculus) 6480464 methylmercuric chloride results in decreased expression of CX3CL1 mRNA CTD PMID:29261810 Cx3cl1 Rat microcystin-LR increases expression EXP 6480464 cyanoginosin LR results in increased expression of CX3CL1 protein CTD PMID:34740672 Cx3cl1 Rat microcystin-LR multiple interactions EXP 6480464 [Dietary Fats co-treated with Cholesterol and Dietary co-treated with cyanoginosin LR] results in increased expression of CX3CL1 protein CTD PMID:34740672 Cx3cl1 Rat mifepristone increases expression ISO CX3CL1 (Homo sapiens) 6480464 Mifepristone results in increased expression of CX3CL1 mRNA CTD PMID:17584828 Cx3cl1 Rat morphine affects response to substance EXP 6480464 CX3CL1 protein affects the susceptibility to Morphine CTD PMID:15317861 Cx3cl1 Rat morphine increases secretion EXP 6480464 Morphine results in increased secretion of CX3CL1 protein CTD PMID:20178837 Cx3cl1 Rat mycophenolic acid increases expression ISO Cx3cl1 (Mus musculus) 6480464 Mycophenolic Acid results in increased expression of CX3CL1 mRNA CTD PMID:19818335 Cx3cl1 Rat mycotoxin increases expression ISO Cx3cl1 (Mus musculus) 6480464 Mycotoxins results in increased expression of CX3CL1 mRNA CTD PMID:19818335 Cx3cl1 Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal multiple interactions ISO CX3CL1 (Homo sapiens) 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde inhibits the reaction [TNF protein results in increased expression of CX3CL1 mRNA] CTD PMID:11698246 Cx3cl1 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of CX3CL1 mRNA and [Diethylnitrosamine co-treated with Thioacetamide] results in increased expression of CX3CL1 mRNA CTD PMID:18164116 and PMID:23830814 Cx3cl1 Rat N-nitrosodimethylamine decreases expression ISO CX3CL1 (Homo sapiens) 6480464 Dimethylnitrosamine results in decreased expression of CX3CL1 mRNA CTD PMID:17547211 Cx3cl1 Rat naproxen multiple interactions EXP 6480464 [Naproxen co-treated with Sumatriptan] inhibits the reaction [Capsaicin affects the expression of CX3CL1 protein] and Naproxen inhibits the reaction [Capsaicin affects the expression of CX3CL1 protein] CTD PMID:22150557 Cx3cl1 Rat neoechinulin A increases expression ISO Cx3cl1 (Mus musculus) 6480464 neoechinulin A results in increased expression of CX3CL1 mRNA CTD PMID:19818335 Cx3cl1 Rat nickel atom affects expression ISO CX3CL1 (Homo sapiens) 6480464 Nickel affects the expression of CX3CL1 mRNA CTD PMID:14575637 Cx3cl1 Rat nickel atom multiple interactions ISO Cx3cl1 (Mus musculus) 6480464 [Zinc co-treated with Nickel co-treated with Cobalt co-treated with 1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with INS1 protein] results in decreased expression of CX3CL1 mRNA and TNF protein promotes the reaction [[Zinc co-treated with Nickel co-treated with Cobalt co-treated with 1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with INS1 protein] results in decreased expression of CX3CL1 mRNA] CTD PMID:23503329 Cx3cl1 Rat nickel atom multiple interactions ISO CX3CL1 (Homo sapiens) 6480464 trichostatin A inhibits the reaction [Nickel affects the expression of CX3CL1 mRNA] CTD PMID:14575637 Cx3cl1 Rat nickel dichloride increases expression ISO CX3CL1 (Homo sapiens) 6480464 nickel chloride results in increased expression of CX3CL1 mRNA CTD PMID:17312168 Cx3cl1 Rat ozone decreases expression EXP 6480464 Ozone results in decreased expression of CX3CL1 mRNA CTD PMID:16716893 Cx3cl1 Rat ozone increases expression ISO CX3CL1 (Homo sapiens) 6480464 Ozone results in increased expression of CX3CL1 mRNA CTD PMID:31476115 Cx3cl1 Rat ozone multiple interactions ISO CX3CL1 (Homo sapiens) 6480464 [Aripiprazole co-treated with Ozone] results in increased expression of CX3CL1 mRNA CTD PMID:31476115 Cx3cl1 Rat p-cresol multiple interactions ISO CX3CL1 (Homo sapiens) 6480464 4-cresol inhibits the reaction [IL1B protein results in increased expression of CX3CL1 protein] CTD PMID:16954166 Cx3cl1 Rat panobinostat multiple interactions ISO CX3CL1 (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of CX3CL1 mRNA CTD PMID:27188386 Cx3cl1 Rat panobinostat increases expression ISO CX3CL1 (Homo sapiens) 6480464 panobinostat results in increased expression of CX3CL1 mRNA CTD PMID:26272509 Cx3cl1 Rat paracetamol affects expression ISO Cx3cl1 (Mus musculus) 6480464 Acetaminophen affects the expression of CX3CL1 mRNA CTD PMID:17562736 Cx3cl1 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of CX3CL1 mRNA CTD PMID:33387578 Cx3cl1 Rat paracetamol increases expression ISO CX3CL1 (Homo sapiens) 6480464 Acetaminophen results in increased expression of CX3CL1 mRNA CTD PMID:29067470 Cx3cl1 Rat paracetamol increases expression ISO Cx3cl1 (Mus musculus) 6480464 Acetaminophen results in increased expression of CX3CL1 protein CTD PMID:29246445 Cx3cl1 Rat paracetamol multiple interactions ISO Cx3cl1 (Mus musculus) 6480464 [MST1R protein mutant form co-treated with Acetaminophen] results in increased expression of CX3CL1 mRNA CTD PMID:22575169 Cx3cl1 Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of CX3CL1 mRNA CTD PMID:35163327 Cx3cl1 Rat phenobarbital affects expression ISO CX3CL1 (Homo sapiens) 6480464 Phenobarbital affects the expression of CX3CL1 mRNA CTD PMID:19159669 Cx3cl1 Rat phenytoin increases expression EXP 6480464 