Advanced Search (OLGA)

Gene: Fos (Fos proto-oncogene, AP-1 transcription factor subunit) Rattus norvegicus

Analyze

Symbol:

Fos

Name:

Fos proto-oncogene, AP-1 transcription factor subunit

RGD ID:

2626

Description:

Enables DNA binding activity; DNA-binding transcription factor activity; and promoter-specific chromatin binding activity. Involved in several processes, including cellular response to epidermal growth factor stimulus; learning or memory; and nervous system development. Located in endoplasmic reticulum; nuclear matrix; and nucleoplasm. Used to study alcohol dependence; alcohol use disorder; gastric ulcer; and morphine dependence. Biomarker of several diseases, including alcohol dependence; alcohol use disorder; artery disease (multiple); brain disease (multiple); and drug dependence (multiple). Orthologous to human FOS (Fos proto-oncogene, AP-1 transcription factor subunit); PARTICIPATES IN endothelin signaling pathway; fibroblast growth factor signaling pathway; forkhead class A signaling pathway; INTERACTS WITH (+)-pilocarpine; (+)-taxifolin; (+)-Tetrandrine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

c-fos; c-fos oncogene; cellular oncogene fos; FBJ murine osteosarcoma viral (v-fos) oncogene homolog; FBJ murine osteosarcoma viral oncogene homolog; FBJ osteosarcoma oncogene; proto-oncogene c-FOS; proto-oncogene cFOS; v-fos FBJ murine osteosarcoma viral oncogene homolog

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	110,852,188 - 110,855,054 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	6	110,852,190 - 110,855,598 (+)	Ensembl				GRCr8
mRatBN7.2	6	105,121,170 - 105,124,036 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	105,121,170 - 105,124,036 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	6	105,290,640 - 105,293,508 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	105,589,531 - 105,592,399 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	104,959,176 - 104,962,044 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	109,300,433 - 109,303,299 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	109,300,433 - 109,303,299 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	6	116,249,742 - 116,252,608 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	6	109,559,135 - 109,562,001 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	6	102,942,464 - 102,945,330 (+)	NCBI		Celera
RGSC_v3.1	6	109,562,609 - 109,566,002 (+)	NCBI
Cytogenetic Map	6	q31	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Aberrant Crypt Foci (IDA,IEP)

acute myocardial infarction (IEP)

alcohol dependence (IDA,IEP)

alcohol use disorder (IDA,IEP,ISO)

alcohol withdrawal syndrome (IEP)

Alcohol-Related Disorders (IEP)

Alcoholic Intoxication (IEP)

amphetamine abuse (IEP,ISO)

amyotrophic lateral sclerosis type 1 (ISO)

Animal Disease Models (ISO)

anxiety disorder (ISO)

autosomal dominant polycystic kidney disease (ISO)

Binge Drinking (IEP)

Brain Hypoxia-Ischemia (IEP)

Brain Injuries (ISO)

Breast Neoplasms (ISO)

cervical squamous cell carcinoma (ISO)

cocaine abuse (ISO)

cocaine dependence (IEP)

Cocaine-Related Disorders (IEP,ISO)

Colonic Neoplasms (ISO)

colorectal adenocarcinoma (ISO)

colorectal adenoma (ISO)

Colorectal Neoplasms (ISO)

congenital hypothyroidism (IEP)

congestive heart failure (IEP)

degenerative disc disease (IEP)

depressive disorder (IEP)

endometriosis (ISO)

epilepsy (IEP,ISO)

Experimental Arthritis (IEP)

Experimental Liver Cirrhosis (ISO)

extrahepatic cholestasis (ISO)

Fetal Growth Retardation (IEP)

Fibrous Dysplasia of Bone (ISO)

functional diarrhea (IEP)

gastric ulcer (IEP,IMP)

glomerulonephritis (IEP)

Heat Stroke (ISO)

Hematuria (IDA,IEP)

hemolytic-uremic syndrome (ISO)

Hemorrhage (ISO)

hepatocellular carcinoma (ISO)

Hyperalgesia (IEP,ISO)

Hyperkinesis (ISO)

hypertension (IEP,ISO)

hypospadias (IEP)

Inhalant Abuse (IEP)

irritable bowel syndrome (IEP)

juvenile rheumatoid arthritis (ISO)

Kidney Reperfusion Injury (ISO)

Lung Neoplasms (ISO)

middle cerebral artery infarction (ISO)

migraine (IEP)

morphine dependence (IDA,IEP,IMP)

morphine withdrawal syndrome (IEP)

myocardial infarction (IEP)

