Mmp9 (matrix metallopeptidase 9) - Rat Genome Database

Name: Mmp9
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Gene: Mmp9 (matrix metallopeptidase 9) Rattus norvegicus

Analyze

Symbol:

Mmp9

Name:

matrix metallopeptidase 9

RGD ID:

621320

Description:

Enables fibronectin binding activity and metallopeptidase activity. Involved in several processes, including cellular response to cell-matrix adhesion; cellular response to cytokine stimulus; and cellular response to iron(III) ion. Located in extracellular space. Part of protein-containing complex. Used to study artery disease (multiple); brain ischemia (multiple); congestive heart failure; glomerulosclerosis; and lung disease (multiple). Biomarker of several diseases, including artery disease (multiple); brain disease (multiple); chronic obstructive pulmonary disease (multiple); glucose metabolism disease (multiple); and kidney disease (multiple). Human ortholog(s) of this gene implicated in several diseases, including Down syndrome; anodontia; artery disease (multiple); autoimmune disease (multiple); and chronic obstructive pulmonary disease (multiple). Orthologous to human MMP9 (matrix metallopeptidase 9); PARTICIPATES IN fibroblast growth factor signaling pathway; syndecan signaling pathway; urinary bladder cancer pathway; INTERACTS WITH (+)-Tetrandrine; (R)-carnitine; (R)-noradrenaline.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

92 kDa gelatinase; 92 kDa type IV collagenase; 92-kDa type IV collagenase; gelatinase B; GELB; matrix metalloproteinase 9 (gelatinase B 92-kDa type IV collagenase); matrix metalloproteinase 9 (gelatinase B, 92-kDa type IV collagenase); matrix metalloproteinase-9; MMP-9

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	MMP9 (matrix metallopeptidase 9)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Mmp9 (matrix metallopeptidase 9)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Mmp9 (matrix metallopeptidase 9)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	MMP9 (matrix metallopeptidase 9)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	MMP9 (matrix metallopeptidase 9)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Mmp9 (matrix metallopeptidase 9)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	MMP9 (matrix metallopeptidase 9)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	MMP9 (matrix metallopeptidase 9)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Mmp9 (matrix metallopeptidase 9)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Mmp9 (matrix metallopeptidase 9)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	MMP9 (matrix metallopeptidase 9)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	mmp9 (matrix metallopeptidase 9)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	zmp-2	Alliance	DIOPT (InParanoid\|PANTHER)
Caenorhabditis elegans (roundworm):	zmp-4	Alliance	DIOPT (Ensembl Compara\|PANTHER)
Caenorhabditis elegans (roundworm):	Y50D7A.13	Alliance	DIOPT (Ensembl Compara\|PANTHER)
Caenorhabditis elegans (roundworm):	W01F3.2	Alliance	DIOPT (Ensembl Compara\|PANTHER)
Caenorhabditis elegans (roundworm):	K03B8.6	Alliance	DIOPT (Ensembl Compara\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	mmp9.1	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Allele / Splice:

Mmp9^em6Mcwi Mmp9^em4Mcwi

Genetic Models:

SS-Mmp9^em4Mcwi SS-Mmp9^em6Mcwi

Candidate Gene For:

Eau4

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	174,103,474 - 174,111,434 (+)	NCBI		GRCr8
mRatBN7.2	3	153,684,158 - 153,692,118 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	153,683,858 - 153,692,120 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	157,492,813 - 157,500,796 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	165,991,783 - 165,999,766 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	163,735,564 - 163,743,543 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	161,413,410 - 161,421,473 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	161,413,298 - 161,421,520 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	167,578,904 - 167,605,890 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	155,985,473 - 155,993,433 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	155,891,508 - 155,899,467 (+)	NCBI
Celera	3	152,289,466 - 152,297,426 (+)	NCBI		Celera
Cytogenetic Map	3	q42	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

abdominal aortic aneurysm (IDA,ISO)

Acute Coronary Syndrome (ISO)

Acute Lung Injury (IEP)

Acute Otitis Media (ISO)

adrenoleukodystrophy (ISO)

adult respiratory distress syndrome (ISO)

Albuminuria (ISO)

alcohol use disorder (IEP)

Alcoholic Liver Diseases (IEP)

allergic contact dermatitis (IEP,ISO)

Alveolar Bone Loss (IEP)

Alzheimer's disease (ISO)

amyotrophic lateral sclerosis (ISO)

angle-closure glaucoma (ISO)

Animal Disease Models (ISO)

Animal Mammary Neoplasms (ISO)

anodontia (ISO)

Anti-Neutrophil Cytoplasmic Antibody-Associated Vasculitis (ISO)

aortic aneurysm (ISO)

aortic disease (ISO)

aortic dissection (ISO)

Aortic Rupture (ISO)

Arterial Injury (IDA)

arteriosclerosis (IDA,ISO)

Arteriovenous Fistula (IEP,ISO)

arteriovenous malformation (ISO)

asthma (IEP,ISO)

atopic dermatitis (ISO)

atrial fibrillation (ISO)

attention deficit hyperactivity disorder (ISO)

autism spectrum disorder (ISO)

autoimmune lymphoproliferative syndrome (ISO)

autosomal dominant polycystic kidney disease (ISO)

bacterial meningitis (ISO)

bacterial pneumonia (ISO)

Behcet's disease (ISO)

Bone Neoplasms (ISO)

brain edema (IEP,ISO)

brain infarction (ISO)

Brain Injuries (IDA,IMP,ISO)

brain ischemia (IDA,ISO)

Breast Neoplasms (ISO)

Bronchial Hyperreactivity (ISO)

bronchiectasis (ISO)

bronchiolitis obliterans (ISO)

bronchopulmonary dysplasia (ISO)

bullous pemphigoid (ISO)

Burns (IEP)

CAKUT2 (ISO)

calcinosis (ISO)

Cardiac Fibrosis (IEP,ISO)

Cardiomegaly (IEP)

cardiomyopathy (ISO)

carotid artery disease (ISO)

Carotid Artery Injuries (IEP)

Carotid Atherosclerosis (ISO)

Cerebral Hemorrhage (ISO)

cerebral infarction (ISO)

Chemical and Drug Induced Liver Injury (ISO)

childhood absence epilepsy (IEP)

cholangiocarcinoma (IEP,ISO)

cholesteatoma (ISO)

cholesteatoma of middle ear (ISO)

chorioamnionitis (ISO)

Choroidal Neovascularization (IDA,ISO)

chronic inflammatory demyelinating polyradiculoneuropathy (ISO)

chronic obstructive pulmonary disease (IEP,ISO)

Chronic Periodontitis (IDA)

chronic ulcer of skin (ISO)

Cicatrix (IDA)

cognitive disorder (IEP)

colon adenocarcinoma (ISO)

Colonic Neoplasms (IDA,IEP,ISO)

colorectal cancer (ISO)

Colorectal Neoplasms (IEP)

congestive heart failure (IDA,IEP,ISO)

conjunctivochalasis (ISO)

coronary artery disease (IEP,ISO)

crescentic glomerulonephritis (IEP)

cystic fibrosis (ISO)

dermatomyositis (ISO)

Diabetic Foot (ISO)

Diabetic Nephropathies (IEP,ISO)

diabetic neuropathy (ISO)

diabetic retinopathy (ISO)

Disease Progression (ISO)

Down syndrome (ISO)

Duchenne muscular dystrophy (ISO)

ductal carcinoma in situ (ISO)

Embolism (ISO)

Emphysema (IEP)

endometrial carcinoma (ISO)

endometriosis (IEP)

epidermolysis bullosa simplex (ISO)

epilepsy (ISO)

esophagus adenocarcinoma (ISO)

esophagus squamous cell carcinoma (ISO)

exfoliation syndrome (ISO)

Experimental Arthritis (IEP)

Experimental Autoimmune Encephalomyelitis (IEP,ISO)

Experimental Autoimmune Neuritis (IEP)

Experimental Colitis (IEP)

Experimental Diabetes Mellitus (IEP,ISO)

Experimental Liver Cirrhosis (ISO)

Experimental Liver Neoplasms (IEP)

Experimental Mammary Neoplasms (IEP,ISO)

extrahepatic cholestasis (ISO)

facial paralysis (ISO)

familial hyperlipidemia (ISO)

Febrile Seizures (ISO)

Fibrosis (IEP)

Focal Cortical Dysplasia of Taylor (ISO)

focal epilepsy (IEP,ISO)

focal segmental glomerulosclerosis (IEP)

fragile X syndrome (ISO)

gastric ulcer (IEP,ISO)

genetic disease (ISO)

glaucoma (ISO)

glioblastoma (ISO)

glomerulosclerosis (IDA,IEP)

Gouty Arthritis (ISO)

heart valve disease (ISO)

Hemorrhagic Shock (IEP)

hepatic veno-occlusive disease (IEP)

hepatocellular carcinoma (ISO)

Herpes Simplex Encephalitis (ISO)

Human Influenza (ISO)

Huntington's disease (IEP)

hyperglycemia (IEP)

hyperhomocysteinemia (ISO)

Hyperlipoproteinemia Type II (ISO)

Hyperoxia (IEP,ISO)

Hyperoxic Lung Injury (ISO)

Hyperplasia (ISO)

hypertension (IEP,ISO)

hypertrophic cardiomyopathy (ISO)

ileus (IEP)

Inflammation (ISO)

interstitial lung disease (ISO)

intracranial aneurysm (IDA,IEP,ISO)

ischemia (ISO)

Kawasaki disease (ISO)

kidney disease (IEP)

Laryngeal Neoplasms (ISO)

Lead Poisoning (ISO)

liver disease (ISO)

Liver Injury (IEP)

Liver Reperfusion Injury (IEP)

lung disease (IMP,ISO)

Lung Neoplasms (ISO)

lung non-small cell carcinoma (ISO)

Lung Reperfusion Injury (IEP)

lupus nephritis (ISO)

lymphangioleiomyomatosis (ISO)

Lymphatic Metastasis (ISO)

macular degeneration (ISO)

malignant astrocytoma (ISO)

Malignant Pleural Effusions (ISO)

mandibuloacral dysplasia type A lipodystrophy (ISO)

Marfan syndrome (ISO)

membranous glomerulonephritis (IEP)

meningococcal meningitis (IEP)

Metaphyseal Anadysplasia (ISO)

Metaphyseal Anadysplasia 2 (ISO)

middle cerebral artery infarction (IEP,ISO)

morphine dependence (ISO)

Multiple Organ Failure (IEP,ISO)

multiple sclerosis (ISO)

Mycoplasma Infections (IEP)

myocardial infarction (IDA,IEP,ISO)

myocarditis (ISO)

Nasal Polyps (ISO)

Neointima (IEP,ISO)

Neoplasm Invasiveness (ISO)

Neoplasm Metastasis (IEP,IMP,ISO)

Neoplastic Cell Transformation (ISO)

Nephrogenic Fibrosing Dermopathy (ISO)

neuroblastoma (ISO)

neuromyelitis optica (ISO)

obesity (ISO)

obstructive sleep apnea (ISO)

ocular hypertension (IEP)

oral submucous fibrosis (ISO)

osteoarthritis (ISO)

osteoporosis (ISO)

pancreatic cancer (ISO)

pancreatic ductal carcinoma (ISO)

paracoccidioidomycosis (ISO)

Parkinsonism (ISO)

Pathologic Constriction (ISO)

Perennial Allergic Rhinitis (ISO)

periodontitis (ISO)

pleural tuberculosis (ISO)

Pneumococcal Meningitis (IEP,IMP)

pneumonia (ISO)

polymyositis (ISO)

Polypoidal Choroidal Vasculopathy (ISO)

pre-eclampsia (ISO)

Premature Birth (ISO)

primary biliary cholangitis (IEP)

primary open angle glaucoma (ISO)

primary progressive multiple sclerosis (ISO)

Prostatic Neoplasms (ISO)

Pseudomonas Aeruginosa Keratitis (ISO)

pterygium (ISO)

pulmonary embolism (IDA)

pulmonary emphysema (IEP,ISO)

pulmonary fibrosis (IEP,ISO)

pulmonary hypertension (IDA,IEP,ISO)

pulmonary tuberculosis (ISO)

pyoderma gangrenosum (ISO)

relapsing-remitting multiple sclerosis (ISO)

renal cell carcinoma (ISO)

renal fibrosis (IEP)

renal hypertension (IDA)

Reperfusion Injury (IMP,ISO)

Respiratory Sounds (ISO)

respiratory syncytial virus infectious disease (ISO)

Respirovirus Infections (IEP)

retinal disease (ISO)

retinal ischemia (IEP)

rheumatic heart disease (ISO)

rheumatoid arthritis (ISO)

Rhinosinusitis (ISO)

Right Ventricular Hypertrophy (IEP)

rosacea (ISO)

sciatic neuropathy (IEP)

Seasonal Allergic Rhinitis (ISO)

Sepsis (IMP,ISO)

sinusitis (ISO)

Sjogren's syndrome (ISO)

skin melanoma (ISO)

Skin Neoplasms (ISO)

Spinal Cord Injuries (IEP)

squamous cell carcinoma (ISO)

Stable Angina (ISO)

status epilepticus (IEP)

stomach cancer (ISO)

stomach carcinoma (IEP)

Stroke (IEP,ISO)

Sturge-Weber syndrome (ISO)

Subarachnoid Hemorrhage (IEP,ISO)

Sunburn (ISO)

Sweet syndrome (ISO)

systemic scleroderma (ISO)

T-Cell Immunodeficiency, Recurrent Infections, and Autoimmunity with or without Cardiac Malformations (ISO)

Tachycardia, Atrioventricular Nodal Reentry (ISO)

Takayasu's arteritis (ISO)

temporal arteritis (ISO)

temporal lobe epilepsy (ISO)

thoracic aortic aneurysm (IEP,ISO)

thrombosis (ISO)

tongue squamous cell carcinoma (ISO)

transient cerebral ischemia (IDA,IEP,ISO)

traumatic brain injury (ISO)

tuberous sclerosis (ISO)

tularemia (ISO)

type 1 diabetes mellitus (ISO)

type 2 diabetes mellitus (IEP,ISO)

ulcerative colitis (ISO)

urinary bladder cancer (ISO)

varicose veins (ISO)

Venous Thrombosis (HEP,ISO)

Ventilator-Induced Lung Injury (ISO)

ventricular septal defect (ISO)

viral encephalitis (ISO)

withdrawal disorder (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-pilocarpine (ISO)

(+)-Pimaric acid (ISO)

(+)-Tetrandrine (EXP,ISO)

(-)-epigallocatechin 3-gallate (ISO)

(24S)-24-hydroxycholesterol (ISO)

(25R)-cholest-5-ene-3beta,26-diol (ISO)

(R)-carnitine (EXP)

(R)-noradrenaline (EXP,ISO)

(S)-colchicine (ISO)

(S)-naringenin (ISO)

(S)-nicotine (ISO)

1'-acetoxychavicol acetate (ISO)

1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (ISO)

1,1-bis(2-aminoethyl)-2-hydroxy-3-oxotriazane (EXP)

1,10-phenanthroline (EXP,ISO)

1,2,3-Trichloropropane (ISO)

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (EXP)

1,3-benzothiazole-2-thiol (ISO)

1-[(2,3,4-trimethoxyphenyl)methyl]piperazine (ISO)

1-hydroxy-1-norresistomycin (ISO)

1-naphthyl isothiocyanate (ISO)

1-octadec-9-enoylglycero-3-phosphate (ISO)

15-deoxy-Delta(12,14)-prostaglandin J2 (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP,ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,2'-bipyridine (ISO)

2,2,2-trichloroethanol (ISO)

2,3,3',4,4',5,5'-Heptachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,6-trinitrobenzenesulfonic acid (EXP)

2,4-diaminotoluene (ISO)

2-acetamidofluorene (EXP)

2-amino-2-deoxy-D-glucopyranose (EXP,ISO)

2-Amino-5-nitrophenol (ISO)

2-deoxy-D-glucose (ISO)

2-Hydroxy-6-(8,11,14-pentadecatrienyl)benzoic acid (ISO)

2-hydroxypropanoic acid (ISO)

2-methoxy-1,4-naphthoquinone (ISO)

2-palmitoylglycerol (ISO)

2-trans,6-trans,10-trans-geranylgeranyl diphosphate (EXP,ISO)

2-trans,6-trans-farnesyl diphosphate (EXP)

26-hydroxycholesterol (ISO)

3,3',4,4',5-pentachlorobiphenyl (ISO)

3,3',5,5'-tetrabromobisphenol A (ISO)

3,3',5,5'-tetraiodothyroacetic acid (ISO)

3,3'-diindolylmethane (ISO)

3-[3-(tert-butylsulfanyl)-1-(4-chlorobenzyl)-5-(propan-2-yl)-1H-indol-2-yl]-2,2-dimethylpropanoic acid (ISO)

3-\{1-[3-(dimethylamino)propyl]-1H-indol-3-yl\}-4-(1H-indol-3-yl)-1H-pyrrole-2,5-dione (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

3-methyladenine (ISO)

3-methylcholanthrene (ISO)

4,4'-sulfonyldiphenol (ISO)

4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one (ISO)

4-Aminobenzamide (ISO)

4-hydroxy-17beta-estradiol (ISO)

4-hydroxy-TEMPO (EXP)

4-hydroxyhexenal (ISO)

4-hydroxynon-2-enal (ISO)

4-hydroxyphenyl retinamide (ISO)

4-nitroquinoline N-oxide (ISO)

5,6alpha-epoxy-5alpha-cholestan-3beta-ol (EXP)

5-aza-2'-deoxycytidine (ISO)

5-azacytidine (ISO)

5-chloro-7-iodoquinolin-8-ol (ISO)

5-fluorouracil (ISO)

6-chloro-2,3,4,9-tetrahydro-1H-carbazole-1-carboxamide (ISO)

6-propyl-2-thiouracil (EXP)

7,12-dimethyltetraphene (EXP,ISO)

7,9-dihydro-1H-purine-2,6,8(3H)-trione (ISO)

7-ketocholesterol (EXP,ISO)

7-NITROINDAZOLE (ISO)

7alpha-hydroxycholesterol (ISO)

[6]-Shogaol (ISO)

abacavir (ISO)

acetaldehyde (ISO)

acetic acid (EXP)

acetylcholine (ISO)

acetylsalicylic acid (EXP,ISO)

acrolein (ISO)

acrylamide (ISO)

actinomycin D (ISO)

aflatoxin B1 (ISO)

agomelatine (EXP)

AH23848 (ISO)

AICA ribonucleotide (ISO)

alachlor (EXP)

aldehydo-D-glucosamine (EXP,ISO)

aldehydo-D-glucose (EXP,ISO)

all-trans-retinoic acid (EXP,ISO)

all-trans-retinyl palmitate (EXP)

allethrin (ISO)

allopurinol (ISO)

alloxanthine (ISO)

allyl isothiocyanate (ISO)

alpha-D-galactose (EXP)

alpha-mangostin (ISO)

alpha-naphthoflavone (EXP,ISO)

alternariol (ISO)

Altertoxin II (ISO)

aluminium atom (EXP,ISO)

aluminium oxide (ISO)

aluminium(0) (EXP,ISO)

aminoguanidine (EXP)

amitrole (ISO)

ammonium chloride (EXP)

anagliptin (ISO)

anandamide (ISO)

andrographolide (ISO)

anethole (ISO)

anthocyanin (ISO)

anthra[1,9-cd]pyrazol-6(2H)-one (EXP,ISO)

antirheumatic drug (ISO)

antroquinonol (ISO)

apigenin (ISO)

apocynin (EXP,ISO)

arachidonic acid (ISO)

arecoline (EXP)

aristolochic acid A (ISO)

aristolochic acids (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

artesunate (EXP,ISO)

astragaloside IV (EXP)

atorvastatin calcium (EXP,ISO)

ATP (EXP,ISO)

atrazine (ISO)

azetidine (ISO)

Bacoside a (EXP)

baicalein (ISO)

BAPTA (ISO)

beclomethasone (ISO)

benazepril (EXP,ISO)

benomyl (EXP,ISO)

benzalkonium chloride (EXP,ISO)

benzamide (ISO)

benzene (ISO)

benzo[a]pyrene (EXP,ISO)

benzofurans (ISO)

benzyl acetate (ISO)

berberine (ISO)

Bergenin (ISO)

beta-aminopropionitrile (EXP)

beta-D-glucosamine (EXP,ISO)

beta-hexachlorocyclohexane (ISO)

beta-naphthoflavone (ISO)

betulinic acid (ISO)

biochanin A (ISO)

biphenyl-2-ol (ISO)

bis(2-chloroethyl) sulfide (EXP,ISO)

bis(2-ethylhexyl) phthalate (EXP,ISO)

bisdemethoxycurcumin (ISO)

bisphenol A (EXP,ISO)

Bisphenol A diglycidyl ether (EXP)

bisphenol F (ISO)

bitertanol (ISO)

bleomycin A2 (EXP,ISO)

bortezomib (ISO)

BQ 123 (ISO)

budesonide (EXP)

bufalin (ISO)

buta-1,3-diene (ISO)

butanal (ISO)

butane-2,3-dione (ISO)

butein (ISO)

Butylbenzyl phthalate (ISO)