Phenytoin results in increased expression of CX3CL1 mRNA CTD PMID:20345932 Cx3cl1 Rat phorbol 13-acetate 12-myristate decreases expression ISO CX3CL1 (Homo sapiens) 6480464 Tetradecanoylphorbol Acetate results in decreased expression of CX3CL1 mRNA CTD PMID:19850645 Cx3cl1 Rat potassium dichromate decreases expression ISO CX3CL1 (Homo sapiens) 6480464 Potassium Dichromate results in decreased expression of CX3CL1 mRNA CTD PMID:17547211 Cx3cl1 Rat progesterone multiple interactions ISO CX3CL1 (Homo sapiens) 6480464 CX3CL1 protein promotes the reaction [CGB3 protein results in increased abundance of Progesterone] CTD PMID:18292196 Cx3cl1 Rat progesterone decreases expression ISO Cx3cl1 (Mus musculus) 6480464 Progesterone results in decreased expression of CX3CL1 mRNA CTD PMID:22238285 Cx3cl1 Rat quercetin decreases expression ISO CX3CL1 (Homo sapiens) 6480464 Quercetin results in decreased expression of CX3CL1 mRNA CTD PMID:21632981 Cx3cl1 Rat resveratrol multiple interactions ISO CX3CL1 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of CX3CL1 mRNA more ... CTD PMID:16614140 and PMID:23557933 Cx3cl1 Rat resveratrol decreases expression ISO CX3CL1 (Homo sapiens) 6480464 resveratrol results in decreased expression of CX3CL1 mRNA CTD PMID:23224687 Cx3cl1 Rat resveratrol multiple interactions EXP 6480464 resveratrol inhibits the reaction [TNF protein results in increased expression of CX3CL1 protein] CTD PMID:16614140 Cx3cl1 Rat rofecoxib affects expression ISO CX3CL1 (Homo sapiens) 6480464 rofecoxib affects the expression of CX3CL1 mRNA CTD PMID:17070997 Cx3cl1 Rat rutin decreases expression EXP 6480464 Rutin results in decreased expression of CX3CL1 mRNA CTD PMID:28693884 Cx3cl1 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO CX3CL1 (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine inhibits the reaction [Lipopolysaccharides results in increased expression of CX3CL1 mRNA] CTD PMID:35811015 Cx3cl1 Rat SB 203580 multiple interactions ISO CX3CL1 (Homo sapiens) 6480464 SB 203580 inhibits the reaction [Glucose results in increased expression of CX3CL1 mRNA] and SB 203580 inhibits the reaction [Glucose results in increased expression of CX3CL1 protein] CTD PMID:19132243 Cx3cl1 Rat SB 431542 multiple interactions ISO CX3CL1 (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of CX3CL1 mRNA CTD PMID:27188386 Cx3cl1 Rat silicon dioxide increases expression EXP 6480464 Silicon Dioxide results in increased expression of CX3CL1 mRNA CTD PMID:22431001 Cx3cl1 Rat silver atom increases secretion EXP 6480464 Silver results in increased secretion of CX3CL1 protein CTD PMID:26702581 Cx3cl1 Rat silver(0) increases secretion EXP 6480464 Silver results in increased secretion of CX3CL1 protein CTD PMID:26702581 Cx3cl1 Rat sodium arsenite decreases expression ISO Cx3cl1 (Mus musculus) 6480464 sodium arsenite results in decreased expression of CX3CL1 mRNA CTD PMID:21911445 Cx3cl1 Rat sodium arsenite multiple interactions ISO Cx3cl1 (Mus musculus) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased secretion of CX3CL1 protein CTD PMID:37527016 Cx3cl1 Rat sodium arsenite increases expression ISO CX3CL1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of CX3CL1 mRNA CTD PMID:29301061 Cx3cl1 Rat sotorasib multiple interactions ISO CX3CL1 (Homo sapiens) 6480464 [sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in increased expression of CX3CL1 mRNA CTD PMID:36139627 Cx3cl1 Rat sterigmatocystin increases expression ISO Cx3cl1 (Mus musculus) 6480464 Sterigmatocystin results in increased expression of CX3CL1 mRNA CTD PMID:19818335 Cx3cl1 Rat sumatriptan multiple interactions EXP 6480464 [Naproxen co-treated with Sumatriptan] inhibits the reaction [Capsaicin affects the expression of CX3CL1 protein] and Sumatriptan inhibits the reaction [Capsaicin affects the expression of CX3CL1 protein] CTD PMID:22150557 Cx3cl1 Rat sunitinib decreases expression ISO CX3CL1 (Homo sapiens) 6480464 Sunitinib results in decreased expression of CX3CL1 mRNA CTD PMID:31533062 Cx3cl1 Rat tamoxifen affects expression ISO Cx3cl1 (Mus musculus) 6480464 Tamoxifen affects the expression of CX3CL1 mRNA CTD PMID:17555576 Cx3cl1 Rat temozolomide increases expression ISO CX3CL1 (Homo sapiens) 6480464 Temozolomide results in increased expression of CX3CL1 mRNA CTD PMID:31758290 Cx3cl1 Rat tetrachloromethane multiple interactions ISO Cx3cl1 (Mus musculus) 6480464 [Carbon Tetrachloride co-treated with Ethanol] results in increased expression of CX3CL1 mRNA CTD PMID:30517762 Cx3cl1 Rat thioacetamide multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Thioacetamide] results in increased expression of CX3CL1 mRNA CTD PMID:23830814 Cx3cl1 Rat titanium dioxide decreases expression ISO Cx3cl1 (Mus musculus) 6480464 titanium dioxide results in decreased expression of CX3CL1 mRNA CTD PMID:27760801 Cx3cl1 Rat titanium dioxide increases expression EXP 6480464 titanium dioxide results in increased expression of CX3CL1 mRNA CTD PMID:30012374 Cx3cl1 Rat TMC-120A increases expression ISO Cx3cl1 (Mus musculus) 6480464 TMC 120A results in increased expression of CX3CL1 mRNA CTD PMID:19818335 Cx3cl1 Rat trametinib multiple interactions ISO CX3CL1 (Homo sapiens) 6480464 [sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in