Neoplastic Cell Transformation (ISO)

nervous system disease (ISO)

nicotine dependence (IEP,ISO)

Nociceptive Pain (IEP)

obesity (ISO)

ovarian carcinoma (ISO)

Pick's disease (ISO)

post-traumatic stress disorder (ISO)

rectal benign neoplasm (ISO)

Reperfusion Injury (IEP,ISO)

sleeping sickness (IEP)

status epilepticus (ISO)

temporal lobe epilepsy (IEP)

Tendon Injuries (IDA)

Tongue Neoplasms (IEP)

tongue squamous cell carcinoma (ISO)

toxic encephalopathy (ISO)

trigeminal neuralgia (ISO)

Ventilator-Induced Lung Injury (IEP)

Wernicke encephalopathy (IEP)

withdrawal disorder (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-catechin (ISO)

(+)-pilocarpine (EXP)

(+)-Pimaric acid (ISO)

(+)-taxifolin (EXP)

(+)-Tetrandrine (EXP)

(-)-alpha-phellandrene (ISO)

(-)-anisomycin (ISO)

(-)-citrinin (ISO)

(-)-demecolcine (ISO)

(-)-ephedrine (ISO)

(-)-epigallocatechin 3-gallate (ISO)

(-)-selegiline (ISO)

(20R)-protopanaxadiol (ISO)

(20S)-ginsenoside Rh1 (ISO)

(E)-roxithromycin (ISO)

(R)-lipoic acid (EXP)

(R)-noradrenaline (EXP,ISO)

(S)-amphetamine (EXP,ISO)

(S)-colchicine (EXP)

(S)-naringenin (ISO)

(S)-nicotine (EXP,ISO)

(Z)-ligustilide (ISO)

1,1,1-trichloro-2,2-bis(4-hydroxyphenyl)ethane (ISO)

1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (EXP,ISO)

1,2,4,5-tetrachlorobenzene (EXP)

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

1,2-naphthoquinone (ISO)

1,4-dichlorobenzene (EXP)

1-(3-chlorophenyl)piperazine (EXP,ISO)

1-(5-isoquinolinesulfonyl)-2-methylpiperazine (EXP,ISO)

1-[3-(dimethylamino)propyl]-1-(4-fluorophenyl)-1,3-dihydro-2-benzofuran-5-carbonitrile (EXP)

1-chloro-2,4-dinitrobenzene (ISO)

1-naphthyl isothiocyanate (EXP,ISO)

1-nitropyrene (ISO)

15-deoxy-Delta(12,14)-prostaglandin J2 (EXP,ISO)

17alpha-ethynylestradiol (EXP,ISO)

17beta-estradiol (EXP,ISO)

17beta-estradiol 3-benzoate (EXP,ISO)

17beta-hydroxy-5alpha-androstan-3-one (ISO)

1D-myo-inositol 1,4,5-trisphosphate (EXP)

2,2',4,4',5,5'-hexachlorobiphenyl (EXP,ISO)

2,2',4,4'-Tetrabromodiphenyl ether (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3-Dioxo-6-nitro-7-sulfamoylbenzo(f)quinoxaline (EXP)

2,4,6-trinitrobenzenesulfonic acid (EXP)

2,4,6-trinitrotoluene (ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

2,4-dinitrotoluene (ISO)

2,6-dinitrotoluene (ISO)

2-(3,4-dimethoxyphenyl)-5-\{[2-(3,4-dimethoxyphenyl)ethyl](methyl)amino\}-2-(propan-2-yl)pentanenitrile (ISO)

2-(4-iodo-2,5-dimethoxyphenyl)-1-methylethylamine (EXP,ISO)

2-acetamidofluorene (EXP)

2-amino-2-deoxy-D-glucopyranose (ISO)

2-amino-3-hydroxypyridine (ISO)

2-aminopurine (ISO)

2-butoxyethanol (ISO)

2-hydroxypropanoic acid (ISO)

2-methyl-6-(phenylethynyl)pyridine (EXP)

2-nitrotoluene (EXP)

2-tert-butylhydroquinone (EXP,ISO)

2-trans,6-trans-farnesyl diphosphate (ISO)

22-Hydroxycholesterol (ISO)

3',5'-cyclic AMP (ISO)

3,3',4,4',5-pentachlorobiphenyl (ISO)

3,4-methylenedioxymethamphetamine (EXP,ISO)

3,5-dichloro-N-[[(2S)-1-ethyl-2-pyrrolidinyl]methyl]-2-hydroxy-6-methoxybenzamide (EXP)