C.I. Natural Red 20 (ISO)

cadmium atom (EXP,ISO)

cadmium dichloride (EXP,ISO)

calcitriol (ISO)

calcium dichloride (EXP,ISO)

camptothecin (ISO)

candesartan (EXP)

cannabidiol (ISO)

cantharidin (ISO)

capillarisin (ISO)

capsaicin (ISO)

captopril (ISO)

carbamazepine (ISO)

carbendazim (ISO)

carbon atom (ISO)

carbon monoxide (ISO)

carbon nanotube (ISO)

carrageenan (EXP)

carvedilol (EXP,ISO)

carvone (ISO)

casticin (ISO)

CEDRELONE (ISO)

celastrol (EXP)

celecoxib (EXP,ISO)

ceric oxide (ISO)

CGS-21680 (ISO)

chalcones (ISO)

chelerythrine (ISO)

chitin (ISO)

chitosan (ISO)

chloroprene (ISO)

chloroquine (ISO)

chlorothalonil (ISO)

chlorpromazine (ISO)

choline (ISO)

chromium(6+) (ISO)

chrysin (ISO)

Cinnamyl anthranilate (ISO)

ciprofloxacin (EXP)

Cirsimarin (ISO)

cisplatin (EXP,ISO)

clarithromycin (EXP)

clofibrate (ISO)

clopidogrel (EXP)

cobalt atom (ISO)

cocaine (EXP,ISO)

coenzyme Q10 (EXP)

cordycepin (ISO)

cortisol (ISO)

coumarin (ISO)

crocidolite asbestos (ISO)

crotonaldehyde (ISO)

Cuprizon (EXP)

curcumin (EXP,ISO)

cycloprothrin (ISO)

cyclosporin A (ISO)

cyhalothrin (ISO)

cypermethrin (ISO)

cysteamine (ISO)

cytochalasin D (ISO)

D-glucose (EXP,ISO)

daidzein (EXP)

dapsone (ISO)

deguelin (ISO)

delphinidin (ISO)

demethoxycurcumin (ISO)

Deoxyschizandrin (ISO)

desferrioxamine B (ISO)

Destruxin B (ISO)

dexamethasone (EXP,ISO)

dextran sulfate (ISO)

diallyl disulfide (ISO)

Diallyl sulfide (EXP,ISO)

diallyl trisulfide (ISO)

diarsenic trioxide (ISO)

dibenziodolium (EXP,ISO)

dibutyl phthalate (EXP,ISO)

dichlorine (ISO)

dichloromethane (ISO)

dicoumarol (ISO)

Dictamnine (ISO)

dieckol (ISO)

dieldrin (EXP)

diepoxybutane (EXP)

diethyl phthalate (ISO)

dihydroartemisinin (ISO)

diisobutyl phthalate (ISO)

diisononyl phthalate (ISO)

dimethyl sulfoxide (EXP,ISO)

dimethylarsinic acid (EXP,ISO)

dimethylarsinous acid (ISO)

diosgenin (EXP,ISO)

dioxygen (EXP,ISO)

disodium selenite (EXP,ISO)

disulfiram (ISO)

divanadium pentaoxide (ISO)

dizocilpine maleate (EXP)

donepezil hydrochloride (ISO)

doxorubicin (EXP,ISO)

doxycycline (EXP,ISO)

EC 3.1.1.4 (phospholipase A2) inhibitor (ISO)

EC 3.4.15.1 (peptidyl-dipeptidase A) inhibitor (ISO)

edaravone (EXP)

elemental carbon (ISO)

elemental selenium (ISO)

ellagic acid (ISO)

embelin (ISO)

emetine (ISO)

endosulfan (EXP,ISO)

entinostat (ISO)

erlotinib hydrochloride (ISO)

ethanol (EXP,ISO)

Ethyl pyruvate (ISO)

ethylparaben (ISO)

etodolac (ISO)

eugenol (EXP,ISO)

everolimus (ISO)

Evodiamine (ISO)

excitatory amino acid agonist (ISO)

famotidine (EXP)

farnesyl diphosphate (EXP)

farrerol (EXP)

fasudil (ISO)

febuxostat (EXP)

fenbendazole (ISO)

fenofibrate (ISO)

fenvalerate (EXP)

Fexofenadine hydrochloride (ISO)

fingolimod hydrochloride (ISO)

fisetin (ISO)

flavonoids (EXP,ISO)

flucythrinate (ISO)

fluoxetine (EXP,ISO)

flurbiprofen (ISO)

flutamide (EXP)

fluvalinate (ISO)

fluvastatin (ISO)

folic acid (EXP,ISO)

formononetin (ISO)

formoterol fumarate (EXP)

fosinopril (EXP)

fructose (ISO)

fucoidan (ISO)

fulvestrant (ISO)

fumigaclavine C (ISO)

gadolinium trichloride (EXP)

galactose (EXP)

galaxolide (ISO)

gallic acid (EXP,ISO)

Garcinol (ISO)

gatifloxacin (EXP)

gefitinib (EXP,ISO)

gemcitabine (ISO)

Genipin (ISO)

genistein (ISO)

geraniol (EXP)

GGTI-2133 (EXP)

gingerol (ISO)

Ginkgoic acid (ISO)

ginsenoside C-K (ISO)

ginsenoside Rg1 (EXP)

glucagon (ISO)

glucose (EXP,ISO)

glutathione (ISO)

glycitein (ISO)

glycyrrhetinate (ISO)

glycyrrhetinic acid (ISO)

Goe 6976 (ISO)

gold atom (ISO)

gold(0) (ISO)

graphene oxide (ISO)

graphite (EXP)

guggulsterone (ISO)

GW 501516 (ISO)

heparin (ISO)

heptachlor (EXP)

hesperidin (EXP,ISO)

hexachlorobenzene (EXP,ISO)

hexadecanoic acid (ISO)

hexanal (ISO)

high-density lipoprotein cholesterol (ISO)

hinokiflavone (ISO)

homocysteine (EXP,ISO)

hyaluronic acid (ISO)

hydrogen peroxide (ISO)

hydrogen sulfide (EXP)

hydroquinone (ISO)

hydroxamic acid (ISO)

hydroxysafflor yellow A (EXP,ISO)

hydroxytyrosol (ISO)

ibuprofen (EXP,ISO)

icariin (EXP)

ICI 118551 (ISO)

idebenone (EXP)

idelalisib (ISO)

ifosfamide (ISO)

imiquimod (ISO)

indinavir (EXP)

indole-3-methanol (ISO)

indometacin (EXP,ISO)

ipratropium (EXP)

irbesartan (EXP)

irigenin (ISO)

irinotecan (ISO)

Isoliensinine (ISO)

isoliquiritigenin (ISO)

isoprenaline (EXP,ISO)

isotretinoin (ISO)

JTE-013 (ISO)

juglone (ISO)

kaempferol (ISO)

kainic acid (ISO)

L-ascorbic acid (ISO)

L-methionine (ISO)

lead diacetate (ISO)

letrozole (ISO)

leukotriene B4 (ISO)

leukotriene C4 (ISO)

leukotriene D4 (ISO)

leuprolide (EXP)

linalool (ISO)

linoleic acid (EXP,ISO)

lipoarabinomannan (ISO)

lipopolysaccharide (EXP,ISO)

liquiritigenin (EXP)

liquiritin (EXP)

lithocholic acid (ISO)

LLY-507 (ISO)

loliolide (ISO)

lomefloxacin (EXP)

lonafarnib (ISO)

losartan (EXP,ISO)

lovastatin (ISO)

luteolin (ISO)

LY294002 (EXP,ISO)

Magnolol (ISO)

manganese(II) chloride (EXP)

mangiferin (ISO)

mechlorethamine (EXP,ISO)

medroxyprogesterone acetate (ISO)

melatonin (EXP,ISO)

melittin (ISO)

menadione (ISO)

mercury atom (ISO)

mercury dichloride (EXP)

mercury(0) (ISO)

metformin (ISO)

methamphetamine (ISO)

Methanandamide (ISO)

methotrexate (EXP,ISO)

methyl caffeate (ISO)

methylglyoxal (ISO)

methylmercury chloride (EXP)

metoprolol (ISO)

mevalonic acid (ISO)

microcystin-LR (EXP,ISO)

mifepristone (EXP,ISO)

minocycline (EXP,ISO)

miquelianin (ISO)

mono(2-ethylhexyl) phthalate (ISO)

monobenzyl phthalate (ISO)

Monobutylphthalate (ISO)

monocrotaline (EXP,ISO)

morin (EXP,ISO)

morphine (ISO)

Morroniside (ISO)

morusin (ISO)

moxifloxacin (EXP,ISO)

myricetin (ISO)

N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine (ISO)

N-[2-(4-bromocinnamylamino)ethyl]isoquinoline-5-sulfonamide (EXP,ISO)

N-[3,5-bis(trifluoromethyl)phenyl]-5-chloro-2-hydroxybenzamide (ISO)

N-acetyl-L-cysteine (EXP,ISO)

N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO)

N-methyl-4-phenylpyridinium (ISO)

N-methyl-N'-nitro-N-nitrosoguanidine (EXP)

N-nitrosodiethylamine (EXP,ISO)

N-nitrosodimethylamine (EXP)

N-tosyl-L-phenylalanyl chloromethyl ketone (ISO)

N1'-[2-[[5-[(dimethylamino)methyl]-2-furanyl]methylthio]ethyl]-N1-methyl-2-nitroethene-1,1-diamine (EXP)

naloxone (ISO)

Nandrolone decanoate (EXP)

naphthalene (ISO)

naringin (EXP,ISO)

Neferine (ISO)

nerolidol (EXP)

nickel atom (ISO)

nickel dichloride (ISO)

nickel sulfate (ISO)

niclosamide (ISO)

nicotinamide (ISO)

nicotine (ISO)

nifedipine (ISO)

nimesulide (ISO)

nitric oxide (ISO)

nitrites (ISO)

nitrobenzenes (EXP)

nitroglycerin (ISO)

nobiletin (EXP)

Nonidet P-40 (ISO)

Nonylphenol (ISO)

NORCANTHARIDIN (ISO)

norfloxacin (EXP)

NS-398 (ISO)

O-(chloroacetylcarbamoyl)fumagillol (ISO)

ochratoxin A (EXP,ISO)

oleanolic acid (ISO)

oleic acid (ISO)

oleuropein (ISO)

Ophiopogonin D (ISO)

oridonin (ISO)

oroxylin A (ISO)

osthole (ISO)

ouabain (ISO)

oxaliplatin (EXP)

oxidopamine (ISO)

oxytocin (EXP)

ozone (ISO)

p-cresol (ISO)

paclitaxel (EXP,ISO)

Paeonol (EXP)

palmatine (ISO)

paracetamol (EXP,ISO)

paraquat (EXP,ISO)

parthenolide (ISO)

pentetrazol (EXP)

perfluorooctane-1-sulfonic acid (EXP,ISO)

perfluorooctanoic acid (EXP,ISO)

perindopril (EXP)

phenanthrolines (EXP)

phenethyl caffeate (EXP,ISO)

phenethyl isothiocyanate (ISO)

phenylarsine oxide (ISO)

phenylephrine (ISO)

PhIP (ISO)

phloretin (EXP)

phorbol 12,13-dibutanoate (ISO)

phorbol 13-acetate 12-myristate (EXP,ISO)

phosgene (EXP)

pioglitazone (ISO)

piperine (ISO)

pipoxolan (ISO)

platycodin D (EXP,ISO)

plumbagin (ISO)

pravastatin (EXP)

prednisolone (EXP)

pregnenolone 16alpha-carbonitrile (ISO)

probucol (ISO)

progesterone (EXP,ISO)

propranolol (ISO)

propylparaben (ISO)

prostaglandin E2 (ISO)

prostaglandin F2alpha (ISO)

protein kinase inhibitor (ISO)

Ptaquiloside (ISO)

pterostilbene (ISO)

pyrrolidine dithiocarbamate (ISO)

quercetin (EXP,ISO)

quercetin 3-O-beta-D-glucofuranoside (ISO)

quercetin 3-O-beta-D-glucopyranoside (ISO)

quinpirole (ISO)

rac-lactic acid (ISO)

raloxifene (EXP,ISO)

ranitidine (EXP)

raspberry ketone (EXP)

razoxane (EXP)

reactive oxygen species (ISO)

rebaudioside A (EXP,ISO)

regorafenib (ISO)

reparixin (ISO)

resveratrol (EXP,ISO)

riboflavin (ISO)

rolipram (ISO)

rosmarinic acid (EXP)

rotenone (ISO)

rottlerin (ISO)

roxarsone (ISO)

ruthenium atom (EXP)

rutin (ISO)

Salinomycin (ISO)

sanguinarine (ISO)

saxagliptin (EXP)

SB 203580 (EXP,ISO)

SB 290157 (ISO)

scoparone (ISO)

selenium atom (ISO)

selumetinib (ISO)

senecionine (ISO)

serpentine asbestos (ISO)

sevoflurane (EXP,ISO)

Shikonin (ISO)

sildenafil citrate (ISO)

silibinin (ISO)

silicon dioxide (EXP,ISO)

simazine (ISO)

simvastatin (EXP,ISO)

sirolimus (EXP,ISO)

sodium arsenite (EXP,ISO)

sodium dichromate (ISO)

sodium fluoride (ISO)

sodium hydroxide (EXP)

sodium silicate (EXP)

solasodine (ISO)

Soman (EXP)

sotorasib (ISO)

sparfloxacin (EXP)

sphingosine 1-phosphate (ISO)

staurosporine (ISO)

steviol (ISO)

stevioside (ISO)

streptozocin (EXP,ISO)

succimer (ISO)

sulfasalazine (EXP,ISO)

sunitinib (EXP)

T-2 toxin (EXP,ISO)

tamoxifen (EXP,ISO)

tanespimycin (ISO)

Tanshinone I (ISO)

taurine (EXP)

taurocholic acid (ISO)

tebuconazole (ISO)

telmisartan (EXP)

temozolomide (ISO)

tephrosin (ISO)

terbinafine (ISO)

tert-butyl hydroperoxide (ISO)

tetracaine (ISO)

tetrachloromethane (EXP,ISO)

tetracyclines (EXP)

tetrahydrocurcumin (ISO)

tetrahydropalmatine (ISO)

tetramethylpyrazine (ISO)

thalidomide (ISO)

Theaflavin 3,3'-digallate (ISO)

thioacetamide (EXP,ISO)

thymol (ISO)

thymol sulfate(1-) (ISO)

thymoquinone (ISO)

thyroxine (ISO)

Tiron (ISO)

titanium atom (ISO)

titanium dioxide (ISO)

tofacitinib (ISO)

toluene 2,4-diisocyanate (ISO)

tomatidine (ISO)

topotecan (EXP)

trametinib (ISO)

trans-anethole (ISO)

trans-cinnamic acid (ISO)

triadimefon (ISO)

tributylstannane (ISO)

tricetin (ISO)

trichloroethene (ISO)

trichostatin A (ISO)

triclosan (ISO)

Triptolide (ISO)

triptonide (ISO)

troglitazone (ISO)

tropisetron (EXP)

tungsten (ISO)

Tungsten carbide (ISO)

tyrphostin AG 1478 (ISO)

ubiquinone-0 (ISO)

urethane (ISO)

ursolic acid (EXP,ISO)

Ursonic acid (ISO)

valproic acid (EXP,ISO)

valsartan (EXP,ISO)

varespladib methyl (ISO)

venlafaxine hydrochloride (EXP)

vitamin D (ISO)

vorinostat (EXP,ISO)

WIN 55212-2 (ISO)

wogonin (EXP,ISO)

wortmannin (EXP,ISO)

xanthohumol (ISO)

Y-27632 (ISO)

zafirlukast (ISO)

zerumbone (ISO)

zidovudine (EXP)

zileuton (EXP)

zinc atom (EXP,ISO)

zinc oxide (EXP,ISO)

zinc protoporphyrin (ISO)

zinc sulfate (ISO)

zinc(0) (EXP,ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

apoptotic process (IEA,ISO)

cell migration (IEA,ISO)

cellular response to cadmium ion (IEA,ISO)

cellular response to cell-matrix adhesion (IEP,IMP)

cellular response to cytokine stimulus (IEP)

cellular response to interleukin-1 (IEP)

cellular response to iron(III) ion (IEP)

cellular response to lipopolysaccharide (IEP)

cellular response to low-density lipoprotein particle stimulus (IEP)

cellular response to reactive oxygen species (IEA,ISO)

cellular response to tumor necrosis factor (IEP)

cellular response to UV-A (IEA,ISO)

collagen catabolic process (IBA,IDA,IEA,ISO)

embryo implantation (IEA,ISO)

endodermal cell differentiation (IEA,ISO)

extracellular matrix organization (IBA,IEA,ISO)

heart development (IDA)

kidney development (IEP)

macrophage chemotaxis (IDA)

modification of synaptic structure, modulating synaptic transmission (EXP,IDA)

negative regulation of apoptotic process (ISO)

negative regulation of epithelial cell differentiation involved in kidney development (IEA,ISO)

negative regulation of fibroblast proliferation (IMP)

negative regulation of intrinsic apoptotic signaling pathway (IEA,ISO)

ossification (IEP)

parturition (IEP)

positive regulation of angiogenesis (IMP)

positive regulation of apoptotic process (IEA,ISO)

positive regulation of epidermal growth factor receptor signaling pathway (IEA,ISO)

positive regulation of keratinocyte migration (IEA,ISO)

positive regulation of leukocyte migration (IDA)

positive regulation of protein phosphorylation (IEA,ISO)

positive regulation of release of cytochrome c from mitochondria (IEA,ISO)

positive regulation of synaptic plasticity (IMP)

positive regulation of vascular associated smooth muscle cell proliferation (IEA,ISO)

protein catabolic process (IDA)

proteolysis (IDA,IEA,ISO,ISS)

regulation of postsynaptic neurotransmitter receptor diffusion trapping (IDA)

response to amyloid-beta (IEA,ISO)

response to estradiol (IEP)

response to ethanol (IEP)

response to high light intensity (IEP)

response to hyperoxia (IEP)

response to hypoxia (IEP)

response to lipopolysaccharide (IEP)

response to mechanical stimulus (IEP)

response to nicotine (IEP)

response to nutrient (IEP)

response to organic cyclic compound (IEP)

response to organic substance (IEP)

response to oxidative stress (IDA)

response to retinoic acid (IEP)

response to tumor necrosis factor (IEP)

response to vitamin A (IEP)

response to xenobiotic stimulus (IDA,IEP)

skeletal system development (IEA,ISO)

tissue remodeling (IDA)

transformation of host cell by virus (IDA)

Cellular Component

extracellular matrix (IEA)

extracellular matrix of synaptic cleft (IDA)

extracellular region (IEA)

extracellular space (IBA,IDA,IEA,ISO,ISS)

glutamatergic synapse (IDA)

postsynaptic density, intracellular component (IDA)

protein-containing complex (IDA)

Schaffer collateral - CA1 synapse (EXP,IDA)