increased expression of CX3CL1 mRNA CTD PMID:36139627 Cx3cl1 Rat tributylstannane increases expression ISO Cx3cl1 (Mus musculus) 6480464 tributyltin results in increased expression of CX3CL1 mRNA CTD PMID:31939706 Cx3cl1 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of CX3CL1 mRNA CTD PMID:33387578 Cx3cl1 Rat trichostatin A multiple interactions ISO CX3CL1 (Homo sapiens) 6480464 trichostatin A inhibits the reaction [Nickel affects the expression of CX3CL1 mRNA] CTD PMID:14575637 Cx3cl1 Rat triclosan increases expression ISO CX3CL1 (Homo sapiens) 6480464 Triclosan results in increased expression of CX3CL1 mRNA CTD PMID:30510588 Cx3cl1 Rat tris(2-butoxyethyl) phosphate affects expression ISO CX3CL1 (Homo sapiens) 6480464 tris(2-butoxyethyl) phosphate affects the expression of CX3CL1 mRNA CTD PMID:29024780 Cx3cl1 Rat valproic acid decreases expression ISO CX3CL1 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of CX3CL1 mRNA CTD PMID:29154799 Cx3cl1 Rat valproic acid affects expression ISO CX3CL1 (Homo sapiens) 6480464 Valproic Acid affects the expression of CX3CL1 mRNA CTD PMID:25979313 Cx3cl1 Rat valproic acid increases expression ISO CX3CL1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of CX3CL1 mRNA CTD PMID:23179753 Cx3cl1 Rat valproic acid decreases expression ISO Cx3cl1 (Mus musculus) 6480464 Valproic Acid results in decreased expression of CX3CL1 mRNA CTD PMID:21427059 Cx3cl1 Rat valproic acid increases expression ISO Cx3cl1 (Mus musculus) 6480464 Valproic Acid results in increased expression of CX3CL1 mRNA CTD PMID:21427059 Cx3cl1 Rat vancomycin decreases expression ISO Cx3cl1 (Mus musculus) 6480464 Vancomycin results in decreased expression of CX3CL1 mRNA CTD PMID:18930951 Cx3cl1 Rat zinc atom multiple interactions ISO Cx3cl1 (Mus musculus) 6480464 [Zinc co-treated with Nickel co-treated with Cobalt co-treated with 1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with INS1 protein] results in decreased expression of CX3CL1 mRNA and TNF protein promotes the reaction [[Zinc co-treated with Nickel co-treated with Cobalt co-treated with 1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with INS1 protein] results in decreased expression of CX3CL1 mRNA] CTD PMID:23503329 Cx3cl1 Rat zinc(0) multiple interactions ISO Cx3cl1 (Mus musculus) 6480464 [Zinc co-treated with Nickel co-treated with Cobalt co-treated with 1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with INS1 protein] results in decreased expression of CX3CL1 mRNA and TNF protein promotes the reaction [[Zinc co-treated with Nickel co-treated with Cobalt co-treated with 1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with INS1 protein] results in decreased expression of CX3CL1 mRNA] CTD PMID:23503329 Cx3cl1 Rat zoledronic acid increases expression ISO CX3CL1 (Homo sapiens) 6480464 zoledronic acid results in increased expression of CX3CL1 mRNA CTD PMID:24714768
Imported Annotations - KEGG (archival)
1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3-dimethoxynaphthalene-1,4-dione (ISO) 2,4,6-trinitrobenzenesulfonic acid (ISO) 2,4-diaminotoluene (ISO) 2-acetamidofluorene (EXP) 2-methylcholine (ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP,ISO) 3,4-dichloroaniline (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 3-methylcholanthrene (ISO) 4,4'-sulfonyldiphenol (ISO) 4-(ethoxymethylene)-2-phenyloxazol-5-one (ISO) 4-hydroxyphenyl retinamide (ISO) 8-Br-cAMP (ISO) acetylsalicylic acid (ISO) acrylamide (EXP,ISO) aflatoxin B1 (EXP,ISO) aldehydo-D-glucose (ISO) all-trans-retinoic acid (EXP,ISO) alpha-Zearalanol (EXP) aluminium atom (ISO) aluminium(0) (ISO) ammonium chloride (EXP) aripiprazole (ISO) aristolochic acid A (EXP,ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) arsenous acid (ISO) asperentin (ISO) benzo[a]pyrene (ISO) benzo[b]fluoranthene (ISO) beta-naphthoflavone (EXP) bis(2-chloroethyl) sulfide (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) bleomycin A2 (ISO) Brevianamide A (ISO) cadmium dichloride (EXP) caffeine (ISO) cannabidiol (ISO) capsaicin (EXP) carbon nanotube (ISO) ceric oxide (EXP) chloroprene (EXP) chlorpyrifos (ISO) choline (ISO) chromium atom (ISO) ciguatoxin CTX1B (ISO) clofibrate (ISO) cobalt atom (ISO) cocaine (EXP) copper(II) sulfate (ISO) crocidolite asbestos (ISO) cyclophosphamide (EXP) cyclosporin A (ISO) D-glucose (ISO) deoxynivalenol (ISO) dexamethasone (ISO) diarsenic trioxide (ISO) dibenz[a,h]anthracene (ISO) dibutyl phthalate (EXP,ISO) dicyclanil (ISO) dioxygen (ISO) diuron (EXP) dorsomorphin (ISO) doxorubicin (ISO) endosulfan (EXP) enzacamene (ISO) ethanol (EXP,ISO) fenofibrate (ISO) fenvalerate (EXP) fipronil (EXP) folic acid (ISO) fructose (ISO) furan (EXP) gamma-aminobutyric acid (EXP) gentamycin (EXP) glucose (ISO) graphene oxide (ISO) hydrogen peroxide (EXP) ibuprofen (ISO) ketamine (EXP) lead diacetate (EXP) lead(0) (ISO) lipopolysaccharide (ISO) manganese(II) chloride (EXP) mechlorethamine (EXP) methadone (EXP) methoxychlor (EXP) methylmercury chloride (ISO) microcystin-LR (EXP) mifepristone (ISO) morphine (EXP) mycophenolic acid (ISO) mycotoxin (ISO) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO) N-nitrosodiethylamine (EXP) N-nitrosodimethylamine (ISO) naproxen (EXP) neoechinulin A (ISO) nickel atom (ISO) nickel dichloride (ISO) ozone (EXP,ISO) p-cresol (ISO) panobinostat (ISO) paracetamol (EXP,ISO) perfluorooctanoic acid (EXP) phenobarbital (ISO) phenytoin (EXP) phorbol 13-acetate 12-myristate (ISO) potassium dichromate (ISO) progesterone (ISO) quercetin (ISO) resveratrol (EXP,ISO) rofecoxib (ISO) rutin (EXP) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 203580 (ISO) SB 431542 (ISO) silicon dioxide (EXP) silver atom (EXP) silver(0) (EXP) sodium arsenite (ISO) sotorasib (ISO) sterigmatocystin (ISO) sumatriptan (EXP) sunitinib (ISO) tamoxifen (ISO) temozolomide (ISO) tetrachloromethane (ISO) thioacetamide (EXP) titanium dioxide (EXP,ISO) TMC-120A (ISO) trametinib (ISO) tributylstannane (ISO) trichloroethene (EXP) trichostatin A (ISO) triclosan (ISO) tris(2-butoxyethyl) phosphate (ISO) valproic acid (ISO) vancomycin (ISO) zinc atom (ISO) zinc(0) (ISO) zoledronic acid (ISO)
Biological Process
angiogenesis involved in wound healing (IEA,ISO) antimicrobial humoral immune response mediated by antimicrobial peptide (IBA) autocrine signaling (IGI) cell adhesion (IEA,ISO) cell chemotaxis (IEA,ISO) cell-cell adhesion (IDA) cellular response to tumor necrosis factor (IDA) chemokine-mediated signaling pathway (IBA,IEA,IGI,ISO) chemotaxis (IDA,IEA,IGI,ISO) cytokine-mediated signaling pathway (IEA,ISO) eosinophil chemotaxis (IBA) extrinsic apoptotic signaling pathway in absence of ligand (IEA,ISO) G protein-coupled receptor signaling pathway (IGI) immune response (IEA) inflammatory response (IBA,IEA) inhibitory postsynaptic potential (IMP) integrin activation (IEA,ISO,ISS) leukocyte migration involved in inflammatory response (IEA,ISO,ISS) lymphocyte chemotaxis (IEA,ISO) macrophage chemotaxis (IEA) microglial cell activation (IDA) microglial cell proliferation (IEA,ISO) negative regulation of apoptotic process (IEA,ISO) negative regulation of apoptotic signaling pathway (IEA,ISO) negative regulation of cell migration (IEA,ISO) negative regulation of extrinsic apoptotic signaling pathway in absence of ligand (IEA,ISO) negative regulation of glutamate receptor signaling pathway (IDA) negative regulation of hippocampal neuron apoptotic process (IEA,ISO) negative regulation of interleukin-1 alpha production (IDA) negative regulation of microglial cell activation (IDA) negative regulation of tumor necrosis factor production (IEA,ISO) negative regulation of vasoconstriction (IDA) neuron cellular homeostasis (IDA) neutrophil chemotaxis (IEA,ISO) positive chemotaxis (IEA,ISO) positive regulation of actin filament bundle assembly (IEA,ISO) positive regulation of angiogenesis (IEA) positive regulation of calcium-independent cell-cell adhesion (IEA,ISO) positive regulation of canonical NF-kappaB signal transduction (IEA,IGI,ISO) positive regulation of cell adhesion (IDA) positive regulation of cell migration (IBA,IDA) positive regulation of cell population proliferation (IEA,ISO) positive regulation of inflammatory response (IEA,ISO) positive regulation of macrophage chemotaxis (IMP) positive regulation of MAPK cascade (IEA,ISO) positive regulation of microglial cell migration (IEA,ISO) positive regulation of neuroblast proliferation (IDA) positive regulation of neuron projection development (IDA) positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction (IEA,IMP,ISO) positive regulation of release of sequestered calcium ion into cytosol (IEA,ISO) positive regulation of smooth muscle cell proliferation (IDA) positive regulation of transcription by RNA polymerase II (IDA) positive regulation of transforming growth factor beta1 production (IEA,ISO) regulation of lipopolysaccharide-mediated signaling pathway (IEA,ISO) response to hypoxia (IEP) response to ischemia (IGI) signal transduction (IEA) wound healing (IEA,ISO)
Cellular Component
cell body (IEA,ISO) cell projection (IDA) cell surface (IEA,ISO) extracellular region (IDA,IEA,ISO) extracellular space (IBA,IEA) membrane (IDA,IEA,ISO) neuron projection (IDA,IEA,ISO) neuronal cell body (IDA,IEA,ISO) perinuclear region of cytoplasm (IDA) plasma membrane (IEA,ISO,ISS) postsynapse (IEA)
1.
Small airway obstruction in severe pulmonary arterial hypertension correlates with increased airway CD8+ T-cells and fractalkine expression.
Ars C, etal., Eur Respir J. 2009 Dec;34(6):1494-6.
2.
Delta chemokine (fractalkine)--a novel mediator of pulmonary arterial hypertension in children undergoing cardiac surgery.
Avni T, etal., Cytokine. 2010 Dec;52(3):143-5.
3.
Fractalkine and CX 3 CR1 regulate hippocampal neurogenesis in adult and aged rats.
Bachstetter AD, etal., Neurobiol Aging. 2011 Nov;32(11):2030-44. doi: 10.1016/j.neurobiolaging.2009.11.022. Epub 2009 Dec 16.
4.
Role of Spinal Microglia in Visceral Hyperalgesia and NK1R Up-regulation in a Rat Model of Chronic Stress.
Bradesi S, etal., Gastroenterology. 2008 Dec 24.
5.
Chronic neuroinflammation and cognitive impairment following transient global cerebral ischemia: role of fractalkine/CX3CR1 signaling.
Briones TL, etal., J Neuroinflammation. 2014 Jan 22;11:13. doi: 10.1186/1742-2094-11-13.
6.
Fractalkine (CX3CL1) stimulated by nuclear factor kappaB (NF-kappaB)-dependent inflammatory signals induces aortic smooth muscle cell proliferation through an autocrine pathway.