3-\{1-[3-(dimethylamino)propyl]-1H-indol-3-yl\}-4-(1H-indol-3-yl)-1H-pyrrole-2,5-dione (EXP,ISO)

3-iodobenzyl-5'-N-methylcarboxamidoadenosine (EXP)

3-Methoxynobiletin (ISO)

3-phenylprop-2-enal (ISO)

4,4'-diaminodiphenylmethane (EXP)

4,4'-sulfonyldiphenol (ISO)

4,5,6,7-TETRABROMOBENZOTRIAZOLE (ISO)

4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one (ISO)

4-[1-hydroxy-2-[4-(phenylmethyl)-1-piperidinyl]propyl]phenol (EXP,ISO)

4-amino-5-chloro-N-[1-[3-(4-fluorophenoxy)propyl]-3-methoxy-4-piperidinyl]-2-methoxybenzamide (ISO)

4-DAMP(1+) (ISO)

4-hydroxynon-2-enal (EXP,ISO)

4-nitrophenol (ISO)

4-nonylphenol (ISO)

4-octylphenol (ISO)

4-tert-Octylphenol (EXP)

5,6,7-trimethoxyflavone (ISO)

5-(2-methylpiperazine-1-sulfonyl)isoquinoline (EXP,ISO)

5-aza-2'-deoxycytidine (EXP,ISO)

5-chloro-7-iodoquinolin-8-ol (ISO)

5-fluorouracil (ISO)

6-Cyano-7-nitroquinoxaline-2,3-dione (EXP)

6-propyl-2-thiouracil (EXP)

7,12-dimethyltetraphene (ISO)

8-(3-chlorostyryl)caffeine (EXP)

8-OH-DPAT (EXP,ISO)

9-Methoxycamptothecin (ISO)

acebutolol (ISO)

acephate (EXP)

acetaldehyde (EXP,ISO)

acetylsalicylic acid (EXP,ISO)

acrivastine (ISO)

acrolein (EXP,ISO)

acrylamide (EXP,ISO)

acrylonitrile (ISO)

actinomycin D (EXP,ISO)

afimoxifene (ISO)

aflatoxin B1 (EXP,ISO)

AH23848 (ISO)

alcohol (EXP,ISO)

aldehydo-D-glucosamine (ISO)

aldehydo-D-glucose (EXP,ISO)

alfuzosin (EXP)

Alisol B (ISO)

all-trans-retinoic acid (EXP,ISO)

allopurinol (ISO)

alpha-hexachlorocyclohexane (EXP)

alpha-naphthoflavone (ISO)

alpha-phellandrene (ISO)

alpha-pinene (ISO)

aluminium atom (ISO)

aluminium oxide (ISO)

aluminium(0) (ISO)

AM-251 (ISO)

amiloride (ISO)

amiodarone (ISO)

ammonium chloride (EXP)

ammonium hydroxide (EXP)

amphetamine (EXP,ISO)

anandamide (EXP)

andrographolide (ISO)

aniline (EXP)

anthra[1,9-cd]pyrazol-6(2H)-one (EXP,ISO)

antimonite (ISO)

antimycin A (ISO)

antirheumatic drug (ISO)

apigenin (ISO)

apomorphine (EXP)

arachidonic acid (ISO)

arecoline (ISO)

aristolochic acid A (ISO)

Aroclor 1254 (EXP,ISO)

arsane (ISO)

arsenic acid (EXP)

arsenic atom (ISO)

arsenite(3-) (EXP,ISO)

arsenous acid (EXP,ISO)

asbestos (ISO)

ascofuranone (ISO)

asoxime chloride (EXP)

astressin (EXP)

ATP (EXP,ISO)

atrazine (EXP,ISO)

atropine (EXP,ISO)

avobenzone (ISO)

Azaspiracid (ISO)

azathioprine (ISO)

azithromycin (ISO)

baclofen (EXP,ISO)

BAPTA (EXP)

bathocuproine disulfonic acid (ISO)

Bay-K-8644 (EXP,ISO)

bazedoxifene (ISO)

beclomethasone (ISO)

benazepril (EXP)

benzene (ISO)

benzo[a]pyrene (EXP,ISO)

benzo[a]pyrene diol epoxide I (ISO)

Benzo[k]fluoranthene (ISO)

benzofurans (ISO)

benzophenone (ISO)

Benzoyl peroxide (ISO)