Molecular Function

endopeptidase activity (ISO)

fibronectin binding (IPI)

identical protein binding (IEA,ISO)

metalloendopeptidase activity (IBA,IEA,ISO,ISS,TAS)

metallopeptidase activity (IDA,ISO)

peptidase activity (IDA,ISO)

protein binding (IPI,ISO)

protein-containing complex binding (IDA)

serine-type endopeptidase activity (ISO)

zinc ion binding (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

fibroblast growth factor signaling pathway (ISO)

syndecan signaling pathway (ISO)

urinary bladder cancer pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Neutrophil adsorption by polymyxin B-immobilized fiber column for acute exacerbation in patients with interstitial pneumonia: a pilot study.	Abe S, etal., Blood Purif. 2010;29(4):321-6. Epub 2010 Feb 24.
2.	Tear fluid gelatinase B activity correlates with IL-1alpha concentration and fluorescein clearance in ocular rosacea.	Afonso AA, etal., Invest Ophthalmol Vis Sci. 1999 Oct;40(11):2506-12.
3.	Lack of matrix metalloproteinase-9 worsens ventilator-induced lung injury.	Albaiceta GM, etal., Am J Physiol Lung Cell Mol Physiol. 2008 Mar;294(3):L535-43. Epub 2008 Jan 25.
4.	Downregulation of remodelling enzymatic activity induced by an angiotensin-converting enzyme inhibitor (perindopril) reduces the degeneration of experimental abdominal aortic aneurysms in a rat model.	Alsac JM, etal., Eur J Vasc Endovasc Surg. 2011 Apr;41(4):474-80. doi: 10.1016/j.ejvs.2010.12.007. Epub 2011 Jan 20.
5.	Expression patterns of matrix metalloproteinases and vascular endothelial growth factor during epiphyseal ossification.	Alvarez J, etal., J Bone Miner Res. 2005 Jun;20(6):1011-21. Epub 2005 Feb 7.
6.	The role of AdipoR1 and AdipoR2 in liver fibrosis.	Alzahrani B, etal., Biochim Biophys Acta Mol Basis Dis. 2018 Mar;1864(3):700-708. doi: 10.1016/j.bbadis.2017.12.012. Epub 2017 Dec 10.
7.	Bronchoalveolar matrix metalloproteinase 9 relates to restrictive lung function impairment in systemic sclerosis.	Andersen GN, etal., Respir Med. 2007 Oct;101(10):2199-206. Epub 2007 Jul 20.
8.	Genetic variations in MMP9 and MMP13 contribute to tooth agenesis in a Brazilian population.	Antunes LS, etal., J Oral Sci. 2013;55(4):281-6.
9.	Role of TIMP-1 and TIMP-2 in the progression of cerebral aneurysms.	Aoki T, etal., Stroke. 2007 Aug;38(8):2337-45. Epub 2007 Jun 14.
10.	Macrophage-derived matrix metalloproteinase-2 and -9 promote the progression of cerebral aneurysms in rats.	Aoki T, etal., Stroke. 2007 Jan;38(1):162-9. Epub 2006 Nov 22.
11.	Forced expression of MMP9 rescues the loss of angiogenesis and abrogates metastasis of pancreatic tumors triggered by the absence of host SPARC.	Arnold S, etal., Exp Biol Med (Maywood). 2008 Jul;233(7):860-73. Epub 2008 Apr 29.
12.	Upregulated expression and activation of membrane‑associated proteases in esophageal squamous cell carcinoma.	Augoff K, etal., Oncol Rep. 2014 Jun;31(6):2820-6. doi: 10.3892/or.2014.3162. Epub 2014 Apr 29.
13.	Matrix metalloproteinase-9 genetic variation and primary angle closure glaucoma in a Caucasian population.	Awadalla MS, etal., Mol Vis. 2011;17:1420-4. Epub 2011 May 27.
14.	Insidious role of nitric oxide in migration/invasion of colon cancer cells by upregulating MMP-2/9 via activation of cGMP-PKG-ERK signaling pathways.	Babykutty S, etal., Clin Exp Metastasis. 2012 Jun;29(5):471-92. doi: 10.1007/s10585-012-9464-6. Epub 2012 Mar 15.
15.	Protective effect of naringenin in experimental ischemic stroke: down-regulated NOD2, RIP2, NF-¿B, MMP-9 and up-regulated claudin-5 expression.	Bai X, etal., Neurochem Res. 2014 Aug;39(8):1405-15. doi: 10.1007/s11064-014-1326-y. Epub 2014 May 20.
16.	Inhibition of matrix metalloproteinases-2 and -9 prevents cognitive impairment induced by pneumococcal meningitis in Wistar rats.	Barichello T, etal., Exp Biol Med (Maywood). 2014 Feb;239(2):225-31. doi: 10.1177/1535370213508354. Epub 2014 Jan 13.
17.	Angiostatin and matrix metalloprotease expression following ischemic acute renal failure.	Basile DP, etal., Am J Physiol Renal Physiol 2004 May;286(5):F893-902. Epub 2004 Jan 6.
18.	Effects of two conventional preoperative radiation schedules on anastomotic healing in the rat colon.	Bedirli A, etal., Eur Surg Res. 2007;39(3):141-7. Epub 2007 Mar 2.
19.	MMP9 polymorphisms and breast cancer risk: a report from the Shanghai Breast Cancer Genetics Study.	Beeghly-Fadiel A, etal., Breast Cancer Res Treat. 2011 Apr;126(2):507-13. doi: 10.1007/s10549-010-1119-1. Epub 2010 Aug 20.
20.	Raf-induced MMP9 disrupts tissue architecture of human breast cells in three-dimensional culture and is necessary for tumor growth in vivo.	Beliveau A, etal., Genes Dev. 2010 Dec 15;24(24):2800-11. doi: 10.1101/gad.1990410.
21.	The involvement of oxidants and NF-kappaB in cytokine-induced MMP-9 synthesis by bone marrow-derived osteoprogenitor cells.	Ben-David D, etal., Inflamm Res. 2012 Jul;61(7):673-88. doi: 10.1007/s00011-012-0461-7. Epub 2012 Mar 13.
22.	Genetic variations and plasma levels of gelatinase A (matrix metalloproteinase-2) and gelatinase B (matrix metalloproteinase-9) in proliferative diabetic retinopathy.	Beranek M, etal., Mol Vis. 2008 Jun 14;14:1114-21.
23.	Postnatal ablation of Foxm1 from cardiomyocytes causes late onset cardiac hypertrophy and fibrosis without exacerbating pressure overload-induced cardiac remodeling.	Bolte C, etal., PLoS One. 2012;7(11):e48713. doi: 10.1371/journal.pone.0048713. Epub 2012 Nov 8.
24.	Circulating matrix metalloproteinase-9 and osteoporosis in patients with chronic obstructive pulmonary disease.	Bolton CE, etal., Chron Respir Dis. 2009;6(2):81-7.
25.	Identification of gene expression profiles correlated to tumor progression in a preclinical model of colon carcinogenesis.	Bousserouel S, etal., Int J Oncol. 2010 Jun;36(6):1485-90.
26.	Matrix metalloproteinase-9 (MMP-9) and tissue inhibitor of matrix metalloproteinase (TIMP-1) in patients with relapsing-remitting multiple sclerosis treated with interferon beta.	Boz C, etal., Clin Neurol Neurosurg. 2006 Feb;108(2):124-8.
27.	In vivo roles for matrix metalloproteinase-9 in mature hippocampal synaptic physiology and plasticity.	Bozdagi O, etal., J Neurophysiol. 2007 Jul;98(1):334-44. Epub 2007 May 9.
28.	Resveratrol inhibits neointimal formation after arterial injury through an endothelial nitric oxide synthase-dependent mechanism.	Breen DM, etal., Atherosclerosis. 2012 Jun;222(2):375-81. Epub 2012 Mar 27.
29.	Telmisartan Prevents Alveolar Bone Loss by Decreasing the Expression of Osteoclasts Markers in Hypertensive Rats With Periodontal Disease.	Brito VGB, etal., Front Pharmacol. 2020 Nov 11;11:579926. doi: 10.3389/fphar.2020.579926. eCollection 2020.
30.	Markers of myocardial damage, tissue healing, and inflammation after radiofrequency catheter ablation of atrial tachyarrhythmias.	Brueckmann M, etal., J Cardiovasc Electrophysiol. 2004 Jun;15(6):686-91.
31.	Stromal remodelling is required for progressive involution of the rat ventral prostate after castration: Identification of a matrix metalloproteinase-dependent apoptotic wave.	Bruni-Cardoso A, etal., Int J Androl. 2009 Nov 10.
32.	Induction of neutrophil gelatinase-associated lipocalin in vascular injury via activation of nuclear factor-kappaB.	Bu DX, etal., Am J Pathol. 2006 Dec;169(6):2245-53.
33.	Mechanism of matrix accumulation and glomerulosclerosis in spontaneously hypertensive rats.	Camp TM, etal., J Hypertens 2003 Sep;21(9):1719-27.
34.	Cyclooxygenase inhibition limits blood-brain barrier disruption following intracerebral injection of tumor necrosis factor-alpha in the rat.	Candelario-Jalil E, etal., J Pharmacol Exp Ther. 2007 Nov;323(2):488-98. Epub 2007 Aug 17.
35.	Metalloproteinase-9 in circulating monocytes in pulmonary hypertension.	Cantini-Salignac C, etal., Fundam Clin Pharmacol. 2006 Aug;20(4):405-10.
36.	Deficiency of gelatinase B/MMP-9 aggravates lpr-induced lymphoproliferation and lupus-like systemic autoimmune disease.	Cauwe B, etal., J Autoimmun. 2011 May;36(3-4):239-52. doi: 10.1016/j.jaut.2011.02.002. Epub 2011 Mar 3.
37.	The activities of MMP-9 and total gelatinase respond differently to substrate coating and cyclic mechanical stretching in fibroblasts and myoblasts.	Cha MC and Purslow PP, Cell Biol Int. 2010 Apr 21;34(6):587-91.
38.	Remodeling of experimental arteriovenous fistula with increased matrix metalloproteinase expression in rats.	Chan CY, etal., J Vasc Surg. 2007 Apr;45(4):804-11.
39.	Iatrogenic extracellular matrix disruption as a local trigger for postoperative ileus.	Chang J, etal., J Surg Res. 2012 Dec;178(2):632-9. doi: 10.1016/j.jss.2012.05.044. Epub 2012 Jun 1.
40.	Baicalein protects against retinal ischemia by antioxidation, antiapoptosis, downregulation of HIF-1alpha, VEGF, and MMP-9 and upregulation of HO-1.	Chao HM, etal., J Ocul Pharmacol Ther. 2013 Jul-Aug;29(6):539-49. doi: 10.1089/jop.2012.0179. Epub 2013 Mar 28.
41.	Plasma levels of matrix metalloproteinase-2 and -9 (MMP-2 and MMP-9) in age-related macular degeneration.	Chau KY, etal., Eye (Lond). 2007 Dec;21(12):1511-5. Epub 2007 Feb 16.
42.	The alterations of matrix metalloproteinase-9 in mouse brainstem during herpes simplex virus type 1-induced facial palsy.	Chen D, etal., J Mol Neurosci. 2013 Nov;51(3):703-9. doi: 10.1007/s12031-013-0051-3. Epub 2013 Jul 2.
43.	A single nucleotide polymorphism in the matrix metalloproteinase 9 gene (-8202A/G) is associated with thoracic aortic aneurysms and thoracic aortic dissection.	Chen L, etal., J Thorac Cardiovasc Surg. 2006 May;131(5):1045-52.
44.	Endothelin-1 receptor antagonists prevent the development of pulmonary emphysema in rats.	Chen Y, etal., Eur Respir J. 2010 Apr;35(4):904-12. Epub 2009 Nov 6.
45.	MMP-9 expression is associated with leukocytic but not endothelial markers in brain arteriovenous malformations.	Chen Y, etal., Front Biosci. 2006 Sep 1;11:3121-8.
46.	[Effect of curcumin on activity of matrix metalloproteinase 2, 9 and nuclear expression of RelA in rat hepatic stellate cells by activating peroxisome proliferator-activated receptor gamma signal]	Cheng Y, etal., Zhongguo Zhong Xi Yi Jie He Za Zhi. 2007 May;27(5):439-43.
47.	Role of matrix metalloprotease-9 in hyperoxic injury in developing lung.	Chetty A, etal., Am J Physiol Lung Cell Mol Physiol. 2008 Oct;295(4):L584-92. Epub 2008 Jul 25.
48.	Matrix metalloproteinases and tissue inhibitors of metalloproteinases in coxsackievirus-induced myocarditis.	Cheung C, etal., Cardiovasc Pathol. 2006 Mar-Apr;15(2):63-74.
49.	Matrix metalloproteinase gelatinase B (MMP-9) is associated with leaking glaucoma filtering blebs.	Chintala SK, etal., Exp Eye Res. 2005 Oct;81(4):429-36.
50.	Ascofuranone suppresses PMA-mediated matrix metalloproteinase-9 gene activation through the Ras/Raf/MEK/ERK- and Ap1-dependent mechanisms.	Cho HJ, etal., Carcinogenesis. 2007 May;28(5):1104-10. Epub 2006 Nov 17.
51.	Increased expression of matrix metalloproteinase 9 and tubulin-alpha in pulmonary sclerosing hemangioma.	Cho SJ, etal., Oncol Rep. 2007 Nov;18(5):1139-44.
52.	Expression of metalloproteinases and their tissue inhibitors in squamous cell laryngeal carcinoma.	Christopoulos TA, etal., Oncol Rep. 2007 Oct;18(4):855-60.
53.	Effects of rosiglitazone alone and in combination with atorvastatin on nontraditional markers of cardiovascular disease in patients with type 2 diabetes mellitus.	Chu CS, etal., Am J Cardiol. 2006 Mar 1;97(5):646-50. Epub 2006 Jan 9.
54.	The clinical significance of gelatinase B in gouty arthritis of the knee.	Chu SC, etal., Clin Chim Acta. 2004 Jan;339(1-2):77-83.
55.	Elevated levels of matrix metalloproteinase 9 and tissue inhibitor of metalloproteinase 1 during the acute phase of Kawasaki disease.	Chua PK, etal., Clin Diagn Lab Immunol. 2003 Mar;10(2):308-14.
56.	Regulation of collagen degradation in the rat myocardium after infarction.	Cleutjens JP, etal., J Mol Cell Cardiol. 1995 Jun;27(6):1281-92.
57.	Role of matrix metalloproteinases in apoptosis after transient focal cerebral ischemia in rats and mice.	Copin JC, etal., Eur J Neurosci. 2005 Oct;22(7):1597-608.
58.	Matrix Metalloproteinase-9 (MMP-9) polymorphisms in patients with cutaneous malignant melanoma.	Cotignola J, etal., BMC Med Genet. 2007 Mar 8;8:10.
59.	MMP-9 supplied by bone marrow-derived cells contributes to skin carcinogenesis.	Coussens LM, etal., Cell. 2000 Oct 27;103(3):481-90.
60.	Altered expression of the plasminogen activation pathway in peripheral blood mononuclear cells in multiple sclerosis: possible pathomechanism of matrix metalloproteinase activation.	Cox MB, etal., Mult Scler. 2013 Sep;19(10):1268-74. doi: 10.1177/1352458513475493. Epub 2013 Feb 11.
61.	Chorioamnionitis and increased neonatal lung lavage fluid matrix metalloproteinase-9 levels: implications for antenatal origins of chronic lung disease.	Curley AE, etal., Am J Obstet Gynecol. 2003 Apr;188(4):871-5.
62.	Osteopontin-stimulated expression of matrix metalloproteinase-9 causes cardiomyopathy in the mdx model of Duchenne muscular dystrophy.	Dahiya S, etal., J Immunol. 2011 Sep 1;187(5):2723-31. doi: 10.4049/jimmunol.1101342. Epub 2011 Aug 1.
63.	Matrix metalloproteinase-2 and metalloproteinase-9 activities are associated with blood-brain barrier dysfunction in an animal model of severe sepsis.	Dal-Pizzol F, etal., Mol Neurobiol. 2013 Aug;48(1):62-70. doi: 10.1007/s12035-013-8433-7. Epub 2013 Mar 12.
64.	Deficiency of ataxia telangiectasia mutated kinase delays inflammatory response in the heart following myocardial infarction.	Daniel LL, etal., J Am Heart Assoc. 2014 Dec;3(6):e001286. doi: 10.1161/JAHA.114.001286.
65.	Active matrix metalloproteases are expressed early on and are high during the Barrett's esophagus malignancy sequence.	Davelaar AL, etal., Scand J Gastroenterol. 2015 Mar;50(3):321-32. doi: 10.3109/00365521.2014.940379. Epub 2015 Jan 6.
66.	Relationship of proteinases and proteinase inhibitors with microbial presence in chronic lung disease of prematurity.	Davies PL, etal., Thorax. 2010 Mar;65(3):246-51.
67.	Evaluation of metalloproteinase 2 and 9 levels and their inhibitors in diabetic and healthy subjects.	Derosa G, etal., Diabetes Metab. 2007 Apr;33(2):129-34. Epub 2007 Feb 22.
68.	Matrix metalloproteinase-2, -9, and tissue inhibitor of metalloproteinase-1 in patients with hypertension.	Derosa G, etal., Endothelium. 2006 May-Jun;13(3):227-31.
69.	The activated form of gelatinase B/matrix metalloproteinase-9 is associated with diabetic vitreous hemorrhage.	Descamps FJ, etal., Exp Eye Res. 2006 Aug;83(2):401-7. Epub 2006 Apr 27.
70.	Steroid-independent upregulation of matrix metalloproteinase 9 in chronic rhinosinusitis patients with radiographic evidence of osteitis.	Detwiller KY, etal., Int Forum Allergy Rhinol. 2013 May;3(5):364-8. doi: 10.1002/alr.21135. Epub 2013 Feb 8.
71.	Gelatinolytic activities (matrix metalloproteinase-2 and -9) and soluble extracellular domain of Her-2/neu in pleural effusions.	Di Carlo A, etal., Oncol Rep. 2007 Aug;18(2):425-31.
72.	Mechanisms involved in the development and healing of diabetic foot ulceration.	Dinh T, etal., Diabetes. 2012 Nov;61(11):2937-47. doi: 10.2337/db12-0227. Epub 2012 Jun 11.
73.	The outer wall of small airways is a major site of remodeling in fatal asthma.	Dolhnikoff M, etal., J Allergy Clin Immunol. 2009 May;123(5):1090-7, 1097.e1. Epub 2009 Apr 10.
74.	LINC00689 participates in proliferation, chemoresistance and metastasis via miR-31-5p/YAP/β-catenin axis in colorectal cancer.	Du YL, etal., Exp Cell Res. 2020 Oct 1;395(1):112176. doi: 10.1016/j.yexcr.2020.112176. Epub 2020 Jul 16.
75.	Serum gelatinase B/MMP-9 in primary progressive multiple sclerosis patients treated with interferon-beta-1a.	Dubois B, etal., J Neurol. 2003 Sep;250(9):1037-43.
76.	Key role of the NO-pathway and matrix metalloprotease-9 in high blood flow-induced remodeling of rat resistance arteries.	Dumont O, etal., Arterioscler Thromb Vasc Biol. 2007 Feb;27(2):317-24. Epub 2006 Dec 7.
77.	Role of matrix metalloproteinase-9 (MMP-9) in striatal blood-brain barrier disruption in a 3-nitropropionic acid model of Huntington's disease.	Duran-Vilaregut J, etal., Neuropathol Appl Neurobiol. 2011 Aug;37(5):525-37. doi: 10.1111/j.1365-2990.2010.01157.x.
78.	Inhibition of cytokine-induced matrix metalloproteinase 9 expression by peroxisome proliferator-activated receptor alpha agonists is indirect and due to a NO-mediated reduction of mRNA stability.	Eberhardt W, etal., J Biol Chem 2002 Sep 6;277(36):33518-28.
79.	Increased plasma metalloproteinase-9 concentrations precede development of microalbuminuria in non-insulin-dependent diabetes mellitus.	Ebihara I, etal., Am J Kidney Dis. 1998 Oct;32(4):544-50.
80.	Cross-talk between vascular endothelial growth factor and matrix metalloproteinases in the induction of neovascularization in vivo.	Ebrahem Q, etal., Am J Pathol. 2010 Jan;176(1):496-503. Epub 2009 Nov 30.
81.	Sequential in-office vitreous aspirates demonstrate vitreous matrix metalloproteinase 9 levels correlate with the amount of subretinal fluid in eyes with wet age-related macular degeneration.	Ecker SM, etal., Mol Vis. 2012;18:1658-67. Epub 2012 Jun 20.
82.	Noninvasive diagnosis of bladder cancer by detection of matrix metalloproteinases (MMP-2 and MMP-9) and their inhibitor (TIMP-2) in urine.	Eissa S, etal., Eur Urol. 2007 Nov;52(5):1388-96. Epub 2007 Apr 10.
83.	Elevated serum levels of proinflammatory cytokines and biomarkers of matrix remodeling in never-treated patients with familial hypercholesterolemia.	El Messal M, etal., Clin Chim Acta. 2006 Apr;366(1-2):185-9. Epub 2005 Nov 8.
84.	Matrix metalloproteases in bronchoalveolar lavage fluid of patients with type III Pseudomonas aeruginosa pneumonia.	El-Solh AA, etal., J Infect. 2009 Jul;59(1):49-55. Epub 2009 May 23.
85.	Matrix metalloproteinase-9 promoter gene polymorphism (-1562C>T) in nasal polyposis.	Erbek SS, etal., Am J Rhinol Allergy. 2009 Nov-Dec;23(6):568-70.
86.	Downregulation of vascular matrix metalloproteinase inducer and activator proteins in hypertensive patients.	Ergul A, etal., Am J Hypertens. 2004 Sep;17(9):775-82.
87.	Bronchoalveolar lavage MMP-9 and TIMP-1 in preschool wheezers and their relationship to persistent wheeze.	Erlewyn-Lajeunesse MD, etal., Pediatr Res. 2008 Aug;64(2):194-9.
88.	Induced expression of MMP-9 in C6 glioma cells is inhibited by PDGF via a PI 3-kinase-dependent pathway.	Esteve PO, etal., Biochem Biophys Res Commun 2002 Aug 30;296(4):864-9.
89.	Protein kinase C-zeta regulates transcription of the matrix metalloproteinase-9 gene induced by IL-1 and TNF-alpha in glioma cells via NF-kappa B.	Esteve PO, etal., J Biol Chem 2002 Sep 20;277(38):35150-5.
90.	Changes in the expression of MMP2, MMP9, and ColIV in stromal cells in oral squamous tongue cell carcinoma: relationships and prognostic implications.	Fan HX, etal., J Exp Clin Cancer Res. 2012 Oct 29;31:90. doi: 10.1186/1756-9966-31-90.
91.	MMP-2 and MMP-9 are elevated in spinal cord and skin in a mouse model of ALS.	Fang L, etal., J Neurol Sci. 2010 Jul 15;294(1-2):51-6. doi: 10.1016/j.jns.2010.04.005. Epub 2010 May 4.
92.	Increased muscle proteolysis after local trauma mainly reflects macrophage-associated lysosomal proteolysis.	Farges MC, etal., Am J Physiol Endocrinol Metab 2002 Feb;282(2):E326-35.
93.	The study of ISO induced heart failure rat model.	Feng W and Li W, Exp Mol Pathol. 2010 Apr;88(2):299-304. Epub 2009 Nov 10.
94.	Platelet soluble CD40L and matrix metalloproteinase 9 activity are proinflammatory mediators in Behcet disease patients.	Fernandez Bello I, etal., Thromb Haemost. 2012 Jan;107(1):88-98. doi: 10.1160/TH11-08-0556. Epub 2011 Nov 24.
95.	MMP-9 microsatellite polymorphism: association with the progression of intima-media thickening and constrictive remodeling of carotid atherosclerotic plaques.	Fiotti N, etal., Atherosclerosis. 2005 Oct;182(2):287-92. Epub 2005 Feb 12.
96.	Transgenic expression of matrix metalloproteinase-9 causes adult-onset emphysema in mice associated with the loss of alveolar elastin.	Foronjy R, etal., Am J Physiol Lung Cell Mol Physiol. 2008 Jun;294(6):L1149-57. Epub 2008 Apr 11.
97.	The influence of functional polymorphisms in matrix metalloproteinase 9 on survival of breast cancer patients in a Chinese population.	Fu F, etal., DNA Cell Biol. 2013 May;32(5):274-82. doi: 10.1089/dna.2012.1928. Epub 2013 Apr 9.