Chandrasekar B, etal., Biochem J. 2003 Jul 15;373(Pt 2):547-58. doi: 10.1042/BJ20030207.
7.
Expression of CX3CL1/fractalkine by mesangial cells in vitro and in acute anti-Thy1 glomerulonephritis in rats.
Chen YM, etal., Nephrol Dial Transplant. 2003 Dec;18(12):2505-14.
8.
Expression of fractalkine (CX3CL1) and its receptor in endotoxin-induced uveitis.
Chu L, etal., Ophthalmic Res. 2009;42(3):160-6. Epub 2009 Jul 31.
9.
Infiltration of macrophages through the atrial endocardium of inflammation-induced rats: contribution of fractalkine.
Date T, etal., Circ J. 2009 May;73(5):932-7. Epub 2009 Mar 12.
10.
Efficacy and safety of an antiviral Iota-Carrageenan nasal spray: a randomized, double-blind, placebo-controlled exploratory study in volunteers with early symptoms of the common cold.
Eccles R, etal., Respir Res. 2010 Aug 10;11:108.
11.
Expression of fractalkine and its receptor, CX3CR1, in atopic dermatitis: possible contribution to skin inflammation.
Echigo T, etal., J Allergy Clin Immunol. 2004 May;113(5):940-8.
12.
Expression of CX3C chemokine, fractalkine, and its receptor CX3CR1 in experimental autoimmune anterior uveitis.
Fang IM, etal., Mol Vis. 2005 Jul 1;11:443-51.
13.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
14.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
15.
Role for neuronally derived fractalkine in mediating interactions between neurons and CX3CR1-expressing microglia.
Harrison JK, etal., Proc Natl Acad Sci U S A 1998 Sep 1;95(18):10896-901.
16.
Up regulated expression of fractalkine/CX3CL1 and CX3CR1 in patients with systemic sclerosis.
Hasegawa M, etal., Ann Rheum Dis. 2005 Jan;64(1):21-8.
17.
Fractalkine/CX3CL1 enhances GABA synaptic activity at serotonin neurons in the rat dorsal raphe nucleus.
Heinisch S and Kirby LG, Neuroscience. 2009 Dec 15;164(3):1210-23. Epub 2009 Sep 10.
18.
Pulmonary infection of mice with human metapneumovirus induces local cytotoxic T-cell and immunoregulatory cytokine responses similar to those seen with human respiratory syncytial virus.
Herd KA, etal., J Gen Virol. 2010 May;91(Pt 5):1302-10. Epub 2010 Jan 6.
19.
Fractalkine upregulates inflammation through CX3CR1 and the Jak-Stat pathway in severe acute pancreatitis rat model.
Huang LY, etal., Inflammation. 2012 Jun;35(3):1023-30. doi: 10.1007/s10753-011-9406-5.
20.
Expression of fractalkine (CX3CL1) and its receptor, CX3CR1, during acute and chronic inflammation in the rodent CNS.
Hughes PM, etal., Glia. 2002 Mar 15;37(4):314-27.
21.
Fractalkine expression and the recruitment of CX3CR1+ cells in the prolonged mesangial proliferative glomerulonephritis.
Ito Y, etal., Kidney Int. 2002 Jun;61(6):2044-57.
22.
Interactions of chemokines and chemokine receptors mediate the migration of mesenchymal stem cells to the impaired site in the brain after hypoglossal nerve injury.
Ji JF, etal., Stem Cells. 2004;22(3):415-27.
23.
Expression of the chemokine fractalkine (FKN/CX3CL1) by podocytes in normal and proteinuric rat kidney glomerulus.
Katsuyama K, etal., Nephron Exp Nephrol. 2009;113(2):e45-56. Epub 2009 Jul 10.
24.
Involvement of fractalkine/CX3CL1 expression by dendritic cells in the enhancement of host immunity against Legionella pneumophila.
Kikuchi T, etal., Infect Immun. 2005 Sep;73(9):5350-7.
25.
Fractalkine and its receptor, CX3CR1, upregulation in streptozotocin-induced diabetic kidneys.
Kikuchi Y, etal., Nephron Exp Nephrol. 2004;97(1):e17-25.
26.
Reductions in circulating levels of IL-16, IL-7 and VEGF-A in myalgic encephalomyelitis/chronic fatigue syndrome.
Landi A, etal., Cytokine. 2016 Feb;78:27-36. doi: 10.1016/j.cyto.2015.11.018. Epub 2015 Nov 28.
27.
The chemokine CX3CL1 reduces migration and increases adhesion of neurons with mechanisms dependent on the beta1 integrin subunit.
Lauro C, etal., J Immunol. 2006 Dec 1;177(11):7599-606.
28.
[Effects of tetramethylpyrazine on fractalkine and tumor necrosis factor-alpha expression in patients with chronic pulmonary heart disease]
Li L, etal., Zhongguo Zhong Xi Yi Jie He Za Zhi. 2010 Apr;30(4):373-5.
29.
Chemokine CX3CL1 protects rat hippocampal neurons against glutamate-mediated excitotoxicity.
Limatola C, etal., J Neuroimmunol. 2005 Sep;166(1-2):19-28. doi: 10.1016/j.jneuroim.2005.03.023.
30.
Spinal changes associated with mechanical hypersensitivity in a model of Guillain-Barre syndrome.
Luongo L, etal., Neurosci Lett. 2008 May 30;437(2):98-102. Epub 2008 Apr 10.
31.
Fractalkine-induced activation of the phosphatidylinositol-3 kinase pathway attentuates microglial activation in vivo and in vitro.
Lyons A, etal., J Neurochem. 2009 Sep;110(5):1547-56. doi: 10.1111/j.1471-4159.2009.06253.x. Epub 2009 Jul 15.
32.
Elevated serum levels of soluble CX3CL1 in patients with microscopic polyangiitis.
Matsunawa M, etal., Clin Exp Rheumatol. 2009 Jan-Feb;27(1):72-8.
33.
CX3CL1 up-regulation is associated with recruitment of CX3CR1+ mononuclear phagocytes and T lymphocytes in the lungs during cigarette smoke-induced emphysema.
McComb JG, etal., Am J Pathol. 2008 Oct;173(4):949-61. Epub 2008 Sep 4.