Bergenin (EXP)

beryllium difluoride (ISO)

beryllium sulfate (ISO)

beta-D-glucosamine (ISO)

beta-lapachone (ISO)

beta-naphthoflavone (EXP,ISO)

bezafibrate (ISO)

bicalutamide (ISO)

bilobalide (EXP)

bis(2-chloroethyl) sulfide (ISO)

bis(2-ethylhexyl) phthalate (EXP,ISO)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

Bisphenol B (ISO)

bisphenol F (EXP,ISO)

bleomycin A2 (ISO)

bromochloroacetic acid (EXP)

bucladesine (ISO)

bufalin (ISO)

bupropion (ISO)

buta-1,3-diene (ISO)

butan-1-ol (EXP,ISO)

butanal (ISO)

butylated hydroxyanisole (ISO)

Butylbenzyl phthalate (ISO)

butyric acid (EXP)

C.I. Natural Red 20 (ISO)

C60 fullerene (EXP)

cadmium atom (EXP,ISO)

cadmium dichloride (EXP,ISO)

cadmium sulfate (ISO)

caffeine (ISO)

Calcimycin (EXP,ISO)

calcitriol (ISO)

Calphostin C (EXP)

calyculin A (ISO)

camostat (ISO)

candesartan (EXP)

cannabidiol (EXP,ISO)

cannabidiolic acid (ISO)

Cannabinol (ISO)

capsaicin (EXP,ISO)

capsazepine (EXP)

captan (ISO)

carbachol (EXP,ISO)

carbamazepine (EXP,ISO)

carbaryl (ISO)

carbon nanotube (ISO)

carnosine (EXP)

carrageenan (EXP)

cefaloridine (EXP)

celecoxib (EXP,ISO)

CGS-21680 (EXP)

chenodeoxycholic acid (ISO)

chloral hydrate (EXP)

Chloralose (EXP)

chlormequat chloride (EXP)

chloroform (ISO)

chloropicrin (ISO)

chloroprene (ISO)

chlorpromazine (ISO)

chlorpropamide (ISO)

chlorpyrifos (EXP,ISO)

choline (ISO)

chromium atom (ISO)

chromium(6+) (EXP,ISO)

chrysene (ISO)

chrysin (ISO)

ciglitazone (EXP,ISO)

ciguatoxin CTX1B (ISO)

Cinobufagin (ISO)

ciprofibrate (ISO)

cisapride (ISO)

cisplatin (EXP,ISO)

citalopram (EXP)

clarithromycin (ISO)

clofibrate (ISO)

clonidine (ISO)

clonidine (amino form) (ISO)

clonidine (imino form) (ISO)

clotrimazole (ISO)

clozapine (EXP,ISO)

cobalt atom (EXP,ISO)

cobalt dichloride (EXP,ISO)

cobalt(2+) sulfate (ISO)

cocaine (EXP,ISO)

colforsin daropate hydrochloride (EXP)

copper atom (EXP,ISO)

copper(0) (EXP,ISO)

copper(II) chloride (ISO)

copper(II) sulfate (ISO)

corilagin (ISO)

corticosterone (ISO)

coumestrol (ISO)

crocidolite asbestos (EXP,ISO)

CU-O LINKAGE (ISO)

curcumin (EXP,ISO)

cyanamide (EXP)

cycloheximide (EXP,ISO)

cyclophosphamide (EXP,ISO)

cyclosporin A (ISO)

cylindrospermopsin (ISO)

cypermethrin (EXP,ISO)

D-cycloserine (EXP)

D-glucose (EXP,ISO)

D-mannitol (EXP)

daidzein (ISO)

daidzein 7-O-beta-D-glucoside (ISO)

DDE (ISO)

DDT (EXP,ISO)

decabromodiphenyl ether (EXP)

deguelin (ISO)

dehydroepiandrosterone (ISO)

dehydroepiandrosterone sulfate (ISO)

delta-hexachlorocyclohexane (EXP)

deoxynivalenol (ISO)

desipramine (EXP)

Destruxin B (ISO)

devazepide (EXP)

dexamethasone (EXP,ISO)

dextran sulfate (ISO)

dextromethorphan (EXP,ISO)

Diallyl sulfide (EXP)

diallyl trisulfide (ISO)

diamminedichloroplatinum (EXP,ISO)

diarsenic trioxide (EXP,ISO)

diarylheptanoid (ISO)

diazepam (EXP,ISO)

dibenziodolium (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (EXP,ISO)

dichlorine (EXP)

dichloroacetic acid (ISO)

dichloromethane (ISO)

diclofenac (ISO)

dieckol (ISO)

dieldrin (ISO)

diethyl maleate (ISO)

diethylstilbestrol (EXP,ISO)

diflunisal (ISO)

diiodine (EXP)

diisopropyl fluorophosphate (EXP)