98.	Losartan alleviates renal fibrosis by down-regulating HIF-1a and up-regulating MMP-9/TIMP-1 in rats with 5/6 nephrectomy.	Fu W, etal., Ren Fail. 2012;34(10):1297-304. doi: 10.3109/0886022X.2012.723775. Epub 2012 Sep 24.
99.	Increases in interleukin-6 and matrix metalloproteinase-9 in the infarct-related coronary artery of acute myocardial infarction.	Funayama H, etal., Circ J. 2004 May;68(5):451-4.
100.	Temporal exposure of cryptic collagen epitopes within ischemic muscle during hindlimb reperfusion.	Gagne PJ, etal., Am J Pathol. 2005 Nov;167(5):1349-59.
101.	Long Non-coding RNA MALAT1/microRNA-143/VEGFA Signal Axis Modulates Vascular Endothelial Injury-Induced Intracranial Aneurysm.	Gao G, etal., Nanoscale Res Lett. 2020 Jun 29;15(1):139. doi: 10.1186/s11671-020-03357-2.
102.	Dynamic changes of matrix metalloproteinases in rat liver during the development of diethylnitrosamine-induced hepatocarcinoma.	Gao Y, etal., Di Yi Jun Yi Da Xue Xue Bao 2002 Oct;22(10):865-8.
103.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
104.	Elevation of ADAM10, ADAM17, MMP-2 and MMP-9 expression with media degeneration features CaCl2-induced thoracic aortic aneurysm in a rat model.	Geng L, etal., Exp Mol Pathol. 2010 Aug;89(1):72-81. Epub 2010 May 26.
105.	Transgenic expression of human matrix metalloproteinase-9 augments monocrotaline-induced pulmonary arterial hypertension in mice.	George J and D'Armiento J, J Hypertens. 2011 Feb;29(2):299-308.
106.	Rosuvastatin treatment prevents progressive kidney inflammation and fibrosis in stroke-prone rats.	Gianella A, etal., Am J Pathol. 2007 Apr;170(4):1165-77.
107.	Pharmacogenetic inhibition of eIF4E-dependent Mmp9 mRNA translation reverses fragile X syndrome-like phenotypes.	Gkogkas CG, etal., Cell Rep. 2014 Dec 11;9(5):1742-55. doi: 10.1016/j.celrep.2014.10.064. Epub 2014 Nov 26.
108.	Elevated matrix metalloproteinase 9 and tissue inhibitor of metalloproteinase 1 in obese children and adolescents.	Glowinska-Olszewska B and Urban M, Metabolism. 2007 Jun;56(6):799-805.
109.	Changes in matrix metalloproteinases during the evolution of interstitial renal fibrosis in a rat experimental model.	Gonzalez-Avila G, etal., Pathobiology. 1998;66(5):196-204.
110.	Prevention of brain injury by the nonbacteriolytic antibiotic daptomycin in experimental pneumococcal meningitis.	Grandgirard D, etal., Antimicrob Agents Chemother. 2007 Jun;51(6):2173-8. Epub 2007 Mar 19.
111.	Expression and in-situ localization of genes coding for extracellular matrix proteins and extracellular matrix degrading proteases in pancreatic cancer.	Gress TM, etal., Int J Cancer. 1995 Aug 9;62(4):407-13.
112.	Identification of candidate genes in scleroderma-related pulmonary arterial hypertension.	Grigoryev DN, etal., Transl Res. 2008 Apr;151(4):197-207. Epub 2008 Feb 1.
113.	Rapamycin alleviates brain edema after focal cerebral ischemia reperfusion in rats.	Guo W, etal., Immunopharmacol Immunotoxicol. 2014 Jun;36(3):211-23. doi: 10.3109/08923973.2014.913616. Epub 2014 Apr 29.
114.	[Expression of matrix metalloproteinase-2, 9 and it's tissue inhibitor-1, 2 in endometrial carcinoma]	Guo W, etal., Zhonghua Fu Chan Ke Za Zhi. 2002 Oct;37(10):604-7.
115.	Selective participation of c-Jun with Fra-2/c-Fos promotes aggressive tumor phenotypes and poor prognosis in tongue cancer.	Gupta S, etal., Sci Rep. 2015 Nov 19;5:16811. doi: 10.1038/srep16811.
116.	A novel and simple immunocapture assay for determination of gelatinase-B (MMP-9) activities in biological fluids: saliva from patients with Sjogren's syndrome contain increased latent and active gelatinase-B levels.	Hanemaaijer R, etal., Matrix Biol. 1998 Dec;17(8-9):657-65.
117.	Gene expression profiling of skin and draining lymph nodes of rats affected with cutaneous contact hypersensitivity.	Hartmann B, etal., Inflamm Res. 2006 Aug;55(8):322-34.
118.	Targeted deletion of CCR2 impairs deep vein thombosis resolution in a mouse model.	Henke PK, etal., J Immunol. 2006 Sep 1;177(5):3388-97.
119.	Interstitial fibrosis in the heart: differences in extracellular matrix proteins and matrix metalloproteinases in end-stage dilated, ischaemic and valvular cardiomyopathy.	Herpel E, etal., Histopathology. 2006 May;48(6):736-47.
120.	Adrenomedullin production is increased in colorectal adenocarcinomas; its relation to matrix metalloproteinase-9.	Hikosaka T, etal., Peptides. 2011 Sep;32(9):1825-31. doi: 10.1016/j.peptides.2011.07.012. Epub 2011 Aug 3.
121.	Airway remodelling in children with cystic fibrosis.	Hilliard TN, etal., Thorax. 2007 Dec;62(12):1074-80. Epub 2007 May 25.
122.	Matrix metalloproteinase-9 inhibition improves proliferation and engraftment of myogenic cells in dystrophic muscle of mdx mice.	Hindi SM, etal., PLoS One. 2013 Aug 15;8(8):e72121. doi: 10.1371/journal.pone.0072121. eCollection 2013.
123.	Multiple-polymorphism associations of 7 matrix metalloproteinase and tissue inhibitor metalloproteinase genes with myocardial infarction and angiographic coronary artery disease.	Horne BD, etal., Am Heart J. 2007 Oct;154(4):751-8.
124.	Hyperoxia decreases matrix metalloproteinase-9 and increases tissue inhibitor of matrix metalloproteinase-1 protein in the newborn rat lung: association with arrested alveolarization.	Hosford GE, etal., Pediatr Res. 2004 Jul;56(1):26-34. Epub 2004 May 5.
125.	Increased serum matrix metalloproteinase-9 in neuromyelitis optica: implication of disruption of blood-brain barrier.	Hosokawa T, etal., J Neuroimmunol. 2011 Jul;236(1-2):81-6. doi: 10.1016/j.jneuroim.2011.04.009. Epub 2011 May 31.
126.	Matrix metalloproteinase-2, -9 and -13 are involved in fibronectin degradation of rat lung granulomatous fibrosis caused by Angiostrongylus cantonensis.	Hsu CC and Lai SC, Int J Exp Pathol. 2007 Dec;88(6):437-43.
127.	Inhibition of matrix metalloproteinase 9 expression by a ribozyme blocks metastasis in a rat sarcoma model system.	Hua J and Muschel RJ, Cancer Res. 1996 Nov 15;56(22):5279-84.
128.	Matrix metalloproteinase 9 (MMP-9) gene polymorphism and MMP-9 plasma levels in primary Sjogren's syndrome.	Hulkkonen J, etal., Rheumatology (Oxford). 2004 Dec;43(12):1476-9. Epub 2004 Aug 17.
129.	Upregulation of tissue inhibitor of metalloproteases-1 (TIMP-1) and procollagen-N-peptidase in hypertension-induced renal damage.	Hultstrom M, etal., Nephrol Dial Transplant. 2008 Mar;23(3):896-903. Epub 2007 Oct 31.
130.	Matrix metalloproteinase-9 and tissue inhibitors of metalloproteinases 1 in influenza-associated encephalopathy.	Ichiyama T, etal., Pediatr Infect Dis J. 2007 Jun;26(6):542-4.
131.	Expression of matrix metalloproteinases and endogenous inhibitors within ascending aortic aneurysms of patients with Marfan syndrome.	Ikonomidis JS, etal., Circulation. 2006 Jul 4;114(1 Suppl):I365-70.
132.	Interleukin-1beta enhanced action of kinins on extracellular matrix of spontaneous hypertensive rat cardiac fibroblasts.	Imai C, etal., Clin Exp Hypertens 2005 Jan;27(1):59-69.
133.	Association of the MMP9 gene with childhood cedar pollen sensitization and pollinosis.	Inoue H, etal., J Hum Genet. 2012 Mar;57(3):176-83. doi: 10.1038/jhg.2011.148. Epub 2012 Jan 12.
134.	Imidapril inhibits cerebral aneurysm formation in an angiotensin-converting enzyme-independent and matrix metalloproteinase-9-dependent manner.	Ishibashi R, etal., Neurosurgery. 2012 Mar;70(3):722-30. doi: 10.1227/NEU.0b013e3182326188.
135.	Diagnosis and assessment of Takayasu arteritis by multiple biomarkers.	Ishihara T, etal., Circ J. 2013;77(2):477-83. Epub 2012 Oct 26.
136.	Nerve growth factor metabolic dysfunction in Down's syndrome brains.	Iulita MF, etal., Brain. 2014 Mar;137(Pt 3):860-72. doi: 10.1093/brain/awt372. Epub 2014 Feb 11.
137.	Evidence for the involvement of matrix metalloproteinases in the cardiovascular effects produced by nicotine.	Jacob-Ferreira AL, etal., Eur J Pharmacol. 2010 Feb 10;627(1-3):216-22. Epub 2009 Oct 30.
138.	Myelin loss associated with neuroinflammation in hypertensive rats.	Jalal FY, etal., Stroke. 2012 Apr;43(4):1115-22. doi: 10.1161/STROKEAHA.111.643080. Epub 2012 Feb 23.
139.	Expression of epidermal growth factor receptor, apomucins, matrix metalloproteinases, and p53 in rat and human cholangiocarcinoma: appraisal of an animal model of cholangiocarcinoma.	Jan YY, etal., Ann Surg. 2004 Jul;240(1):89-94.
140.	Melatonin reduced the elevated matrix metalloproteinase-9 level in a rat photothrombotic stroke model.	Jang JW, etal., J Neurol Sci. 2012 Dec 15;323(1-2):221-7. doi: 10.1016/j.jns.2012.09.021. Epub 2012 Oct 7.
141.	MMP-9 inhibitor SB-3CT attenuates behavioral impairments and hippocampal loss after traumatic brain injury in rat.	Jia F, etal., J Neurotrauma. 2014 Jul 1;31(13):1225-34. doi: 10.1089/neu.2013.3230. Epub 2014 Jun 3.
142.	Comparison of circulating MMP-9, TIMP-1 and CA19-9 in the detection of pancreatic cancer.	Joergensen MT, etal., Anticancer Res. 2010 Feb;30(2):587-92.
143.	Matrix metalloproteinases are down-regulated in rat lenses exposed to oxidative stress.	John M, etal., Exp Eye Res. 2004 Dec;79(6):839-46.
144.	Cytokine concentration in aqueous humour of eyes with exudative age-related macular degeneration.	Jonas JB, etal., Acta Ophthalmol. 2012 Aug;90(5):e381-8. doi: 10.1111/j.1755-3768.2012.02414.x. Epub 2012 Apr 10.
145.	Antitumorigenic effect of plumbagin by induction of SH2-containing protein tyrosine phosphatase 1 in human gastric cancer cells.	Joo MK, etal., Int J Oncol. 2015;46(6):2380-8. doi: 10.3892/ijo.2015.2935. Epub 2015 Mar 26.
146.	Douchi (fermented Glycine max Merr.) alleviates atopic dermatitis-like skin lesions in NC/Nga mice by regulation of PKC and IL-4.	Jung AR, etal., BMC Complement Altern Med. 2016 Oct 24;16(1):416.
147.	Serum matrix metalloproteinase-9 levels and severity of symptoms in boys with attention deficit hyperactivity disorder ADHD/hyperkinetic disorder HKD.	Kadziela-Olech H, etal., Eur Child Adolesc Psychiatry. 2015 Jan;24(1):55-63. doi: 10.1007/s00787-014-0533-z. Epub 2014 Mar 17.
148.	Influence of hyperglycemia on oxidative stress and matrix metalloproteinase-9 activation after focal cerebral ischemia/reperfusion in rats: relation to blood-brain barrier dysfunction.	Kamada H, etal., Stroke. 2007 Mar;38(3):1044-9. Epub 2007 Feb 1.
149.	Expression and activation of matrix metalloproteinase-9 and NADPH oxidase in tissues and plasma of experimental autoimmune encephalomyelitis in mice.	Kandagaddala LD, etal., Exp Toxicol Pathol. 2012 Jan;64(1-2):109-14. doi: 10.1016/j.etp.2010.07.002. Epub 2010 Aug 31.
150.	Exhaled breath condensate MMP-9 levels in children with bronchiectasis.	Karakoc GB, etal., Pediatr Pulmonol. 2009 Oct;44(10):1010-6.
151.	Diclofenac, a selective COX-2 inhibitor, inhibits DMH-induced colon tumorigenesis through suppression of MCP-1, MIP-1alpha and VEGF.	Kaur J and Sanyal SN, Mol Carcinog. 2011 Jan 25. doi: 10.1002/mc.20736.
152.	The imbalanced expression of matrix metalloproteinases in nephrogenic systemic fibrosis.	Kelly BC, etal., J Am Acad Dermatol. 2010 Sep;63(3):483-9. doi: 10.1016/j.jaad.2009.09.006.
153.	Matrix metalloproteinase-9 promotes neutrophil and T cell recruitment and migration in the postischemic liver.	Khandoga A, etal., J Leukoc Biol. 2006 Jun;79(6):1295-305. Epub 2006 Mar 21.
154.	Matrix metalloproteinases MMP-9 and MMP-7 are expressed in experimental autoimmune neuritis and the Guillain-Barre syndrome.	Kieseier BC, etal., Ann Neurol. 1998 Apr;43(4):427-34.
155.	Matrix metalloproteinase-9 and -7 are regulated in experimental autoimmune encephalomyelitis.	Kieseier BC, etal., Brain. 1998 Jan;121 ( Pt 1):159-66.
156.	Differential expression of matrix metalloproteinases in bacterial meningitis.	Kieseier BC, etal., Brain. 1999 Aug;122 ( Pt 8):1579-87.
157.	Expression of specific matrix metalloproteinases in inflammatory myopathies.	Kieseier BC, etal., Brain. 2001 Feb;124(Pt 2):341-51.
158.	Inhibition of matrix metalloproteinase-9 prevents neutrophilic inflammation in ventilator-induced lung injury.	Kim JH, etal., Am J Physiol Lung Cell Mol Physiol. 2006 Oct;291(4):L580-7. Epub 2006 May 12.
159.	Serum cytokines markers in toluene diisocyanate-induced asthma.	Kim JH, etal., Respir Med. 2011 Mar 23.
160.	Matrix metalloproteinase-9 in cerebral aneurysms.	Kim SC, etal., Neurosurgery. 1997 Sep;41(3):642-66; discussion 646-7.
161.	Elevated matrix metalloproteinase-9 in patients with systemic sclerosis.	Kim WU, etal., Arthritis Res Ther. 2005;7(1):R71-9. Epub 2004 Nov 10.
162.	Immunohistochemical changes in matrix metalloproteinase-2 and 9 during small bowel allograft rejection in rats.	Kimizuka K, etal., Transplant Proc 2002 May;34(3):1047-8.
163.	Expression of matrix metalloproteinases and their inhibitors during hepatic tissue repair in the rat.	Knittel T, etal., Histochem Cell Biol. 2000 Jun;113(6):443-53.
164.	Long-term Alcohol Consumption Increases Pro-Matrix Metalloproteinase-9 Levels via Oxidative Stress.	Koken T, etal., J Med Toxicol. 2010 Apr 20.
165.	Zhongguo yi xue ke xue yuan xue bao. Acta Academiae Medicinae Sinicae	Kong L, etal., Zhongguo Yi Xue Ke Xue Yuan Xue Bao. 2006 Oct;28(5):717-20.
166.	Synaptic localization of seizure-induced matrix metalloproteinase-9 mRNA.	Konopacki FA, etal., Neuroscience. 2007 Nov 30;150(1):31-9. Epub 2007 Aug 30.
167.	Matrix metalloproteinase-9 (MMP-9) in human intractable epilepsy caused by focal cortical dysplasia.	Konopka A, etal., Epilepsy Res. 2013 Mar;104(1-2):45-58. doi: 10.1016/j.eplepsyres.2012.09.018. Epub 2012 Nov 23.
168.	[Polymorphism in promoter regions of matrix metalloproteinases (MMP1, MMP9, and MMP12) in chronic obstructive pulmonary disease patients].	Korytina GF, etal., Genetika. 2008 Feb;44(2):242-9.
169.	ProMMP-9 (92 kDa gelatinase) in vitreous fluid of patients with proliferative diabetic retinopathy.	Kosano H, etal., Life Sci. 1999;64(25):2307-15.
170.	Abrogation of MMP-9 gene protects against the development of retinopathy in diabetic mice by preventing mitochondrial damage.	Kowluru RA, etal., Diabetes. 2011 Nov;60(11):3023-33. doi: 10.2337/db11-0816. Epub 2011 Sep 20.
171.	Pleural fluid analysis of lung cancer vs benign inflammatory disease patients.	Kremer R, etal., Br J Cancer. 2010 Mar 30;102(7):1180-4. Epub 2010 Mar 9.
172.	Hydrogen sulfide deficiency and diabetic renal remodeling: role of matrix metalloproteinase-9.	Kundu S, etal., Am J Physiol Endocrinol Metab. 2013 Jun 15;304(12):E1365-78. doi: 10.1152/ajpendo.00604.2012. Epub 2013 Apr 30.
173.	Single nucleotide polymorphism in the MMP-9 gene is associated with susceptibility to develop multiple sclerosis in an Italian case-control study.	La Russa A, etal., J Neuroimmunol. 2010 Aug 25;225(1-2):175-9. doi: 10.1016/j.jneuroim.2010.04.016. Epub 2010 May 14.
174.	Adenovirus-mediated expression of antisense MMP-9 in glioma cells inhibits tumor growth and invasion.	Lakka SS, etal., Oncogene. 2002 Nov 14;21(52):8011-9.
175.	Matrix metalloproteinase-9 contributes to choroidal neovascularization.	Lambert V, etal., Am J Pathol. 2002 Oct;161(4):1247-53.
176.	Matrix metalloproteinase 9 activity leads to elastin breakdown in an animal model of Kawasaki disease.	Lau AC, etal., Arthritis Rheum. 2008 Mar;58(3):854-63. doi: 10.1002/art.23225.
177.	Mutations in MMP9 and MMP13 determine the mode of inheritance and the clinical spectrum of metaphyseal anadysplasia.	Lausch E, etal., Am J Hum Genet. 2009 Aug;85(2):168-78. doi: 10.1016/j.ajhg.2009.06.014. Epub 2009 Jul 16.
178.	Melissa officinalis extract inhibits laser-induced choroidal neovascularization in a rat model.	Lee EK, etal., PLoS One. 2014 Oct 14;9(10):e110109. doi: 10.1371/journal.pone.0110109. eCollection 2014.
179.	17ß-estradiol inhibits MMP-9 and SUR1/TrpM4 expression and activation and thereby attenuates BSCB disruption/hemorrhage after spinal cord injury in male rats.	Lee JY, etal., Endocrinology. 2015 May;156(5):1838-50. doi: 10.1210/en.2014-1832. Epub 2015 Mar 12.
180.	Serum insulin-like growth factor-axis and matrix metalloproteinases in patients with rheumatic arthritis or rheumatic heart disease.	Lee SD, etal., Clin Chim Acta. 2006 May;367(1-2):62-8. Epub 2006 Jan 9.
181.	Polymorphisms in matrix metalloproteinase-1, -9 and -12 genes and the risk of chronic obstructive pulmonary disease in a Korean population.	Lee SY, etal., Respiration. 2010;80(2):133-8. Epub 2010 Feb 16.
182.	Induction of matrix metalloproteinase-9 (MMP-9) in lipopolysaccharide-stimulated primary astrocytes is mediated by extracellular signal-regulated protein kinase 1/2 (Erk1/2).	Lee WJ, etal., Glia 2003 Jan;41(1):15-24.
183.	92-kDa gelatinase (matrix metalloproteinase-9) is induced in rat amnion immediately prior to parturition.	Lei H, etal., Biol Reprod. 1995 Aug;53(2):339-44.
184.	Matrix metalloproteinase upregulation in chronic inflammatory demyelinating polyneuropathy and nonsystemic vasculitic neuropathy.	Leppert D, etal., Neurology. 1999 Jul 13;53(1):62-70.
185.	MMP-9 and CXCL8/IL-8 are potential therapeutic targets in epidermolysis bullosa simplex.	Lettner T, etal., PLoS One. 2013 Jul 19;8(7):e70123. doi: 10.1371/journal.pone.0070123. Print 2013.
186.	The role of matrix metalloproteinases in extracellular matrix remodelling in chronic obstructive pulmonary disease rat models	Li H, etal., Zhonghua Nei Ke Za Zhi 2002 Jun;41(6):393-8.
187.	Prognostic value of matrix metalloproteinases (MMP-2 and MMP-9) in patients with lymph node-negative breast carcinoma.	Li HC, etal., Breast Cancer Res Treat. 2004 Nov;88(1):75-85.
188.	Increased expression of matrix metalloproteinase 9 in cortical lesions from patients with focal cortical dysplasia type IIb and tuberous sclerosis complex.	Li S, etal., Brain Res. 2012 May 9;1453:46-55. doi: 10.1016/j.brainres.2012.03.009. Epub 2012 Mar 12.
189.	Effect of respiratory syncytial virus on the activity of matrix metalloproteinase in mice.	Li W and Shen HH, Chin Med J (Engl). 2007 Jan 5;120(1):5-11.
190.	[Retinoic acid diminished the expression of lung tissue matrix metalloproteinase-2 and matrix metalloproteinase-9 in hyperoxia-exposed premature rats through regulating mitogen-activated protein kinases].	Li WB, etal., Zhonghua Er Ke Za Zhi. 2008 May;46(5):347-53.
191.	Effect of curcumin on permeability of coronary artery and expression of related proteins in rat coronary atherosclerosis heart disease model.	Li X, etal., Int J Clin Exp Pathol. 2015 Jun 1;8(6):7247-53. eCollection 2015.
192.	Expression of TGF, matrix metalloproteinases, and tissue inhibitors in Chinese chronic rhinosinusitis.	Li X, etal., J Allergy Clin Immunol. 2010 May;125(5):1061-8. Epub 2010 Apr 14.
193.	[Effects of unfractionated heparin on expression of metalloproteinase-2 and -9 in acute lung injury rats].	Li X, etal., Zhongguo Wei Zhong Bing Ji Jiu Yi Xue. 2012 Oct;24(10):608-11.
194.	Expression of RECK gene and MMP-9 in hilar cholangiocarcinoma and its clinical significance.	Li Y, etal., J Huazhong Univ Sci Technolog Med Sci. 2005;25(5):552-4.
195.	Ginkgolic acid (GA) suppresses gastric cancer growth by inducing apoptosis and suppressing STAT3/JAK2 signaling regulated by ROS.	Liang JR and Yang H, Biomed Pharmacother. 2020 May;125:109585. doi: 10.1016/j.biopha.2019.109585. Epub 2020 Feb 25.
196.	Activin A contributes to the development of hyperoxia-induced lung injury in neonatal mice.	Lim R, etal., Pediatr Res. 2015 Jun;77(6):749-56. doi: 10.1038/pr.2015.46. Epub 2015 Mar 11.
197.	Functional polymorphisms in matrix metalloproteinases-1, -3, -9 are associated with arteriovenous fistula patency in hemodialysis patients.	Lin CC, etal., Clin J Am Soc Nephrol. 2010 Oct;5(10):1805-14. doi: 10.2215/CJN.01500210. Epub 2010 Jul 8.
198.	[Effects of matrix metallopeptidase 9 on the proliferation, apoptosis, type I and III procollagen synthesis of rat dermal fibroblasts].	Lin DZ, etal., Zhonghua Yi Xue Za Zhi. 2012 Feb 28;92(8):564-7.
199.	Expression of reversion-inducing cysteine-rich protein with kazal motifs and matrix metalloproteinase 9 in middle ear squamous cell carcinoma.	Liu X, etal., ORL J Otorhinolaryngol Relat Spec. 2012;74(1):16-21. doi: 10.1159/000334243. Epub 2011 Dec 16.
200.	[Influence of periodontal therapy on serum interleukin-6 and carotid metalloproteinases in animals with chronic periodontitis associated with atherosclerosis].	Liu Y, etal., Zhonghua Kou Qiang Yi Xue Za Zhi. 2014 Mar;49(3):155-60.