34.
Gut-brain chemokine changes in portal hypertensive rats.
Merino J, etal., Dig Dis Sci. 2011 Aug;56(8):2309-17. doi: 10.1007/s10620-011-1625-y. Epub 2011 Feb 24.
35.
Interaction between CX3CL1 and CX3CR1 regulates vasculitis induced by immune complex deposition.
Morimura S, etal., Am J Pathol. 2013 May;182(5):1640-7. doi: 10.1016/j.ajpath.2013.01.023. Epub 2013 Mar 5.
36.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
37.
Changes in spinal cord expression of fractalkine and its receptor in a rat model of disc herniation by autologous nucleus pulposus.
Park HW, etal., Spine (Phila Pa 1976). 2011 Jan 8.
38.
Fractalkine-induced smooth muscle cell proliferation in pulmonary hypertension.
Perros F, etal., Eur Respir J. 2007 May;29(5):937-43. Epub 2006 Dec 20.
39.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
40.
Upregulation of chemokine receptor gene expression in brains of Borna disease virus (BDV)-infected rats in the absence and presence of inflammation.
Rauer M, etal., J Neurovirol. 2002 Jan;8(3):168-79.
41.
GOA pipeline
RGD automated data pipeline
42.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
43.
The CX3C chemokine fractalkine in allergic asthma and rhinitis.
Rimaniol AC, etal., J Allergy Clin Immunol. 2003 Dec;112(6):1139-46.
44.
A multilevel screening strategy defines a molecular fingerprint of proregenerative olfactory ensheathing cells and identifies SCARB2, a protein that improves regenerative sprouting of injured sensory spinal axons.
Roet KC, etal., J Neurosci. 2013 Jul 3;33(27):11116-35. doi: 10.1523/JNEUROSCI.1002-13.2013.
45.
Fractalkine, a novel chemokine in rheumatoid arthritis and in rat adjuvant-induced arthritis.
Ruth JH, etal., Arthritis Rheum. 2001 Jul;44(7):1568-81.
46.
Activation of fractalkine/CX3CR1 by vascular endothelial cells induces angiogenesis through VEGF-A/KDR and reverses hindlimb ischaemia.
Ryu J, etal., Cardiovasc Res. 2008 May 1;78(2):333-40. Epub 2007 Nov 11.
47.
Novel role of the membrane-bound chemokine fractalkine in platelet activation and adhesion.
Schafer A, etal., Blood. 2004 Jan 15;103(2):407-12. Epub 2003 Sep 11.
48.
Neuronal expression of fractalkine in the presence and absence of inflammation.
Schwaeble WJ, etal., FEBS Lett 1998 Nov 20;439(3):203-7.
49.
NEW evidences for fractalkine/CX3CL1 involved in substantia nigral microglial activation and behavioral changes in a rat model of Parkinson's disease.
Shan S, etal., Neurobiol Aging. 2009 Apr 14.
50.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
51.
Greater fractalkine expression in mesenteric arteries of female spontaneously hypertensive rats compared with males.
Sullivan JC, etal., Am J Physiol Heart Circ Physiol. 2009 Apr;296(4):H1080-8. Epub 2009 Feb 6.
52.
[Effects of aspirin on CX3CL1 and CX3CR1 in acute pulmonary embolism rats].
Sun C, etal., Zhonghua Yi Xue Za Zhi. 2013 Jan 1;93(1):69-72.
53.
Inhibition of the Activation and Recruitment of Microglia-Like Cells Protects Against Neomycin-Induced Ototoxicity.
Sun S, etal., Mol Neurobiol. 2014 May 1.
54.
CX3CL1 (fractalkine) and CX3CR1 expression in myelin oligodendrocyte glycoprotein-induced experimental autoimmune encephalomyelitis: kinetics and cellular origin.
Sunnemark D, etal., J Neuroinflammation. 2005 Jul 29;2:17.
55.
Serum level of soluble CX3CL1/fractalkine is elevated in patients with polymyositis and dermatomyositis, which is correlated with disease activity.
Suzuki F, etal., Arthritis Res Ther. 2012 Mar 6;14(2):R48. doi: 10.1186/ar3761.
56.
Expression of fractalkine and its receptor, CX3CR1, in response to ischaemia-reperfusion brain injury in the rat.
Tarozzo G, etal., Eur J Neurosci. 2002 May;15(10):1663-8.
57.
Fractalkine (CX3CL1) and fractalkine receptor (CX3CR1) distribution in spinal cord and dorsal root ganglia under basal and neuropathic pain conditions.
Verge GM, etal., Eur J Neurosci 2004 Sep;20(5):1150-60.
58.
Expression of CX3CL1 and its receptor, CX3CR1, in the development of periapical lesions.
Wang L, etal., Int Endod J. 2014 Mar;47(3):271-9. doi: 10.1111/iej.12143. Epub 2013 Jul 6.
59.
[Effect of Shenqi Fuzheng injection on fractalkine expression in lung tissue of rats with lipopolysaccharide-induced acute lung injury].
Wang L, etal., Zhongguo Zhong Xi Yi Jie He Za Zhi. 2007 Jan;27(1):55-9.
60.
Gabapentin reduces CX3CL1 signaling and blocks spinal microglial activation in monoarthritic rats.
Yang JL, etal., Mol Brain. 2012 May 30;5:18. doi: 10.1186/1756-6606-5-18.
61.
The roles of fractalkine/CX3CR1 system in neuronal death following pilocarpine-induced status epilepticus.
Yeo SI, etal., J Neuroimmunol. 2011 May;234(1-2):93-102. doi: 10.1016/j.jneuroim.2011.03.005. Epub 2011 Apr 8.
62.
Expression of immunological molecules by cardiomyocytes and inflammatory and interstitial cells in rat autoimmune myocarditis.
Yoshida T, etal., Cardiovasc Res. 2005 Nov 1;68(2):278-88. Epub 2005 Jul 12.
63.
Expression of fractalkine and fractalkine receptor in urinary bladder after cyclophosphamide (CYP)-induced cystitis.
Yuridullah R, etal., Auton Neurosci. 2006 Jun 30;126-127:380-9. Epub 2006 May 2.
64.