Dimaprit (ISO)

dimemorfan (EXP,ISO)

dimethyl sulfoxide (EXP)

dimethylarsinic acid (ISO)

dimethylarsinous acid (ISO)

dimethyldithiocarbamate (EXP)

dinophysistoxin 1 (ISO)

dioxygen (EXP,ISO)

diphenylcyclopropenone (ISO)

dipotassium bis[mu-tartrato(4-)]diantimonate(2-) trihydrate (ISO)

dipyridamole (ISO)

diquat (ISO)

disodium selenite (EXP,ISO)

disulfiram (ISO)

dizocilpine maleate (EXP,ISO)

dobutamine (EXP)

donepezil hydrochloride (ISO)

dopamine (EXP,ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

doxycycline (ISO)

ebselen (ISO)

elemental selenium (EXP)

ellagic acid (ISO)

endosulfan (ISO)

Enterolactone (ISO)

entinostat (ISO)

epoxiconazole (ISO)

ergotamine (EXP)

ergothioneine (EXP)

Erionite (EXP)

erythromycin A (ISO)

escitalopram (EXP)

estra-1,3,5(10)-triene-3,16beta-diol (EXP)

estriol (EXP)

etacrynic acid (ISO)

ethanol (EXP,ISO)

ethylene glycol bis(2-aminoethyl)tetraacetic acid (ISO)

eticlopride(1+) (EXP)

etoposide (EXP,ISO)

Evodiamine (EXP)

famotidine (ISO)

farnesyl diphosphate (ISO)

fenfluramine (EXP)

fentanyl (EXP)

fenthion (ISO)

ferric oxide (ISO)

ferroheme b (ISO)

ferrosoferric oxide (ISO)

fingolimod hydrochloride (ISO)

fisetin (ISO)

Flavokawain A (ISO)

flecainide (ISO)

flumequine (ISO)

fluoranthene (ISO)

fluoxetine (EXP,ISO)

flurbiprofen (EXP,ISO)

folic acid (ISO)

folpet (ISO)

formaldehyde (EXP,ISO)

formononetin (ISO)

fotemustine (ISO)

fructose (EXP)

fulvestrant (ISO)

furan (EXP)

furosemide (EXP,ISO)

gamma-hexachlorocyclohexane (EXP,ISO)

gamma-tocopherol (ISO)

gefitinib (ISO)

Geniposide pentaacetate (EXP)

genistein (EXP,ISO)

gentamycin (EXP)

geraniol (ISO)

ginsenoside Rb1 (ISO)

ginsenoside Re (ISO)

ginsenoside Rg1 (ISO)

glucaric acid (ISO)

glucose (EXP,ISO)

glufosinate (ISO)

glutathione (ISO)

glycidol (EXP)

glyphosate (EXP,ISO)

gold atom (ISO)

gold(0) (ISO)

haloperidol (EXP,ISO)

halothane (EXP)

Harpagoside (ISO)

helioxanthin (ISO)

heme b (ISO)

hemin (ISO)

heparin (EXP,ISO)

herbimycin (EXP)

heroin (EXP)

hexachlorobenzene (EXP)

Hexamethonium (EXP)

histamine (ISO)

hydralazine (EXP)

hydrogen chloride (EXP)

hydrogen peroxide (EXP,ISO)

hydrogen sulfide (ISO)

hydroquinone (ISO)

hydroxyurea (ISO)

hypochlorous acid (ISO)

ibuprofen (ISO)

icariin (ISO)

idazoxan (ISO)

ifosfamide (EXP)

imipramine (EXP)

indapamide (EXP)

Indeno[1,2,3-cd]pyrene (ISO)

indole-3-methanol (EXP)

indometacin (EXP)

iodoform (ISO)

ionomycin (EXP,ISO)

iprodione (ISO)

irinotecan (ISO)

iron atom (EXP)

iron dextran (EXP)

iron dichloride (ISO)

iron(0) (EXP)

iron(III) nitrilotriacetate (ISO)

isobutanol (ISO)

isoflurane (EXP)

isoprenaline (EXP,ISO)

isorhapontigenin (EXP)

isotretinoin (ISO)

istradefylline (EXP)

josamycin (ISO)

kaempferol (EXP,ISO)

kainic acid (EXP,ISO)

kenpaullone (EXP)

ketamine (EXP)

ketorolac (EXP)

KT 5823 (ISO)