201.	Gelatinase B-deficient mice are resistant to experimental bullous pemphigoid.	Liu Z, etal., J Exp Med. 1998 Aug 3;188(3):475-82.
202.	[Overexpression of IL-8 and MMP-9 confer high malignant phenotype in patients with non-small cell lung cancer].	Liu Z, etal., Zhongguo Fei Ai Za Zhi. 2010 Aug 20;13(8):795-802.
203.	Profiles of matrix metalloproteinases and their inhibitors in plasma of patients with dementia.	Lorenzl S, etal., Int Psychogeriatr. 2008 Feb;20(1):67-76. Epub 2007 Aug 15.
204.	Matrix metalloproteinase-9 is elevated in 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine-induced parkinsonism in mice.	Lorenzl S, etal., Neuromolecular Med. 2004;5(2):119-32.
205.	Matrix metalloproteinase-9 deletion rescues auditory evoked potential habituation deficit in a mouse model of Fragile X Syndrome.	Lovelace JW, etal., Neurobiol Dis. 2016 May;89:126-35. doi: 10.1016/j.nbd.2016.02.002. Epub 2016 Feb 2.
206.	Matrix metalloproteinase-9 deficiency worsens lung injury in a model of bronchopulmonary dysplasia.	Lukkarinen H, etal., Am J Respir Cell Mol Biol. 2009 Jul;41(1):59-68. Epub 2008 Dec 18.
207.	Traditional Chinese medicine Kang Xian Fu Fang I is effective for prophylaxis and treatment of alcoholic liver disease in rats.	Lv XH, etal., Hepatobiliary Pancreat Dis Int. 2007 Apr;6(2):182-7.
208.	Higher expression of vascular endothelial growth factor (VEGF) and its receptor VEGFR-2 (Flk-1) and metalloproteinase-9 (MMP-9) in a rat model of peritoneal endometriosis is similar to cancer diseases.	Machado DE, etal., J Exp Clin Cancer Res. 2010 Jan 19;29:4.
209.	Delayed minocycline inhibits ischemia-activated matrix metalloproteinases 2 and 9 after experimental stroke.	Machado LS, etal., BMC Neurosci. 2006 Jul 17;7:56.
210.	Dinucleotide repeat polymorphism of matrix metalloproteinase-9 gene is associated with diabetic nephropathy.	Maeda S, etal., Kidney Int. 2001 Oct;60(4):1428-34.
211.	Increased cellular iron levels affect matrix metalloproteinase expression and phagocytosis in activated microglia.	Mairuae N, etal., Neurosci Lett. 2011 Aug 1;500(1):36-40. doi: 10.1016/j.neulet.2011.06.001. Epub 2011 Jun 12.
212.	Inhibition of matrix metalloproteinase on hepatic transforming growth factor beta1 and caspase-3 activation in hemorrhage.	Maitra SR, etal., Acad Emerg Med. 2005 Sep;12(9):797-803. doi: 10.1197/j.aem.2005.04.017.
213.	Matrix metalloproteinase 9 activity enhances host susceptibility to pulmonary infection with type A and B strains of Francisella tularensis.	Malik M, etal., J Immunol. 2007 Jan 15;178(2):1013-20.
214.	Matrix metalloproteinases and their impact on sinusal extension in chronic rhinosinusitis with nasal polyps.	Malinsky RR, etal., Eur Arch Otorhinolaryngol. 2013 Mar;270(4):1345-8. doi: 10.1007/s00405-012-2219-9. Epub 2012 Oct 12.
215.	Activation of matrix metalloproteinase-9 via neuronal nitric oxide synthase contributes to NMDA-induced retinal ganglion cell death.	Manabe S, etal., Invest Ophthalmol Vis Sci. 2005 Dec;46(12):4747-53.
216.	Coordinated elevation of membrane type 1-matrix metalloproteinase and matrix metalloproteinase-2 expression in rat uterus during postpartum involution.	Manase K, etal., Reprod Biol Endocrinol. 2006 Jun 2;4:32.
217.	Eugenol induces apoptosis and inhibits invasion and angiogenesis in a rat model of gastric carcinogenesis induced by MNNG.	Manikandan P, etal., Life Sci. 2010 Apr 29.
218.	All-trans retinoic acid modulates the balance of matrix metalloproteinase-9 and tissue inhibitor of metalloproteinase-1 in patients with emphysema.	Mao JT, etal., Chest. 2003 Nov;124(5):1724-32.
219.	Protective role of metalloproteinase inhibitor (AE-941) on ulcerative colitis in rats.	Mao JW, etal., World J Gastroenterol. 2012 Dec 21;18(47):7063-9. doi: 10.3748/wjg.v18.i47.7063.
220.	Effect of ablation or inhibition of stromal matrix metalloproteinase-9 on lung metastasis in a breast cancer model is dependent on genetic background.	Martin MD, etal., Cancer Res. 2008 Aug 1;68(15):6251-9. doi: 10.1158/0008-5472.CAN-08-0537.
221.	Increased presence of matrix metalloproteinases 2 and 9 in short- and long-term experimental herpes simplex virus encephalitis.	Martinez-Torres FJ, etal., Neurosci Lett. 2004 Sep 30;368(3):274-8.
222.	Inflammatory cells, cytokines and matrix metalloproteinases in amicrobial pustulosis of the folds and other neutrophilic dermatoses.	Marzano AV, etal., Int J Immunopathol Pharmacol. 2011 Apr-Jun;24(2):451-60.
223.	Comparison of matrix metalloproteinase expression between primary tumors with or without liver metastasis in pancreatic and colorectal carcinomas.	Matsuyama Y, etal., J Surg Oncol. 2002 Jun;80(2):105-10.
224.	Matrix metalloproteinase-9 amplifies the immune response to Pseudomonas aeruginosa corneal infection.	McClellan SA, etal., Invest Ophthalmol Vis Sci. 2006 Jan;47(1):256-64.
225.	Characterization of a glomerular epithelial cell metalloproteinase as matrix metalloproteinase-9 with enhanced expression in a model of membranous nephropathy.	McMillan JI, etal., J Clin Invest. 1996 Feb 15;97(4):1094-101.
226.	Increased activity and expression of matrix metalloproteinase-9 in a rat model of distal colitis.	Medina C, etal., Am J Physiol Gastrointest Liver Physiol 2003 Jan;284(1):G116-22.
227.	Matrix metalloproteinase-9 genotype influences large artery stiffness through effects on aortic gene and protein expression.	Medley TL, etal., Arterioscler Thromb Vasc Biol. 2004 Aug;24(8):1479-84. Epub 2004 Jun 10.
228.	Altered lymphocyte trafficking and diminished airway reactivity in transgenic mice expressing human MMP-9 in a mouse model of asthma.	Mehra D, etal., Am J Physiol Lung Cell Mol Physiol. 2010 Feb;298(2):L189-96. Epub 2009 Nov 25.
229.	Expression of MMP2, MMP9 and MMP3 in breast cancer brain metastasis in a rat model.	Mendes O, etal., Clin Exp Metastasis. 2005;22(3):237-46.
230.	Identification of a calcium-dependent matrix metalloproteinase complex in rat chorioallantoid membranes during labour.	Meraz-Cruz N, etal., Mol Hum Reprod. 2006 Oct;12(10):633-41. Epub 2006 Aug 25.
231.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
232.	Matrix metalloproteinase-9 controls NMDA receptor surface diffusion through integrin beta1 signaling.	Michaluk P, etal., J Neurosci. 2009 May 6;29(18):6007-12.
233.	Polymorphisms in matrix metalloproteinases MMP1 and MMP9 are associated with primary open-angle and angle closure glaucoma in a Pakistani population.	Micheal S, etal., Mol Vis. 2013;19:441-7. Epub 2013 Feb 20.
234.	Association of MMP1, MMP3, MMP9, and MMP12 polymorphisms with risk and clinical course of multiple sclerosis in a Polish population.	Mirowska-Guzel D, etal., J Neuroimmunol. 2009 Sep 29;214(1-2):113-7. doi: 10.1016/j.jneuroim.2009.06.014. Epub 2009 Jul 22.
235.	Microscopical evaluation of extracellular matrix and its relation to the palatopharyngeal muscle in obstructive sleep apnea.	Molina FD, etal., Microsc Res Tech. 2010 Sep 10.
236.	Fibronectin-alpha4beta1 integrin interactions regulate metalloproteinase-9 expression in steatotic liver ischemia and reperfusion injury.	Moore C, etal., Am J Pathol. 2007 Feb;170(2):567-77.
237.	Small airway remodeling in acute respiratory distress syndrome: a study in autopsy lung tissue.	Morales MM, etal., Crit Care. 2011 Jan 6;15(1):R4.
238.	Role of functional single nucleotide polymorphisms of MMP1, MMP2, and MMP9 in open angle glaucomas.	Mossbock G, etal., Mol Vis. 2010 Aug 28;16:1764-70.
239.	Clinical significance of the measurements of serum matrix metalloproteinase-9 and its inhibitor (tissue inhibitor of metalloproteinase-1) in patients with pancreatic cancer: metalloproteinase-9 as an independent prognostic factor.	Mroczko B, etal., Pancreas. 2009 Aug;38(6):613-8.
240.	Experimental hindlimb ischemia leads to neutrophil-mediated increases in gastrocnemius MMP-2 and -9 activity: a potential mechanism for ischemia induced MMP activation.	Muhs BE, etal., J Surg Res. 2004 Apr;117(2):249-54.
241.	Black tea polyphenols target matrix metalloproteinases, RECK, proangiogenic molecules and histone deacetylase in a rat hepatocarcinogenesis model.	Murugan RS, etal., Anticancer Res. 2009 Jun;29(6):2301-5.
242.	Expression of matrix metalloproteinase-9 associated with ets-1 proto-oncogene in rat tubulointerstitial cells.	Naito T, etal., Nephrol Dial Transplant. 2005 Nov;20(11):2333-48. Epub 2005 Jul 26.
243.	Elevation of serum levels of metalloproteinase-1, tissue inhibitor of metalloproteinase-1 and type IV collagen, and plasma levels of metalloproteinase-9 in polycystic kidney disease.	Nakamura T, etal., Am J Nephrol. 2000 Jan-Feb;20(1):32-6.
244.	Stromal metalloproteinase-9 is essential to angiogenesis and progressive growth of orthotopic human pancreatic cancer in parabiont nude mice.	Nakamura T, etal., Neoplasia. 2007 Nov;9(11):979-86.
245.	Matrix metalloproteinases and tissue inhibitors of metalloproteinases in human gliomas.	Nakano A, etal., J Neurosurg. 1995 Aug;83(2):298-307.
246.	Epigenetic regulation of aortic remodeling in hyperhomocysteinemia.	Narayanan N, etal., FASEB J. 2014 Aug;28(8):3411-22. doi: 10.1096/fj.14-250183. Epub 2014 Apr 16.
247.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
248.	Polymorphism analysis suggests that the gelatinase B gene is not a susceptibility factor for multiple sclerosis.	Nelissen I, etal., J Neuroimmunol. 2000 Jun 1;105(1):58-63.
249.	Matrix metalloproteinases and their tissue inhibitors in serum and cerebrospinal fluid of patients with amyotrophic lateral sclerosis.	Niebroj-Dobosz I, etal., Eur J Neurol. 2010 Feb;17(2):226-31. doi: 10.1111/j.1468-1331.2009.02775.x. Epub 2009 Oct 1.
250.	High serum levels of matrix metalloproteinase-9 and matrix metalloproteinase-1 are associated with rapid progression in patients with metastatic melanoma.	Nikkola J, etal., Clin Cancer Res. 2005 Jul 15;11(14):5158-66.
251.	Matrix metalloproteinases with gelatinolytic activity induced by Paracoccidioides brasiliensis infection.	Nishikaku AS, etal., Int J Exp Pathol. 2009 Oct;90(5):527-37. doi: 10.1111/j.1365-2613.2009.00663.x.
252.	HMG-CoA reductase inhibitors reduce matrix metalloproteinase-9 activity in human varicose veins.	Nomura S, etal., Eur Surg Res. 2005 Nov-Dec;37(6):370-8.
253.	Alternatively activated macrophages and collagen remodeling characterize the postpartum involuting mammary gland across species.	O'Brien J, etal., Am J Pathol. 2010 Mar;176(3):1241-55. Epub 2010 Jan 28.
254.	Matrix metalloproteinases in blood from patients with LAM.	Odajima N, etal., Respir Med. 2009 Jan;103(1):124-9. Epub 2008 Aug 29.
255.	Effect of hypoxia on gene expression of bone marrow-derived mesenchymal stem cells and mononuclear cells.	Ohnishi S, etal., Stem Cells. 2007 May;25(5):1166-77. Epub 2007 Feb 8.
256.	Angiotensin II Enhances Interleukin-1beta-Induced MMP-9 Secretion in Adult Rat Cardiac Fibroblasts.	Okada M, etal., J Vet Med Sci. 2010 Feb 9.
257.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
258.	Macrophage migration inhibitory factor up-regulates matrix metalloproteinase-9 and -13 in rat osteoblasts. Relevance to intracellular signaling pathways.	Onodera S, etal., J Biol Chem 2002 Mar 8;277(10):7865-74.
259.	The role of MMP-2 and MMP-9 polymorphisms in sporadic intracranial aneurysms.	Pannu H, etal., J Neurosurg. 2006 Sep;105(3):418-23.
260.	Visible light induces matrix metalloproteinase-9 expression in rat eye.	Papp AM, etal., J Neurochem. 2007 Dec;103(6):2224-33. Epub 2007 Sep 11.
261.	Polymorphism of matrix metalloproteinase-3 promoter gene as a risk factor for coronary artery lesions in Kawasaki disease.	Park JA, etal., J Korean Med Sci. 2005 Aug;20(4):607-11.
262.	Plasma and brain matrix metalloproteinase-9 after acute focal cerebral ischemia in rats.	Park KP, etal., Stroke. 2009 Aug;40(8):2836-42. Epub 2009 Jun 25.
263.	Serum MMP-2 and MMP-9 in patients with Behcet's disease: do their higher levels correlate to vasculo-Behcet's disease associated with aneurysm formation?	Pay S, etal., Clin Exp Rheumatol. 2007 Jul-Aug;25(4 Suppl 45):S70-5.
264.	Effect of experimental genital mycoplasmosis on production of matrix metalloproteinases in membranes and amniotic fluid of Sprague-Dawley rats.	Peltier MR, etal., Am J Reprod Immunol. 2007 Feb;57(2):116-21.
265.	Matrix metalloproteinase inhibition attenuates left ventricular remodeling and dysfunction in a rat model of progressive heart failure.	Peterson JT, etal., Circulation. 2001 May 8;103(18):2303-9.
266.	Role of matrix metalloproteinases and their inhibition in cutaneous wound healing and allergic contact hypersensitivity.	Pilcher BK, etal., Ann N Y Acad Sci. 1999 Jun 30;878:12-24.
267.	MMP-9 gene variants increase the risk for non-atopic asthma in children.	Pinto LA, etal., Respir Res. 2010 Feb 24;11:23.
268.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
269.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
270.	Matrix metalloproteinase-9 deficiency phenocopies features of preeclampsia and intrauterine growth restriction.	Plaks V, etal., Proc Natl Acad Sci U S A. 2013 Jul 2;110(27):11109-14. doi: 10.1073/pnas.1309561110. Epub 2013 Jun 17.
271.	Expression and activation of matrix metalloproteinase-2 and -9 in rat brain after transient focal cerebral ischemia.	Planas AM, etal., Neurobiol Dis. 2001 Oct;8(5):834-46.
272.	Matrix metalloproteinase3 and 9 gene promoter polymorphisms: joint action of two loci as a risk factor for coronary artery complicated plaques.	Pollanen PJ, etal., Atherosclerosis. 2005 May;180(1):73-8. Epub 2004 Dec 18.
273.	Atrial extracellular matrix remodelling in patients with atrial fibrillation.	Polyakova V, etal., J Cell Mol Med. 2008 Jan-Feb;12(1):189-208. doi: 10.1111/j.1582-4934.2008.00219.x. Epub 2008 Jan 10.
274.	Macrophage-mediated phagocytosis of apoptotic cholangiocytes contributes to reversal of experimental biliary fibrosis.	Popov Y, etal., Am J Physiol Gastrointest Liver Physiol. 2010 Mar;298(3):G323-34. doi: 10.1152/ajpgi.00394.2009. Epub 2010 Jan 7.
275.	Novel role of famotidine in downregulation of matrix metalloproteinase-9 during protection of ethanol-induced acute gastric ulcer.	Pradeepkumar Singh L, etal., Free Radic Biol Med. 2007 Jul 15;43(2):289-99. Epub 2007 Apr 29.
276.	Expression of matrix metalloproteinase 9 in pancreatic ductal carcinoma is associated with tumor metastasis formation.	Pryczynicz A, etal., Folia Histochem Cytobiol. 2007;45(1):37-40.
277.	Morphological changes of cerebral vessels and expression patterns of MMP-2 and MMP-9 on cerebrovascular wall of alcoholic rats.	Qi Q, etal., Int J Clin Exp Pathol. 2014 Apr 15;7(5):1880-8. eCollection 2014.
278.	[Regulatory effects of inhaled steroids on expression of matrix metalloproteinase-9 and its inhibitor in asthmatic rats]	Qiao HM, etal., Zhonghua Er Ke Za Zhi. 2005 Aug;43(8):591-4.
279.	Effect of all-trans retinoic acid on renal expressions of matrix metalloproteinase-2, matrix metalloproteinase-9 and tissue inhibitor of metalloproteinase-1 in rats with glomerulosclerosis.	Qin YH, etal., Pediatr Nephrol. 2009 Aug;24(8):1477-86. Epub 2009 Apr 9.
280.	Temperospatial expression of matrix metalloproteinases 1, 2, 3, and 9 during early tooth development.	Randall LE and Hall RC, Connect Tissue Res 2002;43(2-3):205-11.
281.	Embryogenesis of the rat heart: the expression of collagenases.	Ratajska A and Cleutjens JP, Basic Res Cardiol. 2002 May;97(3):189-97.
282.	Identification of neutrophil activation markers as novel surrogate markers of CF lung disease.	Rath T, etal., PLoS One. 2014 Dec 29;9(12):e115847. doi: 10.1371/journal.pone.0115847. eCollection 2014.
283.	MMP9 overexpression is associated with good surgical outcome in children with UPJO: Preliminary results.	Reis ST, etal., BMC Urol. 2016 Jul 23;16(1):44. doi: 10.1186/s12894-016-0162-6.
284.	LncRNA H19 regulates smooth muscle cell functions and participates in the development of aortic dissection through sponging miR-193b-3p.	Ren M, etal., Biosci Rep. 2021 Jan 29;41(1):BSR20202298. doi: 10.1042/BSR20202298.
285.	GOA pipeline	RGD automated data pipeline
286.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
287.	Increased net gelatinase but not serine protease activity in bronchiolitis obliterans syndrome.	Riise GC, etal., J Heart Lung Transplant. 2010 Jul;29(7):800-7. Epub 2010 Apr 22.
288.	Association of a nonsynonymous single-nucleotide polymorphism of matrix metalloproteinase 9 with giant cell arteritis.	Rodriguez-Pla A, etal., Arthritis Rheum. 2008 Jun;58(6):1849-53. doi: 10.1002/art.23457.
289.	Metalloproteinase-2 and -9 in giant cell arteritis: involvement in vascular remodeling.	Rodriguez-Pla A, etal., Circulation. 2005 Jul 12;112(2):264-9. Epub 2005 Jul 5.
290.	Minocycline prevents dynorphin-induced neurotoxicity during neuropathic pain in rats.	Rojewska E, etal., Neuropharmacology. 2014 Nov;86:301-10. doi: 10.1016/j.neuropharm.2014.08.001. Epub 2014 Aug 27.
291.	Matrix metalloproteinases and tissue remodeling in hypertrophic cardiomyopathy.	Roldan V, etal., Am Heart J. 2008 Jul;156(1):85-91.
292.	Combined treatment of glibenclamide and CoCl2 decreases MMP9 expression and inhibits growth in highly metastatic breast cancer.	Rong Z, etal., J Exp Clin Cancer Res. 2013 May 28;32:32. doi: 10.1186/1756-9966-32-32.
293.	Increased brain expression of matrix metalloproteinase-9 after ischemic and hemorrhagic human stroke.	Rosell A, etal., Stroke. 2006 Jun;37(6):1399-406. Epub 2006 May 11.
294.	Collagen induced arthritis increases secondary metastasis in MMTV-PyV MT mouse model of mammary cancer.	Roy LD, etal., BMC Cancer. 2011 Aug 22;11:365.
295.	Regulated expression of matrix metalloproteinases, inflammatory mediators, and endometrial matrix remodeling by 17beta-estradiol in the immature rat uterus.	Russo LA, etal., Reprod Biol Endocrinol. 2009 Nov 4;7:124.
296.	Urinary matrix metalloproteinases reflect renal damage in anti-neutrophil cytoplasm autoantibody-associated vasculitis.	Sanders JS, etal., Am J Physiol Renal Physiol. 2007 Dec;293(6):F1927-34. Epub 2007 Sep 26.
297.	Effect of glycosaminoglycans on matrix metalloproteinases in type II collagen-induced experimental arthritis.	Sandya S and Sudhakaran PR, Exp Biol Med (Maywood). 2007 May;232(5):629-37.
298.	[The behavior of intra-leukocyte peroxidase after irradiation with radar microwaves in intra-articular exudates].	Santolini BM, etal., Minerva Ortop. 1971 Dec;22(12):459-62.
299.	Tissue remodeling in the acute otitis media mouse model.	Sautter NB, etal., Int J Pediatr Otorhinolaryngol. 2011 Nov;75(11):1368-71. doi: 10.1016/j.ijporl.2011.07.026. Epub 2011 Sep 1.
300.	Differential regulation of glomerular gelatinase B (MMP-9) and tissue inhibitor of metalloproteinase-1 (TIMP-1) in obese Zucker rats.	Schaefer L, etal., Diabetologia. 1997 Sep;40(9):1035-43.
301.	Gelatinase expression and proteolytic activity in giant-cell arteritis.	Segarra M, etal., Ann Rheum Dis. 2007 Nov;66(11):1429-35. Epub 2007 May 14.
302.	Preferential expression of matrix metalloproteinase-9 in mouse skin after sulfur mustard exposure.	Shakarjian MP, etal., J Appl Toxicol. 2006 May-Jun;26(3):239-46.
303.	High MMP-9 activity characterises pleural tuberculosis correlating with granuloma formation.	Sheen P, etal., Eur Respir J. 2009 Jan;33(1):134-41. Epub 2008 Aug 20.
304.	[Atorvastatin upregulates the expression of PPAR alpha/gamma and inhibits the hypertrophy of cardiac myocytes in vitro]	Sheng L, etal., Zhonghua Xin Xue Guan Bing Za Zhi. 2005 Dec;33(12):1080-4.
305.	Matrix metalloproteinase-9 is associated with blood-brain barrier opening and brain edema formation after cortical contusion in rats.	Shigemori Y, etal., Acta Neurochir Suppl. 2006;96:130-3.
306.	Down-regulation of matrix metalloproteinase-9 expression by nitric oxide in lipopolysaccharide-stimulated rat primary astrocytes.	Shin CY, etal., Nitric Oxide. 2007 Jun;16(4):425-32. Epub 2007 Mar 24.
307.	Nonasthmatic nasal polyposis patients with allergy exhibit greater epithelial MMP positivity.	Shin HW, etal., Otolaryngol Head Neck Surg. 2009 Oct;141(4):442-7.
308.	Heregulin, cysteine rich-61 and matrix metalloproteinase 9 expression in human carotid atherosclerotic plaques: relationship with clinical data.	Sigala F, etal., Eur J Vasc Endovasc Surg. 2006 Sep;32(3):238-45. doi: 10.1016/j.ejvs.2006.01.026. Epub 2006 Jun 13.