The role of CX(3)CL1/CX(3)CR1 in pulmonary angiogenesis and intravascular monocyte accumulation in rat experimental hepatopulmonary syndrome.
Zhang J, etal., J Hepatol. 2012 Oct;57(4):752-8. doi: 10.1016/j.jhep.2012.05.014. Epub 2012 May 29.
65.
[The change of fractalkine in lung tissue of rat with hypoxic pulmonary hypertension].
Zheng BX, etal., Sichuan Da Xue Xue Bao Yi Xue Ban. 2008 Mar;39(2):227-30.
66.
Fractalkine and CX3CR1 are involved in the migration of intravenously grafted human bone marrow stromal cells toward ischemic brain lesion in rats.
Zhu J, etal., Brain Res. 2009 Sep 1;1287:173-83. Epub 2009 Jun 27.
67.
Fractalkine modulates TNF-alpha secretion and neurotoxicity induced by microglial activation.
Zujovic V, etal., Glia. 2000 Feb 15;29(4):305-15.
Cx3cl1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 19 10,233,326 - 10,244,856 (-) NCBI GRCr8 mRatBN7.2 19 10,227,337 - 10,237,826 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 19 10,227,340 - 10,236,833 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 19 10,190,578 - 10,200,058 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 19 10,957,425 - 10,966,906 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 19 10,244,371 - 10,253,854 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 19 10,644,267 - 10,654,861 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 19 10,644,244 - 10,653,800 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 19 10,638,466 - 10,647,951 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 19 10,666,940 - 10,676,424 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 19 10,671,765 - 10,681,250 (-) NCBI Celera 19 10,113,300 - 10,122,786 (-) NCBI Celera Cytogenetic Map 19 p13 NCBI
CX3CL1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 16 57,372,490 - 57,385,044 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 16 57,372,477 - 57,385,044 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 16 57,406,402 - 57,418,956 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 16 55,963,915 - 55,976,457 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 16 55,963,914 - 55,976,455 NCBI Celera 16 41,906,410 - 41,918,956 (+) NCBI Celera Cytogenetic Map 16 q21 NCBI HuRef 16 43,274,294 - 43,286,836 (+) NCBI HuRef CHM1_1 16 58,814,629 - 58,827,168 (+) NCBI CHM1_1 T2T-CHM13v2.0 16 63,167,607 - 63,180,165 (+) NCBI T2T-CHM13v2.0
Cx3cl1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 95,498,808 - 95,509,055 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 95,498,637 - 95,509,055 (+) Ensembl GRCm39 Ensembl GRCm38 8 94,772,180 - 94,782,427 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 94,772,009 - 94,782,427 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 97,296,080 - 97,306,327 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 97,661,355 - 97,671,556 (+) NCBI MGSCv36 mm8 Celera 8 99,100,414 - 99,110,655 (+) NCBI Celera Cytogenetic Map 8 C5 NCBI cM Map 8 46.79 NCBI
Cx3cl1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955433 15,023,050 - 15,034,711 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955433 15,023,272 - 15,034,650 (+) NCBI ChiLan1.0 ChiLan1.0
CX3CL1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 18 66,840,670 - 66,853,297 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 16 72,761,444 - 72,774,073 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 16 37,646,447 - 37,659,078 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 16 56,779,065 - 56,791,760 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 16 56,779,065 - 56,791,760 (+) Ensembl panpan1.1 panPan2
CX3CL1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 2 59,022,794 - 59,032,095 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 2 59,022,794 - 59,032,095 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 2 55,652,232 - 55,661,533 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 2 59,561,127 - 59,570,437 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 2 59,559,167 - 59,570,279 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 2 56,392,704 - 56,402,005 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 2 57,400,382 - 57,409,687 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 2 58,293,678 - 58,302,979 (-) NCBI UU_Cfam_GSD_1.0
Cx3cl1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409349 50,134,360 - 50,145,250 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936475 9,443,733 - 9,455,062 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936475 9,443,851 - 9,454,715 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
CX3CL1
LOC103233058 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 5 43,310,711 - 43,323,533 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 5 43,310,753 - 43,323,529 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666047 32,993,345 - 33,006,077 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Cx3cl1
.
Predicted Target Of