L-ascorbic acid (ISO)

L-methionine (ISO)

L-selenocysteine (ISO)

lanthanum atom (EXP)

lanthanum trichloride (EXP)

lead diacetate (EXP,ISO)

lead nitrate (ISO)

lead(0) (EXP,ISO)

leflunomide (ISO)

levamisole (ISO)

Licochalcone B (ISO)

lidocaine (EXP,ISO)

linalool (EXP)

lipoic acid (EXP)

lipopolysaccharide (EXP,ISO)

lithium atom (EXP,ISO)

lithium chloride (EXP)

lithium hydride (EXP,ISO)

losartan (EXP,ISO)

lovastatin (EXP,ISO)

luteolin (EXP,ISO)

luteolin 7-O-beta-D-glucoside (ISO)

LY294002 (ISO)

lycopene (ISO)

lysergic acid diethylamide (EXP)

m-Chlorophenylbiguanide (EXP)

mancozeb (ISO)

maneb (EXP,ISO)

manganese atom (EXP,ISO)

manganese(0) (EXP,ISO)

manganese(II) chloride (EXP,ISO)

masoprocol (ISO)

mebendazole (ISO)

mechlorethamine (ISO)

MeIQx (ISO)

melatonin (EXP)

menadione (ISO)

mercury atom (EXP)

mercury dichloride (EXP,ISO)

mercury(0) (EXP)

metformin (EXP,ISO)

methamidophos (EXP)

methamphetamine (EXP,ISO)

methapyrilene (EXP)

methotrexate (EXP,ISO)

methoxychlor (EXP)

methyl methanesulfonate (ISO)

methylarsonic acid (ISO)

methylglyoxal (ISO)

methylisothiazolinone (ISO)

methylmercury chloride (EXP,ISO)

methylphenidate (EXP,ISO)

metoprolol (EXP)

metyrapone (EXP)

miconazole (EXP)

microcystin-LR (ISO)

Midecamycin (ISO)

mifepristone (EXP)

mitomycin C (ISO)

ML-7 (EXP)

modafinil (ISO)

Mofezolac (TN) (EXP)

mono(2-ethylhexyl) phthalate (EXP,ISO)

monocrotophos (EXP)

monosodium L-glutamate (EXP)

morin (EXP)

morphine (EXP,ISO)

Muconic dialdehyde (ISO)

muscimol (EXP)

mycophenolic acid (ISO)

myricetin (ISO)

N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine (ISO)

N-[2-(4-bromocinnamylamino)ethyl]isoquinoline-5-sulfonamide (EXP,ISO)

N-[2-[4-(2-methoxyphenyl)-1-piperazinyl]ethyl]-N-(2-pyridinyl)cyclohexanecarboxamide (EXP)

N-acetyl-L-cysteine (EXP,ISO)

N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (EXP,ISO)

N-ethyl-N-nitrosourea (ISO)

N-methyl-4-phenylpyridinium (EXP,ISO)

N-methyl-N-nitrosourea (EXP)

N-methylformamide (ISO)

N-nitrosodiethylamine (EXP,ISO)

N-Nitrosopyrrolidine (ISO)

N-phenylthiourea (ISO)

N1'-[2-[[5-[(dimethylamino)methyl]-2-furanyl]methylthio]ethyl]-N1-methyl-2-nitroethene-1,1-diamine (EXP)

nabumetone (ISO)

nafadotride (EXP)

naloxone (EXP,ISO)

naphthalene (ISO)

naringin (ISO)

NCX-4040 (ISO)

nectandrin B (ISO)

nefazodone (ISO)

neurotensin (ISO)

nicardipine (EXP)

nickel atom (EXP,ISO)

nickel dichloride (EXP)

nickel subsulfide (EXP,ISO)

nickel sulfate (ISO)

niclosamide (ISO)

nicotinamide (EXP)

nicotine (EXP,ISO)

nifedipine (EXP,ISO)

nilotinib (ISO)

nimodipine (EXP,ISO)

nimustine (ISO)

nitrofen (EXP)

nitrogen dioxide (EXP)

nitroglycerin (EXP,ISO)

nitroprusside (EXP,ISO)

nobiletin (EXP)

Nodularin (ISO)

nomifensine (EXP)

Nonylphenol (ISO)

obeticholic acid (ISO)

ochratoxin A (EXP,ISO)

okadaic acid (EXP,ISO)

olanzapine (EXP)

omega-conotoxin GVIA (EXP)

organoselenium compound (ISO)

oroxylin A (ISO)

oxaliplatin (EXP,ISO)

oxidopamine (EXP)