309.	Immunohistochemical expression of vascular endothelial growth factor, matrix metalloproteinase 2, and matrix metalloproteinase 9 in cutaneous melanocytic lesions.	Simonetti O, etal., Cancer. 2002 Nov 1;95(9):1963-70.
310.	The interplay of collagen IV, tumor necrosis factor-alpha, gelatinase B (matrix metalloprotease-9), and tissue inhibitor of metalloproteases-1 in the basal lamina regulates Sertoli cell-tight junction dynamics in the rat testis.	Siu MK, etal., Endocrinology 2003 Jan;144(1):371-87.
311.	Morin regulates the expression of NF-kappaB-p65, COX-2 and matrix metalloproteinases in diethylnitrosamine induced rat hepatocellular carcinoma.	Sivaramakrishnan V and Niranjali Devaraj S, Chem Biol Interact. 2009 Aug 14;180(3):353-9. Epub 2009 Feb 21.
312.	Analysis of matrix metalloproteinase-9 gene polymorphism -1562 C/T in patients suffering from systemic sclerosis with and without ulcers.	Skarmoutsou E, etal., Int J Mol Med. 2011 Jun;27(6):873-7. doi: 10.3892/ijmm.2011.661. Epub 2011 Mar 31.
313.	Matrix metalloproteinase 2 is associated with stable and matrix metalloproteinases 8 and 9 with vulnerable carotid atherosclerotic lesions: a study in human endarterectomy specimen pointing to a role for different extracellular matrix metalloproteinase inducer glycosylation forms.	Sluijter JP, etal., Stroke. 2006 Jan;37(1):235-9. Epub 2005 Dec 8.
314.	Inhibition of matrix metalloproteinase-9 with doxycycline reduces pancreatitis-associated lung injury.	Sochor M, etal., Digestion. 2009;80(2):65-73. Epub 2009 Jun 3.
315.	[Expression of gelatinases A and B and their endogenous regulators in immortal and transformed fibroblasts].	Solov'eva NI, etal., Biomed Khim. 2009 Jul-Aug;55(4):441-50.
316.	[MMP-9 gene -1562C/T polymorphism in aortic dissection in Chinese hypertensive patients]	Song WH, etal., Zhonghua Nei Ke Za Zhi. 2006 May;45(5):376-8.
317.	Elevated levels of 92-kd type IV collagenase (matrix metalloproteinase 9) in giant cell arteritis.	Sorbi D, etal., Arthritis Rheum. 1996 Oct;39(10):1747-53.
318.	L-arginine attenuates acute pulmonary embolism-induced increases in lung matrix metalloproteinase-2 and matrix metalloproteinase-9.	Souza-Costa DC, etal., Chest. 2005 Nov;128(5):3705-10.
319.	Protective effects of atorvastatin in rat models of acute pulmonary embolism: involvement of matrix metalloproteinase-9.	Souza-Costa DC, etal., Crit Care Med. 2007 Jan;35(1):239-45.
320.	Urine vascular biomarkers in Sturge-Weber syndrome.	Sreenivasan AK, etal., Vasc Med. 2013 Jun;18(3):122-8. doi: 10.1177/1358863X13486312.
321.	[mRNA expression analysis of metastatic markers in clear-cell renal cell carcinoma]	Struckmann K, etal., Verh Dtsch Ges Pathol. 2005;89:178-83.
322.	Lumbrokinase attenuates diabetic nephropathy through regulating extracellular matrix degradation in Streptozotocin-induced diabetic rats.	Sun H, etal., Diabetes Res Clin Pract. 2013 Apr;100(1):85-95. doi: 10.1016/j.diabres.2013.01.012. Epub 2013 Feb 4.
323.	Peripheral thermal injury causes blood-brain barrier dysfunction and matrix metalloproteinase (MMP) expression in rat.	Swann K, etal., Brain Res. 2007 Jan 19;1129(1):26-33. Epub 2006 Dec 6.
324.	Matrix metalloproteinase-9 undergoes expression and activation during dendritic remodeling in adult hippocampus.	Szklarczyk A, etal., J Neurosci 2002 Feb 1;22(3):920-30.
325.	Serum levels of matrix metalloproteinases 2 and 9 and TGFBR2 gene screening in patients with ascending aortic dilatation.	Símová J, etal., Folia Biol (Praha). 2013;59(4):154-61.
326.	Matrix metalloproteinase-9 activity increased by two different types of epileptic seizures that do not induce neuronal death: a possible role in homeostatic synaptic plasticity.	Takacs E, etal., Neurochem Int. 2010 May-Jun;56(6-7):799-809. doi: 10.1016/j.neuint.2010.03.003. Epub 2010 Mar 18.
327.	Modulation of matrix metalloproteinase-9 in hepatic stellate cells by three-dimensional type I collagen: its activation and signaling pathway.	Takahara T, etal., Hepatol Res. 2003 Aug;26(4):318-326.
328.	Age-related changes in the expression of gelatinase and tissue inhibitor of metalloproteinase genes in mandibular condylar, growth plate, and articular cartilage in rats.	Takahashi I, etal., J Mol Histol. 2005 Jun;36(5):355-66. Epub 2005 Oct 6.
329.	Production of inflammatory mediators by monocytes in patients with obstructive sleep apnea syndrome.	Tamaki S, etal., Intern Med. 2009;48(15):1255-62. Epub 2009 Aug 3.
330.	Regulated expression of matrix metalloproteinases and TIMP in nephrogenesis.	Tanney DC, etal., Dev Dyn. 1998 Sep;213(1):121-9.
331.	Temporal changes in matrix metalloproteinase expression and inflammatory response associated with cardiac rupture after myocardial infarction in mice.	Tao ZY, etal., Life Sci. 2004 Feb 6;74(12):1561-72.
332.	Role for matrix metalloproteinase 9 in granuloma formation during pulmonary Mycobacterium tuberculosis infection.	Taylor JL, etal., Infect Immun. 2006 Nov;74(11):6135-44. Epub 2006 Sep 18.
333.	MMP profile in paired serum and synovial fluid samples of patients with rheumatoid arthritis.	Tchetverikov I, etal., Ann Rheum Dis. 2004 Jul;63(7):881-3.
334.	Matrix metalloproteinase-9 as new biomarkers of severity in multiple organ dysfunction syndrome caused by trauma and infection.	Teng L, etal., Mol Cell Biochem. 2012 Jan;360(1-2):271-7. doi: 10.1007/s11010-011-1066-0. Epub 2011 Oct 1.
335.	Cerebrospinal fluid matrix metalloproteinases are elevated in cerebral adrenoleukodystrophy and correlate with MRI severity and neurologic dysfunction.	Thibert KA, etal., PLoS One. 2012;7(11):e50430. doi: 10.1371/journal.pone.0050430. Epub 2012 Nov 21.
336.	Liver-specific overexpression of matrix metalloproteinase 9 (MMP-9) in transgenic mice accelerates development of hepatocellular carcinoma.	Thieringer FR, etal., Mol Carcinog. 2012 Jun;51(6):439-48. doi: 10.1002/mc.20809. Epub 2011 Jun 16.
337.	Proteomic analysis identifies MMP-9, DJ-1 and A1BG as overexpressed proteins in pancreatic juice from pancreatic ductal adenocarcinoma patients.	Tian M, etal., BMC Cancer. 2008 Aug 16;8:241.
338.	IGF-II and MMP9 as surgical repair indicators of ventricular septal defects.	Tsai CY, etal., Clin Chim Acta. 2011 Apr 11;412(9-10):761-5. doi: 10.1016/j.cca.2011.01.005. Epub 2011 Jan 14.
339.	Tissue plasminogen activator promotes matrix metalloproteinase-9 upregulation after focal cerebral ischemia.	Tsuji K, etal., Stroke. 2005 Sep;36(9):1954-9. Epub 2005 Jul 28.
340.	Tetrahydrocurcumin ameliorates homocysteinylated cytochrome-c mediated autophagy in hyperhomocysteinemia mice after cerebral ischemia.	Tyagi N, etal., J Mol Neurosci. 2012 May;47(1):128-38. doi: 10.1007/s12031-011-9695-z. Epub 2012 Jan 3.
341.	Activation of signaling molecules and matrix metalloproteinases in right ventricular myocardium of rats with pulmonary hypertension.	Umar S, etal., Pathol Res Pract. 2007;203(12):863-72. Epub 2007 Oct 29.
342.	Decrease in serum matrix metalloproteinase-9 and matrix metalloproteinase-3 levels in Zucker fa/fa obese rats after treatment with swertiamarin.	Vaidya H, etal., Exp Clin Cardiol. 2012 Spring;17(1):12-6.
343.	Angiostatic properties of sulindac and celecoxib in the experimentally induced inflammatory colorectal cancer.	Vaish V, etal., Cell Biochem Biophys. 2013 Jun;66(2):205-27. doi: 10.1007/s12013-012-9469-4.
344.	Evaluation of molecular markers in a rat model of mammary carcinogenesis.	Vinothini G, etal., Oncol Res. 2009;17(10):483-93.
345.	Increased expression of matrix metalloproteinases in the murine zymosan-induced multiple organ dysfunction syndrome.	Volman TJ, etal., J Pathol. 2004 Aug;203(4):968-75.
346.	Matrix metalloproteinases and their inhibitors in different acute stroke subtypes.	Vukasovic I, etal., Clin Chem Lab Med. 2006;44(4):428-34.
347.	Prevention of ischemia/reperfusion-induced accumulation of matrix metalloproteinases in rat lung by preconditioning with nitric oxide.	Waldow T, etal., J Surg Res. 2009 Apr;152(2):198-208. Epub 2008 Apr 9.
348.	Effect of Liuweibuqi capsule, a Chinese patent medicine, on the JAK1/STAT3 pathway and MMP9/TIMP1 in a chronic obstructive pulmonary disease rat model.	Wang C, etal., J Tradit Chin Med. 2015 Feb;35(1):54-62.
349.	[Detection of the activity of MMP2 and MMP9 in middle ear cholesteatoma].	Wang H, etal., Lin Chuang Er Bi Yan Hou Ke Za Zhi. 2004 Oct;18(10):620-2.
350.	Oxidized low-density lipoprotein-induced matrix metalloproteinase-9 expression via PKC-delta/p42/p44 MAPK/Elk-1 cascade in brain astrocytes.	Wang HH, etal., Neurotox Res. 2010 Jan;17(1):50-65. Epub 2009 Jun 25.
351.	The association of single nucleotide polymorphisms in the MMP-9 genes with susceptibility to acute primary angle closure glaucoma in Taiwanese patients.	Wang IJ, etal., Mol Vis. 2006 Oct 26;12:1223-32.
352.	[Expression of matrix metalloproteinase-2,9 in cholesteatoma from different positions].	Wang J and Yu LS, Zhonghua Er Bi Yan Hou Tou Jing Wai Ke Za Zhi. 2009 Jan;44(1):44-8.
353.	Bone marrow mesenchymal stem cell transplantation combined with perindopril treatment attenuates infarction remodelling in a rat model of acute myocardial infarction.	Wang JA, etal., J Zhejiang Univ Sci B. 2006 Aug;7(8):641-7.
354.	Matrix metalloproteinase deficiencies affect contact hypersensitivity: stromelysin-1 deficiency prevents the response and gelatinase B deficiency prolongs the response.	Wang M, etal., Proc Natl Acad Sci U S A. 1999 Jun 8;96(12):6885-9.
355.	Mechanisms of matrix metalloproteinase-9 upregulation and tissue destruction in various organs in influenza A virus infection.	Wang S, etal., J Med Invest. 2010 Feb;57(1-2):26-34.
356.	KLF8 promotes human breast cancer cell invasion and metastasis by transcriptional activation of MMP9.	Wang X, etal., Oncogene. 2011 Apr 21;30(16):1901-11. doi: 10.1038/onc.2010.563. Epub 2010 Dec 13.
357.	Extracellular proteolysis by matrix metalloproteinase-9 drives dendritic spine enlargement and long-term potentiation coordinately.	Wang XB, etal., Proc Natl Acad Sci U S A. 2008 Dec 9;105(49):19520-5. doi: 10.1073/pnas.0807248105. Epub 2008 Dec 1.
358.	Idazoxan reduces blood-brain barrier damage during experimental autoimmune encephalomyelitis in mouse.	Wang XS, etal., Eur J Pharmacol. 2014 Aug 5;736:70-6. doi: 10.1016/j.ejphar.2014.04.034. Epub 2014 May 2.
359.	[Effects of xinfeng capsule on myocardial fibrosis in adjuvant arthritis rats and its mechanism research].	Wang Y, etal., Zhongguo Zhong Xi Yi Jie He Za Zhi. 2013 May;33(5):668-73.
360.	The role of oxidative stress and inflammation in conjunctivochalasis.	Ward SK, etal., Invest Ophthalmol Vis Sci. 2010 Apr;51(4):1994-2002. doi: 10.1167/iovs.09-4130. Epub 2009 Dec 17.
361.	Expression of matrix metalloproteinases and their inhibitor TIMP-1 in the rat carotid artery after balloon injury.	Webb KE, etal., Arterioscler Thromb Vasc Biol. 1997 Sep;17(9):1837-44.
362.	Important role of matrix metalloproteinase 9 in epileptogenesis.	Wilczynski GM, etal., J Cell Biol. 2008 Mar 10;180(5):1021-35. doi: 10.1083/jcb.200708213.
363.	Matrix metalloproteinase-8 and -9 are increased at the site of abdominal aortic aneurysm rupture.	Wilson WR, etal., Circulation. 2006 Jan 24;113(3):438-45.
364.	Time course of upregulation of inflammatory mediators in the hemorrhagic brain in rats: correlation with brain edema.	Wu H, etal., Neurochem Int. 2010 Oct;57(3):248-53. Epub 2010 Jun 10.
365.	The expression of CD40-CD40L and activities of matrix metalloproteinases in atherosclerotic rats.	Wu M and Li YG, Mol Cell Biochem. 2006 Jan;282(1-2):141-6.
366.	Cariporide, a specific Na/H(+) exchanger 1 blocker, inhibits neointimal proliferation induced by advanced glycation end products in a balloon injury rat model.	Wu S, etal., Pharmacology. 2013;91(3-4):123-30. doi: 10.1159/000346128. Epub 2013 Jan 23.
367.	Reducing scar formation by regulation of IL-1 and MMP-9 expression by using sustained release of prednisolone-loaded PDLL microspheres in a murine wound model.	Wu TH, etal., J Biomed Mater Res A. 2013 Apr;101(4):1165-72. doi: 10.1002/jbm.a.34413. Epub 2012 Oct 18.
368.	[Effects of ru'ai shuhou recipe on the matrix metalloproteinases and the inhibitive factors in the recurrence and metastasis of HER2 positive breast cancer].	Wu XQ, etal., Zhongguo Zhong Xi Yi Jie He Za Zhi. 2012 Nov;32(11):1526-30.
369.	Prognostic significance of MMP-9 and TIMP-1 serum and tissue expression in breast cancer.	Wu ZS, etal., Int J Cancer. 2008 May 1;122(9):2050-6.
370.	Doxycycline delays aneurysm rupture in a mouse model of Marfan syndrome.	Xiong W, etal., J Vasc Surg. 2008 Jan;47(1):166-72; discussion 172. doi: 10.1016/j.jvs.2007.09.016.
371.	[Zhonghua yan ke za zhi] Chinese journal of ophthalmology	Xu SL, etal., Zhonghua Yan Ke Za Zhi. 2009 Mar;45(3):260-5.
372.	Combination of thrombin and matrix metalloproteinase-9 exacerbates neurotoxicity in cell culture and intracerebral hemorrhage in mice.	Xue M, etal., J Neurosci. 2006 Oct 4;26(40):10281-91.
373.	Sendai virus infection up-regulates trypsin I and matrix metalloproteinase-9, triggering viral multiplication and matrix degradation in rat lungs and lung L2 cells.	Yamada H, etal., Arch Virol. 2006 Dec;151(12):2529-37. Epub 2006 Jun 30.
374.	Low-energy laser irradiation facilitates the velocity of tooth movement and the expressions of matrix metalloproteinase-9, cathepsin K, and alpha(v) beta(3) integrin in rats.	Yamaguchi M, etal., Eur J Orthod. 2010 Apr;32(2):131-9. Epub 2010 Feb 16.
375.	Plasma matrix metalloproteinase-9 level is correlated with left ventricular volumes and ejection fraction in patients with heart failure.	Yan AT, etal., J Card Fail. 2006 Sep;12(7):514-9.
376.	Intracranial aneurysm formation in type-one diabetes rats.	Yan T, etal., PLoS One. 2013 Jul 2;8(7):e67949. doi: 10.1371/journal.pone.0067949. Print 2013.
377.	Adventitial transduction of lentivirus-shRNA-VEGF-A in arteriovenous fistula reduces venous stenosis formation.	Yang B, etal., Kidney Int. 2014 Feb;85(2):289-306. doi: 10.1038/ki.2013.290. Epub 2013 Aug 7.
378.	Imbalance of matrix metalloproteinases/tissue inhibitor of metalloproteinase-1 and loss of fibronectin expression in patients with congestive heart failure.	Yang DC, etal., Cardiology. 2010;116(2):133-41. doi: 10.1159/000317245. Epub 2010 Jul 1.
379.	Increased expression of gelatinase (MMP-2 and MMP-9) in pterygia and pterygium fibroblasts with disease progression and activation of protein kinase C.	Yang SF, etal., Invest Ophthalmol Vis Sci. 2009 Oct;50(10):4588-96. doi: 10.1167/iovs.08-3147. Epub 2009 May 6.
380.	Simvastatin attenuates pulmonary vascular remodelling by down-regulating matrix metalloproteinase-1 and -9 expression in a carotid artery-jugular vein shunt pulmonary hypertension model in rats.	Yao J, etal., Eur J Cardiothorac Surg. 2012 Nov;42(5):e121-7. doi: 10.1093/ejcts/ezs445.
381.	Role of c-Jun N-terminal kinase in early brain injury after subarachnoid hemorrhage.	Yatsushige H, etal., J Neurosci Res. 2007 May 15;85(7):1436-48.
382.	Transcriptomic dissection of tongue squamous cell carcinoma.	Ye H, etal., BMC Genomics. 2008 Feb 6;9:69. doi: 10.1186/1471-2164-9-69.
383.	Atorvastatin attenuating down-regulation of peroxisome proliferator-activated receptor gamma in preventing cardiac hypertrophy of rats in vitro and in vivo.	Ye P, etal., J Pharm Pharm Sci. 2006;9(3):365-75.
384.	Silencing of FGFR4 could influence the biological features of gastric cancer cells and its therapeutic value in gastric cancer.	Ye Y, etal., Tumour Biol. 2016 Mar;37(3):3185-95. doi: 10.1007/s13277-015-4100-0. Epub 2015 Oct 2.
385.	Matrix metalloprotease expressions in both reperfusion lung injury and oleic acid lung injury models and the protective effects of ilomastat.	Yeh DY, etal., Transplant Proc. 2009 Jun;41(5):1508-11.
386.	Expression of matrix metalloproteinase 2 and 9 and tissue inhibitor of metalloproteinase 1 in nonrecurrent vs recurrent nasal polyps.	Yeo NK, etal., Ann Allergy Asthma Immunol. 2013 Sep;111(3):205-10. doi: 10.1016/j.anai.2013.06.023. Epub 2013 Jul 16.
387.	Protective role of matrix metalloproteinase-9 in ozone-induced airway inflammation.	Yoon HK, etal., Environ Health Perspect. 2007 Nov;115(11):1557-63.
388.	Aging is associated with increased activities of matrix metalloproteinase-2 and -9 in tenocytes.	Yu TY, etal., BMC Musculoskelet Disord. 2013 Jan 2;14:2. doi: 10.1186/1471-2474-14-2.
389.	Expression of MMP-9 in hepatic sinusoidal obstruction syndrome induced by Gynura segetum.	Yu XZ, etal., J Zhejiang Univ Sci B. 2013 Jan;14(1):68-75. doi: 10.1631/jzus.B1200112.
390.	Retinoids induce MMP-9 expression through RARalpha during mammary gland remodeling.	Zaragoza R, etal., Am J Physiol Endocrinol Metab. 2007 Apr;292(4):E1140-8. Epub 2006 Dec 12.
391.	Serum levels of matrix metalloproteinase 2 and matrix metalloproteinase 9 elevated in polypoidal choroidal vasculopathy but not in age-related macular degeneration.	Zeng R, etal., Mol Vis. 2013;19:729-36. Epub 2013 Mar 21.
392.	NMDA receptor-mediated activation of NADPH oxidase and glomerulosclerosis in hyperhomocysteinemic rats.	Zhang C, etal., Antioxid Redox Signal. 2010 Oct 1;13(7):975-86. doi: 10.1089/ars.2010.3091.
393.	[Expression of trophoblast invasion related genes mRNA and protein in human placenta in preeclampsia].	Zhang H, etal., Zhonghua Fu Chan Ke Za Zhi. 2006 Aug;41(8):509-13.
394.	rAAV2-TGF-beta(3) Decreases Collagen Synthesis and Deposition in the Liver of Experimental Hepatic Fibrosis Rat.	Zhang Y, etal., Dig Dis Sci. 2010 Jan 28.
395.	Expression changes and roles of matrix metalloproteinases in a rat model of traumatic deep vein thrombosis.	Zhang YB, etal., Chin J Traumatol. 2010 Jun 1;13(3):188-92.
396.	Valproic acid ameliorates inflammation in experimental autoimmune encephalomyelitis rats.	Zhang Z, etal., Neuroscience. 2012 Sep 27;221:140-50. doi: 10.1016/j.neuroscience.2012.07.013. Epub 2012 Jul 16.
397.	[Expression and significance of matrix metalloproteinase-1,9, tissue inhibitor of metalloproteinase-4 and extracellular matrix metalloproteinase inducer in the myocardium of congestive heart failure in patients with rheumatic heart diseases].	Zhao Y, etal., Zhong Nan Da Xue Xue Bao Yi Xue Ban. 2009 Aug;34(8):790-5.
398.	Endometase/matrilysin-2 in human breast ductal carcinoma in situ and its inhibition by tissue inhibitors of metalloproteinases-2 and -4: a putative role in the initiation of breast cancer invasion.	Zhao YG, etal., Cancer Res. 2004 Jan 15;64(2):590-8.
399.	Expression of matrix metalloproteinase -2, -9 and tissue inhibitors of metalloproteinase -1, -2, -3 mRNAs in rat uterus during early pregnancy.	Zhao YG, etal., Mol Reprod Dev 2002 Jun;62(2):149-58.
400.	Inhibition of NF-kappaB activation by Pyrrolidine dithiocarbamate partially attenuates hippocampal MMP-9 activation and improves cognitive deficits in streptozotocin-induced diabetic rats.	Zhao Z, etal., Behav Brain Res. 2013 Feb 1;238:44-7. doi: 10.1016/j.bbr.2012.10.018. Epub 2012 Oct 23.
401.	[Modulative effect of zhenqing recipe on expressions of matrix metalloproteinase-9 and tissue inhibitor of matrix metalloproteinase-1 in experimental type 2 diabetic rats]	Zheng LY, etal., Zhongguo Zhong Xi Yi Jie He Za Zhi. 2006 Jun;26 Suppl:72-6.
402.	[Expression and significance of matrix metalloproteinase and tissue inhibitor of metalloproteinase in nasal cavity squamous cell carcinoma].	Zheng Y, etal., Zhonghua Er Bi Yan Hou Tou Jing Wai Ke Za Zhi. 2011 Apr;46(4):299-302.
403.	Regulation of matrix metalloproteinase-9 by epigenetic modifications and the development of diabetic retinopathy.	Zhong Q and Kowluru RA, Diabetes. 2013 Jul;62(7):2559-68. doi: 10.2337/db12-1141. Epub 2013 Feb 19.
404.	Inhibitory effects of alkaline extract of Citrus reticulata on pulmonary fibrosis.	Zhou XM, etal., J Ethnopharmacol. 2013 Mar 7;146(1):372-8. doi: 10.1016/j.jep.2013.01.006. Epub 2013 Jan 11.
405.	Favorable effects of MMP-9 knockdown in murine herpes simplex encephalitis using small interfering RNA.	Zhou Y, etal., Neurol Res. 2010 Oct;32(8):801-9. doi: 10.1179/016164110X12644252260556. Epub 2010 May 18.
406.	Erythromycin ameliorates cigarette-smoke-induced emphysema and inflammation in rats.	Zhou Y, etal., Transl Res. 2012 Jun;159(6):464-72. doi: 10.1016/j.trsl.2011.09.007. Epub 2011 Oct 24.