Count of predictions: 330 Count of miRNA genes: 195 Interacting mature miRNAs: 250 Transcripts: ENSRNOT00000022128 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1549847 Bss8 Bone structure and strength QTL 8 4 lumbar vertebra strength trait (VT:0010574) vertebra ultimate force (CMO:0001678) 19 1 31963836 Rat 8552935 Pigfal10 Plasma insulin-like growth factor 1 level QTL 10 5.7 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 19 1 36824771 Rat 61447 Tcas1 Tongue tumor susceptibility QTL 1 6.08 tongue integrity trait (VT:0010553) squamous cell carcinoma of the tongue maximum tumor diameter (CMO:0001875) 19 2316121 47316121 Rat 631681 Cm12 Cardiac mass QTL 12 3.33 0.00053 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 19 1 28982497 Rat 9590298 Uminl5 Urine mineral level QTL 5 3.59 0.001 urine mineral amount (VT:0015086) urine electrolyte level (CMO:0000593) 19 1 36824771 Rat 10054132 Srcrt9 Stress Responsive Cort QTL 9 2.87 0.0017 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 19 1 27355345 Rat 1331737 Uae29 Urinary albumin excretion QTL 29 5.5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 19 4096155 55283277 Rat 724518 Uae19 Urinary albumin excretion QTL 19 5.5 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 19 7457249 42983518 Rat 8694186 Bw152 Body weight QTL 152 3.34 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 19 569374 45569374 Rat 7411590 Foco7 Food consumption QTL 7 6.8 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 19 1 24688055 Rat 631678 Cm9 Cardiac mass QTL 9 4.27 0.0001 aorta mass (VT:0002845) aorta weight (CMO:0000076) 19 1 28982497 Rat 9590250 Scort11 Serum corticosterone level QTL 11 23.45 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 19 1 36824771 Rat 9590090 Insglur8 Insulin/glucose ratio QTL 8 10.81 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 19 1 36824771 Rat 2317848 Alcrsp21 Alcohol response QTL 21 1.899999976158142 0.05 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 19 3204777 48204777 Rat 9589102 Slep13 Serum leptin concentration QTL 13 4.63 0.001 blood leptin amount (VT:0005667) plasma leptin level (CMO:0000781) 19 569374 45569374 Rat 7247442 Uae39 Urinary albumin excretion QTL 39 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 19 2187927 46708701 Rat 724566 Uae12 Urinary albumin excretion QTL 12 5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 19 2187927 56457239 Rat 724565 Tcas5 Tongue tumor susceptibility QTL 5 10.04 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 19 9977753 39654489 Rat
U92565
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 19 10,227,908 - 10,228,061 (+) MAPPER mRatBN7.2 Rnor_6.0 19 10,644,839 - 10,644,991 NCBI Rnor6.0 Rnor_5.0 19 10,639,030 - 10,639,182 UniSTS Rnor5.0 RGSC_v3.4 19 10,667,504 - 10,667,656 UniSTS RGSC3.4 Celera 19 10,113,864 - 10,114,016 UniSTS Cytogenetic Map 19 p12 UniSTS
BF390094
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 19 10,235,251 - 10,235,409 (+) MAPPER mRatBN7.2 Rnor_6.0 19 10,652,182 - 10,652,339 NCBI Rnor6.0 Rnor_5.0 19 10,646,373 - 10,646,530 UniSTS Rnor5.0 RGSC_v3.4 19 10,674,845 - 10,675,002 UniSTS RGSC3.4 Celera 19 10,121,207 - 10,121,364 UniSTS RH 3.4 Map 19 97.1 UniSTS Cytogenetic Map 19 p12 UniSTS
PMC86945P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 19 10,229,962 - 10,230,173 (+) MAPPER mRatBN7.2 Rnor_6.0 19 10,646,893 - 10,647,103 NCBI Rnor6.0 Rnor_5.0 19 10,641,084 - 10,641,294 UniSTS Rnor5.0 RGSC_v3.4 19 10,669,558 - 10,669,768 UniSTS RGSC3.4 Celera 19 10,115,918 - 10,116,128 UniSTS Cytogenetic Map 19 p12 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000022128 ⟹ ENSRNOP00000022128
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 19 10,227,340 - 10,236,833 (-) Ensembl Rnor_6.0 Ensembl 19 10,644,244 - 10,653,800 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000112965 ⟹ ENSRNOP00000077452
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 19 10,227,340 - 10,232,896 (-) Ensembl
RefSeq Acc Id:
NM_134455 ⟹ NP_604450
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 10,233,334 - 10,242,820 (-) NCBI mRatBN7.2 19 10,227,345 - 10,236,832 (-) NCBI Rnor_6.0 19 10,644,275 - 10,653,761 (-) NCBI Rnor_5.0 19 10,638,466 - 10,647,951 (-) NCBI RGSC_v3.4 19 10,666,940 - 10,676,424 (-) RGD Celera 19 10,113,300 - 10,122,786 (-) RGD
Sequence:
TGCACTCCAGCCATCCAGCCATGGCTCCCTCACAGCTCGCGTGGCTGCTGCGCCTGGCCGCGTTCTTTCATCTGTGTACTCTGCTGGCGGGTCAGCACCTCGGCATGACGAAATGCAACATCACGTGC
hide sequence
RefSeq Acc Id:
XM_008772329 ⟹ XP_008770551
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 10,233,326 - 10,244,856 (-) NCBI mRatBN7.2 19 10,227,337 - 10,237,826 (-) NCBI Rnor_6.0 19 10,644,267 - 10,654,861 (-) NCBI
Sequence:
CCATAGCCCGGGACACTTTTCTTCACAAACTGGTTTTTCCCTCTGGCTGGCAGCCCAAAAAAGAATAGCGCAATTCACTCCCAGCCTGAGACTGGGAAGGCTCTAGTCGACTCCTCTAGACTCCCAGG
hide sequence
RefSeq Acc Id:
NP_604450 ⟸ NM_134455
- Peptide Label:
precursor
- UniProtKB:
O55145 (UniProtKB/Swiss-Prot), Q6IRF7 (UniProtKB/TrEMBL), A6JY48 (UniProtKB/TrEMBL), F7EX30 (UniProtKB/TrEMBL)
- Sequence:
MAPSQLAWLLRLAAFFHLCTLLAGQHLGMTKCNITCHKMTSPIPVTLLIHYQLNQESCGKRAIILETRQHRHFCADPKEKWVQDAMKHLDHQTAALTRNGGKFEKRVDNVTPRITSATRGLSPTALAK
hide sequence
RefSeq Acc Id:
XP_008770551 ⟸ XM_008772329
- Peptide Label:
isoform X1
- UniProtKB:
O55145 (UniProtKB/Swiss-Prot), Q6IRF7 (UniProtKB/TrEMBL), A6JY48 (UniProtKB/TrEMBL), F7EX30 (UniProtKB/TrEMBL)
- Sequence:
MAPSQLAWLLRLAAFFHLCTLLAGQHLGMTKCNITCHKMTSPIPVTLLIHYQLNQESCGKRAII
hide sequence
Ensembl Acc Id:
ENSRNOP00000022128 ⟸ ENSRNOT00000022128
Ensembl Acc Id:
ENSRNOP00000077452 ⟸ ENSRNOT00000112965
RGD ID: 13700942 Promoter ID: EPDNEW_R11466 Type: single initiation site Name: Cx3cl1_1 Description: C-X3-C motif chemokine ligand 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 19 10,653,810 - 10,653,870 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-03-08
Cx3cl1
C-X3-C motif chemokine ligand 1
Cx3cl1
chemokine (C-X3-C motif) ligand 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2004-02-26
Cx3cl1
chemokine (C-X3-C motif) ligand 1
Symbol and Name status set to approved
625702 APPROVED
2003-03-04
Cx3cl1
chemokine (C-X3-C motif) ligand 1
Scyd1
small inducible cytokine subfamily D, 1
Symbol and Name updated to reflect Human and Mouse nomenclature
61478 PROVISIONAL
2002-08-07
Scyd1
small inducible cytokine subfamily D, 1
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_domains
contains a Cys-X-X-X-Cys motif
728291