Oxotremorine (EXP)

oxotremorine M (ISO)

oxycodone (EXP)

oxytocin (EXP)

ozone (EXP,ISO)

p-chloromercuribenzoic acid (ISO)

p-menthan-3-ol (EXP)

p-tert-Amylphenol (EXP)

palytoxin (ISO)

paracetamol (EXP,ISO)

paraoxon (ISO)

paraquat (EXP,ISO)

parathion-methyl (EXP)

patulin (EXP,ISO)

PCB138 (EXP)

PD 0325901 (EXP,ISO)

pentachlorobenzene (EXP)

pentachlorophenol (ISO)

pentetrazol (EXP,ISO)

pentobarbital (EXP,ISO)

Pentoxifylline (ISO)

perchlorate (EXP)

perfluorooctane-1-sulfonic acid (EXP,ISO)

perfluorooctanoic acid (EXP,ISO)

perindopril (EXP)

permethrin (EXP,ISO)

peroxynitrous acid (ISO)

Pf-06840003 (ISO)

phencyclidine (EXP)

phenethyl isothiocyanate (ISO)

phenformin (EXP)

phenobarbital (EXP,ISO)

Phenoxybenzamine (EXP)

phenylarsine oxide (ISO)

phenylephrine (EXP,ISO)

phenytoin (EXP)

PhIP (EXP,ISO)

phorbol 12,13-dibutanoate (EXP)

phorbol 13-acetate 12-myristate (EXP,ISO)

phorone (EXP)

phosgene (ISO)

phylloquinone (ISO)

physostigmine (EXP)

picrotoxin (EXP)

picrotoxinin (EXP)

pimozide (EXP)

pioglitazone (EXP)

piperine (ISO)

piperonyl butoxide (ISO)

pipoxolan (ISO)

pirenzepine (EXP)

pirinixic acid (ISO)

platycodin D (ISO)

poly(ethylene) (ISO)

potassium atom (EXP,ISO)

potassium chloride (EXP)

potassium chromate (ISO)

potassium cyanide (EXP)

prazosin (EXP,ISO)

pregabalin (EXP)

pregnenolone 16alpha-carbonitrile (ISO)

progesterone (EXP,ISO)

promegestone (ISO)

propan-2-ol (ISO)

propanal (ISO)

propofol (EXP)

propranolol (EXP)

prostaglandin E2 (ISO)

protein kinase inhibitor (EXP)

protoporphyrin (ISO)

pterostilbene (ISO)

puerarin (ISO)

putrescine (EXP)

pyrethrins (ISO)

pyridine (EXP)

pyrimethamine (ISO)

pyrithiamine (EXP)

pyrrolidine dithiocarbamate (EXP,ISO)

quartz (ISO)

quercetin (EXP,ISO)

quercetin 3-O-beta-D-glucofuranoside (EXP)

quercetin 3-O-beta-D-glucopyranoside (EXP)

quinapril hydrochloride (EXP)

quinolin-8-ol (ISO)

quinolinic acid (EXP)

quinomethionate (ISO)

quinpirole (EXP)

rac-lactic acid (ISO)

ranitidine (EXP)

reactive oxygen species (ISO)

reboxetine (EXP)

reserpine (EXP)

resiniferatoxin (EXP,ISO)

resveratrol (EXP,ISO)

rimonabant (EXP,ISO)

risperidone (EXP,ISO)

ritonavir (ISO)

Rizatriptan benzoate (EXP)

Ro 31-8220 (ISO)

rosmarinic acid (EXP)

rotenone (EXP,ISO)

rottlerin (ISO)

rutin (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

S-butyl-DL-homocysteine (S,R)-sulfoximine (EXP,ISO)

SB 203580 (EXP,ISO)

SB 206553 (EXP)

SB 431542 (ISO)

SCH 23390 (EXP)

SCH772984 (EXP)

sclareol (ISO)

scopolamine (EXP,ISO)

selenium atom (EXP)

selenomethionine (ISO)

selumetinib (ISO)

serotonin (EXP)

serpentine asbestos (EXP)

sertraline (EXP,ISO)

Shikonin (ISO)

silicon dioxide (EXP,ISO)

silver atom (ISO)

silver(0) (ISO)

silver(1+) nitrate (ISO)

simvastatin (EXP,ISO)

SKF 38393 (EXP,ISO)