Additional References at PubMed

PMID:2551898	PMID:7590350	PMID:8605986	PMID:9256427	PMID:9291580	PMID:9789069	PMID:11860503	PMID:12062105	PMID:12172377	PMID:12183632	PMID:12419962	PMID:12717622
PMID:12832476	PMID:14523003	PMID:14575305	PMID:14643899	PMID:14663338	PMID:14707083	PMID:14732351	PMID:15051632	PMID:15111317	PMID:15146242	PMID:15211589	PMID:15240011
PMID:15269222	PMID:15480897	PMID:15615723	PMID:15621209	PMID:15800063	PMID:15802562	PMID:15851690	PMID:15863497	PMID:15990452	PMID:16097048	PMID:16192646	PMID:16303771
PMID:16478919	PMID:16481424	PMID:16488444	PMID:16721810	PMID:16738242	PMID:16762003	PMID:16877562	PMID:16919608	PMID:17053025	PMID:17116693	PMID:17143608	PMID:17188498
PMID:17189680	PMID:17202418	PMID:17334234	PMID:17428795	PMID:17456343	PMID:17496904	PMID:17574586	PMID:17607299	PMID:17704059	PMID:17909100	PMID:17937912	PMID:17986262
PMID:17987394	PMID:17996850	PMID:18000599	PMID:18031717	PMID:18052689	PMID:18073506	PMID:18077379	PMID:18247145	PMID:18264108	PMID:18292396	PMID:18320202	PMID:18352832
PMID:18390195	PMID:18401426	PMID:18502312	PMID:18556655	PMID:18664349	PMID:18667463	PMID:18675881	PMID:18678246	PMID:18713734	PMID:18769934	PMID:18799129	PMID:18830828
PMID:18935914	PMID:18940814	PMID:18974601	PMID:18976709	PMID:18993041	PMID:19022250	PMID:19037103	PMID:19052882	PMID:19085380	PMID:19085832	PMID:19132994	PMID:19148693
PMID:19167969	PMID:19184368	PMID:19201691	PMID:19229995	PMID:19235898	PMID:19259351	PMID:19272421	PMID:19299917	PMID:19330523	PMID:19404732	PMID:19462901	PMID:19464272
PMID:19478225	PMID:19497125	PMID:19524937	PMID:19537852	PMID:19551335	PMID:19570337	PMID:19607919	PMID:19685505	PMID:19703360	PMID:19734212	PMID:19838811	PMID:19847888
PMID:19885954	PMID:19917734	PMID:20026244	PMID:20033829	PMID:20043284	PMID:20059586	PMID:20079284	PMID:20213142	PMID:20233042	PMID:20388475	PMID:20617879	PMID:20666994
PMID:20698853	PMID:20854798	PMID:20923679	PMID:21039990	PMID:21055280	PMID:21092323	PMID:21114027	PMID:21134288	PMID:21141568	PMID:21186625	PMID:21220710	PMID:21308405
PMID:21319376	PMID:21354273	PMID:21374976	PMID:21426744	PMID:21460212	PMID:21468558	PMID:21486558	PMID:21624254	PMID:21660948	PMID:21703213	PMID:21752621	PMID:21814480
PMID:21884701	PMID:21896646	PMID:21941784	PMID:21952436	PMID:22071631	PMID:22092673	PMID:22098918	PMID:22105553	PMID:22135757	PMID:22182603	PMID:22191573	PMID:22207560
PMID:22218048	PMID:22351756	PMID:22357420	PMID:22371905	PMID:22419075	PMID:22429194	PMID:22433789	PMID:22449799	PMID:22479334	PMID:22496348	PMID:22507553	PMID:22511009
PMID:22526758	PMID:22528459	PMID:22643046	PMID:22773570	PMID:22820569	PMID:22826328	PMID:22872320	PMID:22897943	PMID:22900357	PMID:22984561	PMID:23077039	PMID:23088810
PMID:23099153	PMID:23154389	PMID:23171679	PMID:23179310	PMID:23270462	PMID:23275087	PMID:23307413	PMID:23351884	PMID:23376485	PMID:23473787	PMID:23508111	PMID:23526543
PMID:23533145	PMID:23585120	PMID:23601700	PMID:23619615	PMID:23646930	PMID:23708107	PMID:23800500	PMID:23819982	PMID:23845380	PMID:23867621	PMID:23886643	PMID:23891690
PMID:23933360	PMID:23981230	PMID:23988659	PMID:24018979	PMID:24060804	PMID:24114974	PMID:24116115	PMID:24131725	PMID:24160412	PMID:24164424	PMID:24236012	PMID:24342130
PMID:24379181	PMID:24380732	PMID:24395134	PMID:24454919	PMID:24503540	PMID:24560960	PMID:24704305	PMID:24704473	PMID:24722316	PMID:24815146	PMID:24935409	PMID:25004875
PMID:25013773	PMID:25028660	PMID:25063292	PMID:25086360	PMID:25159478	PMID:25232752	PMID:25261791	PMID:25326689	PMID:25343559	PMID:25380300	PMID:25529509	PMID:25537973
PMID:25595645	PMID:25627354	PMID:25645918	PMID:25652432	PMID:25867313	PMID:25897215	PMID:25947163	PMID:25960249	PMID:25961845	PMID:26232046	PMID:26258010	PMID:26264698
PMID:26318311	PMID:26333546	PMID:26363453	PMID:26481104	PMID:26514923	PMID:26547079	PMID:26567576	PMID:26601648	PMID:26617754	PMID:26680767	PMID:26733721	PMID:26800984
PMID:26852688	PMID:26919547	PMID:26924185	PMID:27035767	PMID:27068509	PMID:27154762	PMID:27320964	PMID:27322513	PMID:27323108	PMID:27363270	PMID:27425890	PMID:27633189
PMID:27666960	PMID:27760767	PMID:27826738	PMID:27893855	PMID:27902934	PMID:27937032	PMID:28157489	PMID:28199982	PMID:28257481	PMID:28259914	PMID:28260878	PMID:28280358
PMID:28392358	PMID:28488074	PMID:28501723	PMID:28506758	PMID:28645189	PMID:28805677	PMID:28912068	PMID:28912710	PMID:29210076	PMID:29262413	PMID:29277445	PMID:29604590
PMID:30410547	PMID:30627903	PMID:30691844	PMID:30769782	PMID:31054885	PMID:31061278	PMID:31075261	PMID:31099017	PMID:31200003	PMID:31208343	PMID:31349015	PMID:31493243
PMID:31680487	PMID:31734396	PMID:31746394	PMID:31797986	PMID:31834839	PMID:32016994	PMID:32159248	PMID:32303987	PMID:32328952	PMID:32450187	PMID:32633388	PMID:32682824
PMID:32692220	PMID:32881898	PMID:32990013	PMID:33023122	PMID:33162790	PMID:33220187	PMID:33228717	PMID:33468174	PMID:33571214	PMID:33611790	PMID:33636289	PMID:34063987
PMID:34160889	PMID:34610044	PMID:34630739	PMID:34919217	PMID:35196503	PMID:35216236	PMID:35306046	PMID:36193497	PMID:36281728	PMID:36322784	PMID:36438504	PMID:36925202
PMID:37356787	PMID:37423509	PMID:37433223	PMID:37700592	PMID:38043722	PMID:38321559

Genomics

Comparative Map Data

Mmp9
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	174,103,474 - 174,111,434 (+)	NCBI		GRCr8
mRatBN7.2	3	153,684,158 - 153,692,118 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	153,683,858 - 153,692,120 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	157,492,813 - 157,500,796 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	165,991,783 - 165,999,766 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	163,735,564 - 163,743,543 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	161,413,410 - 161,421,473 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	161,413,298 - 161,421,520 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	167,578,904 - 167,605,890 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	155,985,473 - 155,993,433 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	155,891,508 - 155,899,467 (+)	NCBI
Celera	3	152,289,466 - 152,297,426 (+)	NCBI		Celera
Cytogenetic Map	3	q42	NCBI

MMP9
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	20	46,008,908 - 46,016,561 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	20	46,008,908 - 46,016,561 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	20	44,637,547 - 44,645,200 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	20	44,070,954 - 44,078,607 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	20	44,070,953 - 44,078,606	NCBI
Celera	20	41,348,998 - 41,356,660 (+)	NCBI		Celera
Cytogenetic Map	20	q13.12	NCBI
HuRef	20	41,378,970 - 41,386,505 (+)	NCBI		HuRef
CHM1_1	20	44,540,180 - 44,547,844 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	20	47,744,921 - 47,752,589 (+)	NCBI		T2T-CHM13v2.0

Mmp9
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	164,782,246 - 164,797,770 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	164,782,700 - 164,797,770 (+)	Ensembl		GRCm39 Ensembl
GRCm38	2	164,940,326 - 164,955,850 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	164,940,780 - 164,955,850 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	164,773,751 - 164,781,346 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	164,639,456 - 164,647,051 (+)	NCBI		MGSCv36	mm8
Celera	2	170,885,579 - 170,893,176 (+)	NCBI		Celera
Cytogenetic Map	2	H3	NCBI
cM Map	2	85.27	NCBI

Mmp9
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955445	11,295,448 - 11,303,288 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955445	11,295,500 - 11,303,322 (-)	NCBI	ChiLan1.0	ChiLan1.0

MMP9
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	21	51,748,843 - 51,757,462 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	20	51,741,951 - 51,749,613 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	20	42,346,305 - 42,354,018 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	20	43,432,389 - 43,440,129 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	20	43,432,389 - 43,440,129 (+)	Ensembl	panpan1.1		panPan2

MMP9
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	24	33,274,260 - 33,281,116 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	24	33,274,268 - 33,281,293 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	24	32,801,110 - 32,807,958 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	24	33,984,592 - 33,991,450 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	24	33,984,589 - 33,991,650 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	24	33,242,837 - 33,249,697 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	24	33,358,136 - 33,364,990 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	24	33,897,331 - 33,904,192 (+)	NCBI		UU_Cfam_GSD_1.0

Mmp9
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	191,584,597 - 191,592,230 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936514	7,037,639 - 7,045,793 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936514	7,038,240 - 7,045,873 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

MMP9
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	17	48,179,671 - 48,186,788 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	17	48,179,690 - 48,186,782 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	17	53,819,971 - 53,827,064 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

MMP9
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	2	17,867,267 - 17,874,757 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	2	17,867,177 - 17,874,712 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666050	66,502,195 - 66,509,744 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Mmp9
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624790	8,583,457 - 8,591,713 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624790	8,584,399 - 8,591,763 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Mmp9
19 total Variants

miRNA Target Status

Confirmed Target Of

miRNA Gene	Mature miRNA	Method Name	Result Type	Data Type	Support Type	PMID
Mir125a	rno-miR-125a-5p	Mirtarbase	external_info	Microarray	Functional MTI (Weak)	18258830
Mir664-2	rno-miR-664-3p	Mirtarbase	external_info	Microarray	Functional MTI (Weak)	18258830
Mir132	rno-miR-132-3p	Mirtarbase	external_info	Microarray	Functional MTI (Weak)	18258830

Predicted Target Of

	Summary Value
Count of predictions:	103
Count of miRNA genes:	81
Interacting mature miRNAs:	93
Transcripts:	ENSRNOT00000023965
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	31172320	163586636	Rat
2301970	Bw81	Body weight QTL 81	5.19		body mass (VT:0001259)	body weight (CMO:0000012)	3	41874578	155617519	Rat
2301971	Cm71	Cardiac mass QTL 71	4.63		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	3	41874578	155617519	Rat
1559282	Emca5	Estrogen-induced mammary cancer QTL 5	3.9		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	3	43827364	169034231	Rat
1581568	Rf53	Renal function QTL 53			urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	3	56395968	161299569	Rat
8662816	Vetf4	Vascular elastic tissue fragility QTL 4	4		renal artery integrity trait (VT:0010642)	number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563)	3	59242096	157323038	Rat
631841	Niddm39	Non-insulin dependent diabetes mellitus QTL 39	3.36		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	94856903	159898684	Rat
2312659	Slep7	Serum leptin concentration QTL 7		0.001	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	3	98535255	168026850	Rat
2312670	Bw94	Body weight QTL 94		0.01	inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	3	98535255	168026850	Rat
2312673	Scl63	Serum cholesterol level QTL 63		0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	3	98535255	168026850	Rat
2302373	Gluco39	Glucose level QTL 39	5.01		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	3	98535386	161695835	Rat
1578754	Stresp16	Stress response QTL 16	4	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	3	112681431	157681431	Rat
1576306	Schws3	Schwannoma susceptibility QTL 3		0.001	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	3	118839124	163839124	Rat
1598877	Bp285	Blood pressure QTL 285	1.5	0.03	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	120538241	165538241	Rat
1300159	Kidm4	Kidney mass QTL 4	3.83		kidney mass (VT:0002707)	right kidney wet weight to body weight ratio (CMO:0001953)	3	121056165	157309487	Rat
10755461	Coatc16	Coat color QTL 16			coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	3	122438700	167438700	Rat
631541	Bp81	Blood pressure QTL 81	4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	124122556	169034231	Rat
2303620	Vencon4	Ventilatory control QTL 4	3.9		respiration trait (VT:0001943)	tidal volume (CMO:0000222)	3	127162703	168026850	Rat
631673	Iddm13	Insulin dependent diabetes mellitus QTL 13	1.3	0.663	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	3	130193298	161695983	Rat
1578656	Vnigr2	Vascular neointimal growth QTL 2	4.2		artery morphology trait (VT:0002191)	lesioned artery residual lumen area (CMO:0001417)	3	130656562	169034231	Rat
1578653	Vnigr3	Vascular neointimal growth QTL 3	3.1		artery morphology trait (VT:0002191)	artery neointimal hyperplastic lesion area (CMO:0001414)	3	130656562	169034231	Rat
9589106	Insul23	Insulin level QTL 23	13.86	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	3	131635904	169034231	Rat
2298477	Eau4	Experimental allergic uveoretinitis QTL 4		0.0011	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	3	137398739	169034231	Rat
8552952	Pigfal13	Plasma insulin-like growth factor 1 level QTL 13			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	3	138799500	169034231	Rat
1298068	Bp167	Blood pressure QTL 167		0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	141074471	169034231	Rat
1331726	Bp208	Blood pressure QTL 208	3.129		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	141339013	162184794	Rat
61335	Bp20	Blood pressure QTL 20	3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	141339236	155617360	Rat
2317883	Alcrsp26	Alcohol response QTL 26	1.8	0.63	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	3	145526770	169034231	Rat
12879871	Am7	Aortic mass QTL 7		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	3	145925360	166177555	Rat
12879872	Cm97	Cardiac mass QTL 97		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	145925360	166177555	Rat
12879873	Cm96	Cardiac mass QTL 96		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	3	145925360	166177555	Rat
12879874	Cm98	Cardiac mass QTL 98		0.005	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	3	145925360	166177555	Rat
12879875	Kidm64	Kidney mass QTL 64		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	145925360	166177555	Rat
12879876	Bw182	Body weight QTL 182		0.003	body mass (VT:0001259)	body weight (CMO:0000012)	3	145925360	166177555	Rat
2301411	Bp320	Blood pressure QTL 320		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	145925360	166177555	Rat
1300113	Bp176	Blood pressure QTL 176	3.9		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	145956084	157309487	Rat
1598854	Memor10	Memory QTL 10	2		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	3	145956084	161299569	Rat
8552791	Vie2	Viral induced encephalitis QTL 2	4.1		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	3	145956084	169034231	Rat
1578666	Vnigr1	Vascular neointimal growth QTL 1	4.6		artery morphology trait (VT:0002191)	artery lumen area (CMO:0001409)	3	149040888	168026850	Rat

Markers in Region

D3Wox36

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	153,683,950 - 153,684,056 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	161,413,203 - 161,413,308	NCBI	Rnor6.0
Rnor_5.0	3	167,597,610 - 167,597,715	UniSTS	Rnor5.0
RGSC_v3.4	3	155,985,266 - 155,985,371	UniSTS	RGSC3.4
Celera	3	152,289,259 - 152,289,364	UniSTS
Cytogenetic Map	3	q42	UniSTS

PMC162218P1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	153,691,448 - 153,692,111 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	161,420,804 - 161,421,466	NCBI	Rnor6.0
Rnor_5.0	3	167,605,211 - 167,605,873	UniSTS	Rnor5.0
RGSC_v3.4	3	155,992,764 - 155,993,426	UniSTS	RGSC3.4
Celera	3	152,296,757 - 152,297,419	UniSTS
Cytogenetic Map	3	q42	UniSTS

D17Mit102

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	153,683,940 - 153,684,099 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	161,413,193 - 161,413,351	NCBI	Rnor6.0
Rnor_5.0	3	167,597,600 - 167,597,758	UniSTS	Rnor5.0
RGSC_v3.4	3	155,985,256 - 155,985,414	UniSTS	RGSC3.4
Celera	3	152,289,249 - 152,289,407	UniSTS
Cytogenetic Map	3	q42	UniSTS

D2Dcr116

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	153,683,938 - 153,684,073 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	161,413,191 - 161,413,325	NCBI	Rnor6.0
Rnor_5.0	3	167,597,598 - 167,597,732	UniSTS	Rnor5.0
RGSC_v3.4	3	155,985,254 - 155,985,388	UniSTS	RGSC3.4
Celera	3	152,289,247 - 152,289,381	UniSTS
Cytogenetic Map	3	q42	UniSTS

Mmp9

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	153,685,293 - 153,685,355 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	161,414,546 - 161,414,607	NCBI	Rnor6.0
Rnor_5.0	3	167,598,953 - 167,599,014	UniSTS	Rnor5.0
RGSC_v3.4	3	155,986,609 - 155,986,670	UniSTS	RGSC3.4
Celera	3	152,290,602 - 152,290,663	UniSTS
Cytogenetic Map	3	q42	UniSTS

Genetic Models

This gene Mmp9 is modified in the following models/strains:

SS-Mmp9^em4Mcwi SS-Mmp9^em6Mcwi

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium			3		3					12		1
Low	3	6	29	20	16	20			22	19	24	10
Below cutoff		27	25	21		21	8	9	48	4	16		8

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_031055	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AJ438266	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MW395632	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U24441	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U36476	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000023965 ⟹ ENSRNOP00000023965

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	153,683,858 - 153,692,120 (+)	Ensembl
Rnor_6.0 Ensembl	3	161,413,298 - 161,421,520 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000088776 ⟹ ENSRNOP00000069060

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	153,683,858 - 153,692,120 (+)	Ensembl
Rnor_6.0 Ensembl	3	161,413,410 - 161,420,812 (+)	Ensembl

RefSeq Acc Id:

NM_031055 ⟹ NP_112317

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	174,103,474 - 174,111,434 (+)	NCBI
mRatBN7.2	3	153,684,158 - 153,692,118 (+)	NCBI
Rnor_6.0	3	161,413,410 - 161,421,473 (+)	NCBI
Rnor_5.0	3	167,578,904 - 167,605,890 (+)	NCBI
RGSC_v3.4	3	155,985,473 - 155,993,433 (+)	RGD
Celera	3	152,289,466 - 152,297,426 (+)	RGD

Sequence:

show sequence

ATGAACCCCTGGCAGCCCCTGCTCCTGGTGCTCCTGGCTCTAGGCTACAGCTTTGCTGCCCCTC
ACCAGCGCCAGCCGACTTATGTGGTCTTCCCCCGAGACCTGAAAACCTCCAACCTCACGGACAC
ACAGCTGGCAGAGGATTACCTGTACCGCTATGGTTACACTCGGGCAGCCCAGATGATGGGAGAG
AAGCAGTCCCTGCGGCCCGCTTTGCTGATGCTTCAGAAGCAGCTGTCCCTGCCCCAGACTGGTG
AGCTGGACAGCGAGACACTAAAGGCCATTCGTTCACCGCGCTGTGGTGTCCCAGACGTGGGCAA
ATTCCAAACCTTCGAAGGCGACCTCAAGTGGCACCATCATAACATCACCTATTGGATCCAAAGC
TACACCGAAGACTTGCCGCGAGACGTGATCGATGACTCCTTCGCGCGCGCCTTCGCGGTGTGGA
GCGCGGTGACACCGCTCACCTTCACCCGCGTGTACGGGCTCGAAGCAGACATTGTCATCCAGTT
TGGTGTCGCGGAGCACGGGGACGGGTATCCCTTCGACGGCAAGGATGGTCTACTGGCACACGCC
TTTCCCCCTGGCCCCGGCATTCAGGGAGATGCCCACTTCGACGACGACGAGTTGTGGTCGCTGG
GCAAAGGCGCCGTGGTCCCCACTTACTTTGGAAACGCAAATGGTGCCCCATGTCACTTTCCCTT
CACCTTCGAGGGACGCTCCTATTTGTCCTGCACCACGGATGGCCGCAACGACGGCAAGCCTTGG
TGTGGCACGACAGCTGACTACGACACAGACAGAAAATATGGTTTCTGCCCCAGTGAGAATCTCT
ACACGGAGCATGGCAACGGAGACGGCAAACCCTGCGTATTTCCATTCATCTTCGAGGGCCACTC
CTACTCTGCCTGCACCACTAAAGGTCGCTCGGATGGTTATCGCTGGTGCGCCACCACCGCCAAC
TATGACCAGGATAAGCTGTATGGCTTCTGTCCTACTCGAGCCGACGTCACTGTAACTGGGGGCA
ACTCGGCAGGAGAGATGTGCGTCTTCCCCTTCGTCTTCCTGGGCAAGCAGTACTCTACCTGTAC
CGGCGAGGGCCGCAGTGATGGGCGCCTCTGGTGCGCGACGACGTCGAACTTCGACGCTGACAAG
AAGTGGGGTTTCTGTCCAGACCAAGGGTACAGCCTGTTTCTGGTGGCAGCGCACGAGTTCGGCC
ATGCGCTGGGCTTAGATCATTCTTCAGTGCCGGAAGCGCTCATGTACCCCATGTATCACTACCA
CGAGGACTCCCCTCTGCATGAAGACGACATAAAAGGCATCCAGCATCTGTATGGTCGTGGCTCT
AAACCTGACCCAAGGCCTCCAGCCACCACCGCAGCTGAACCACAGCCGACAGCTCCTCCCACTA
TGTGTCCCACTGCACCTCCCATGGCCTATCCCACAGGGGGCCCCACAGTCGCCCCTACAGGCGC
CCCCTCACCTGGCCCCACAGGTCCCCCTACTGCTGGTCCTTCTGAGGCCCCTACAGAGTCTTCG
ACTCCAGTAGACAATCCTTGCAATGTGGATGTTTTTGATGCCATTGCTGATATCCAGGGCGCTC
TGCATTTCTTCAAGGACGGTCGGTATTGGAAGTTCTCGAATCACGGAGGAAGCCAATTGCAGGG
CCCCTTTCTTATTGCCCGCACGTGGCCAGCTTTGCCTGCAAAGTTGAACTCAGCCTTTGAGGAT
CCGCAGTCCAAGAAGATTTTCTTCTTCTCTGGGCGCAAAATGTGGGTGTACACAGGCCAGACGG
TGCTGGGCCCCAGGAGTCTGGATAAGTTGGGGCTAGGCTCAGAGGTAACCCTGGTCACCGGACT
TCTCCCGCGTCGTGGAGGGAAGGCTCTGCTGATCAGCCGGGAACGTATCTGGAAATTCGACTTG
AAGTCTCAGAAGGTGGATCCCCAGAGCGTTACTCGCTTGGATAACGAGTTCTCTGGCGTGCCCT
GGAACTCACACAACGTCTTTCACTACCAAGACAAGGCCTATTTCTGCCATGACAAATACTTCTG
GCGTGTGAGTTTCCACAACCGGGTGAACCAGGTGGACCACGTGGCCTACGTGACCTATGACCTC
CTGCAGTGCCCTTGAACTAAGGCTCCTCTTTTGCTTCAGCGGTGCAGCGCAAGCCTCTAGAGAC
CACCCCTGAGGGGGAGGAGCTAGTTTGCCGGATACAAACTGGTGATCTCTTCTAGAGACTAGGA
AGGAGTGGAGGCGGGCAGGGCCCTCTCTGCACGCTGTCCTTTCTTGTTGGACTGTTTCTAATAA
ACACGGATCCCCCAACCTTTACCAGCTACTCGAACCAATCAGCTTGTCTGTAGTTGTATACACA
TCCAAGCCTGTGGTTGGTCAGAAGACAACTTTGTAGGGTCGGTTCTGACCTTTTGTTTTTATGG
GGCATCTGGGGATTGAACTCAGCTGGCTTTTGTGACAAGTACTTCACCCGCTGCACCACCTTAC
CGGCCCTTTTATTTATTATGTATGTGGTCATGTTCACACACATGTATTTAACCTATAGAATGCT
TACTGTGCGTCGGGCGCTGCTCCAACTGCTGTATAAATATTAAGGTATTCAGTTACTCCTACTG
GAAGGTATTATGTAACCATTTCTCTCTTACATCGGAGGACACCACCGAGCTATCCACTCATCAA
ACATTTATTGTGAGCATCCCTAGGGAGCCAGGCTCTCTACTGGGCATTAGGGACAGAGGAATTT
ATTGGATGTTGGTTCTTCCTTCAAGAATCGCTCAGGGATTCTCAGTGTCCTCAAAACATGCTGA
AACCGGACCCCAGACTCCACTCTGGAGAATCCAACCCACTCACAGGGGAAACAGCCCGTTTAAA
GTGCATGTGTGCTAGAGAGGTAGGGTAGCCGAGATGATCCCTCAGTGGAAGGATAACCAAGTAT
CTTCCTCGGACACTCTTTTTTAAATAAATGAATAAATGAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_112317	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA90911	(Get FASTA)	NCBI Sequence Viewer
	AAB01721	(Get FASTA)	NCBI Sequence Viewer
	CAD27893	(Get FASTA)	NCBI Sequence Viewer
	EDL96479	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000023965
	ENSRNOP00000023965.1
	ENSRNOP00000069060.2
GenBank Protein	P50282	(Get FASTA)	NCBI Sequence Viewer
	QST77665	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_112317 ⟸ NM_031055
- Peptide Label:	precursor
- UniProtKB:	P50282 (UniProtKB/Swiss-Prot), D3ZYK8 (UniProtKB/TrEMBL), A6JXD0 (UniProtKB/TrEMBL)
- Sequence:	show sequence MNPWQPLLLVLLALGYSFAAPHQRQPTYVVFPRDLKTSNLTDTQLAEDYLYRYGYTRAAQMMGE KQSLRPALLMLQKQLSLPQTGELDSETLKAIRSPRCGVPDVGKFQTFEGDLKWHHHNITYWIQS YTEDLPRDVIDDSFARAFAVWSAVTPLTFTRVYGLEADIVIQFGVAEHGDGYPFDGKDGLLAHA FPPGPGIQGDAHFDDDELWSLGKGAVVPTYFGNANGAPCHFPFTFEGRSYLSCTTDGRNDGKPW CGTTADYDTDRKYGFCPSENLYTEHGNGDGKPCVFPFIFEGHSYSACTTKGRSDGYRWCATTAN YDQDKLYGFCPTRADVTVTGGNSAGEMCVFPFVFLGKQYSTCTGEGRSDGRLWCATTSNFDADK KWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYHYHEDSPLHEDDIKGIQHLYGRGS KPDPRPPATTAAEPQPTAPPTMCPTAPPMAYPTGGPTVAPTGAPSPGPTGPPTAGPSEAPTESS TPVDNPCNVDVFDAIADIQGALHFFKDGRYWKFSNHGGSQLQGPFLIARTWPALPAKLNSAFED PQSKKIFFFSGRKMWVYTGQTVLGPRSLDKLGLGSEVTLVTGLLPRRGGKALLISRERIWKFDL KSQKVDPQSVTRLDNEFSGVPWNSHNVFHYQDKAYFCHDKYFWRVSFHNRVNQVDHVAYVTYDL LQCP hide sequence

RefSeq Acc Id:

ENSRNOP00000023965 ⟸ ENSRNOT00000023965

RefSeq Acc Id:

ENSRNOP00000069060 ⟸ ENSRNOT00000088776

Protein Domains

Fibronectin type-II

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P50282-F1-model_v2	AlphaFold	P50282	1-708	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13692672

Promoter ID:

EPDNEW_R3196

Type:

single initiation site

Name:

Mmp9_1

Description:

matrix metallopeptidase 9

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	3	161,413,391 - 161,413,451	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621320	AgrOrtholog
BioCyc Gene	G2FUF-46817	BioCyc
Ensembl Genes	ENSRNOG00000017539	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000023965	ENTREZGENE
	ENSRNOT00000023965.4	UniProtKB/TrEMBL
	ENSRNOT00000088776.2	UniProtKB/TrEMBL
Gene3D-CATH	2.10.10.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	2.110.10.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	3.40.390.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	FN_type2_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	FN_type2_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Hemopexin-like_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Hemopexin-like_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Hemopexin-like_repeat	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Hemopexin_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	IPR006970	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Kringle-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	M10A_MMP	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	MetalloPept_cat_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Pept_M10_metallopeptidase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Pept_M10A	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Pept_M10A_Zn_BS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Peptidase_Metallo	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PGBD-like_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:81687	UniProtKB/Swiss-Prot
NCBI Gene	81687	ENTREZGENE
PANTHER	MATRIX METALLOPROTEINASE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR10201:SF30	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	fn2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Hemopexin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Peptidase_M10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PF04886	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PharmGKB	MMP9	RGD
PhenoGen	Mmp9	PhenoGen
PIRSF	Peptidase_M10A_matrix	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PRINTS	FNTYPEII	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	MATRIXIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	CYSTEINE_SWITCH	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	FN2_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	FN2_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	HEMOPEXIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	HEMOPEXIN_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ZINC_PROTEASE	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000017539	RatGTEx
SMART	FN2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SM00120	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ZnMc	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	Metalloproteases ('zincins'), catalytic domain	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SSF47090	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SSF50923	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SSF57440	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A0G2JUD9_RAT	UniProtKB/TrEMBL
	A0A8A1UC80_RAT	UniProtKB/TrEMBL
	A0A8A1UDE0_RAT	UniProtKB/TrEMBL
	A6JXD0	ENTREZGENE, UniProtKB/TrEMBL
	D3ZYK8	ENTREZGENE, UniProtKB/TrEMBL
	MMP9_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2005-01-20	Mmp9	matrix metallopeptidase 9		matrix metalloproteinase 9 (gelatinase B, 92-kDa type IV collagenase)	Name updated	1299863	APPROVED
2002-08-07	Mmp9	matrix metalloproteinase 9 (gelatinase B, 92-kDa type IV collagenase)			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_disease	increased expression is observed in rheumatoid arthiritis and periodontal disease, highly expressed in patients with ulcerative colitis	628551
gene_expression	expressed in the colonic wall tissue of colotic and normal rats	628551
gene_function	zinc and calcium-dependent endopeptidase, secreted as a zymogens	628551
gene_process	involved in tissue destruction and remodelling	628551
gene_process	degrades type IV collagen and gelatine	628551
gene_regulation	expression induced by TNFalpha in testis	727488
gene_regulation	oral administration of dextran sulphate sodium (DSS) induced upregulatin of pro-Mmp-9 activity, activity dependent on the extent of inflammed colonic tissue	628551
gene_regulation	after exposure of cultured cardiac fibroblasts to IL-1 beta, expression was enhanced in cells of both SHR and WKY strains to equivalent levels as measured by both semiquantitative PCR and zymographic studies	1358958

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)