SL-327 (EXP,ISO)

sodium arsenate (ISO)

sodium arsenite (EXP,ISO)

sodium azide (EXP)

sodium chloride (EXP,ISO)

sodium dichromate (EXP,ISO)

sodium dodecyl sulfate (EXP,ISO)

sodium fluoride (ISO)

sodium perchlorate (EXP)

Soman (EXP)

spiramycin II (ISO)

staurosporine (EXP)

sterigmatocystin (EXP)

stilben-4-ol (ISO)

stilbene-4,4'-diol (ISO)

streptozocin (ISO)

styrene (ISO)

sulfur dioxide (EXP)

sulindac (ISO)

sumatriptan (ISO)

superoxide (ISO)

tacrine (EXP)

tacrolimus hydrate (ISO)

tamoxifen (EXP,ISO)

tandospirone citrate (ISO)

Tanshinone I (ISO)

taurine (EXP)

taurolithocholic acid (ISO)

tauroursodeoxycholic acid (ISO)

tebufenpyrad (ISO)

telmisartan (EXP)

terbufos (ISO)

terbutaline (EXP)

tert-butyl hydroperoxide (ISO)

testosterone (EXP,ISO)

Tetrachlorobisphenol A (EXP,ISO)

tetrachloroethene (ISO)

tetrachloromethane (EXP,ISO)

tetramethylpyrazine (EXP)

tetrathiomolybdate(2-) (ISO)

tetrodotoxin (EXP)

thalidomide (ISO)

thapsigargin (ISO)

theophylline (EXP)

thimerosal (ISO)

thioacetamide (EXP)

thiourea (ISO)

thiram (ISO)

thymol (ISO)

thymol sulfate(1-) (ISO)

thymoquinone (EXP)

titanium dioxide (EXP,ISO)

tocopherol (ISO)

toluene (ISO)

topotecan (EXP,ISO)

torcetrapib (ISO)

toremifene (ISO)

trans-stilbene-4,4'-diol (ISO)

transplatin (EXP,ISO)

tranylcypromine (EXP)

triacsin C (ISO)

triazolam (ISO)

tributylstannane (EXP)

trichloroethene (EXP)

trichostatin A (ISO)

triphenyl phosphate (ISO)

triptonide (ISO)

troglitazone (EXP,ISO)

tropan-3alpha-yl 3-hydroxy-2-phenylpropanoate (EXP,ISO)

Tropicamide (EXP)

trovafloxacin (ISO)

tubocurarine (ISO)

tungsten (EXP,ISO)

tunicamycin (ISO)

tyrphostin AG 1478 (EXP,ISO)

U-73122 (EXP)

uranium atom (ISO)

urethane (EXP,ISO)

Ursonic acid (ISO)

valproic acid (EXP,ISO)

valsartan (EXP)

vanadyl sulfate (ISO)

vancomycin (ISO)

vanoxerine dihydrochloride (EXP)

verapamil (ISO)

veratridine (EXP,ISO)

vinclozolin (EXP)

vincristine (EXP)

vitamin D (ISO)

vitamin E (ISO)

WIN 55212-2 (ISO)

wortmannin (EXP,ISO)

xanomeline (EXP)

Xanthatin (ISO)

xanthohumol (ISO)

xanthones (ISO)

zearalenone (ISO)

zidovudine (ISO)

zinc atom (EXP,ISO)

zinc dichloride (ISO)

zinc oxide (ISO)

zinc protoporphyrin (ISO)

zinc sulfate (ISO)

zinc(0) (EXP,ISO)

zoledronic acid (EXP,ISO)

zonisamide (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cellular response to calcium ion (ISO)

cellular response to epidermal growth factor stimulus (IEP)

cellular response to hormone stimulus (IEP)

cellular response to hypoxia (IEP)

cellular response to parathyroid hormone stimulus (IEP)

cellular response to phorbol 13-acetate 12-myristate (IEP)

cellular response to prolactin (IEP)

cellular response to reactive oxygen species (IEA,ISO)

cellular response to transforming growth factor beta stimulus (IEP)

cellular response to tumor necrosis factor (IEP)

cellular response to zinc ion starvation (IEP)

cerebral cortex development (IMP)

conditioned taste aversion (IEP)

female pregnancy (IEP)

medium-term memory (IMP)

mononuclear cell differentiation (IEP)

myoblast proliferation (IEP)

nervous system development (ISO)

neural retina development (IEP)

neuron differentiation (IMP)

positive regulation of DNA-templated transcription (IEA,ISO)

positive regulation of miRNA transcription (IDA,IEA,ISO)

positive regulation of osteoclast differentiation (ISO)

positive regulation of transcription by RNA polymerase II (IEA,ISO)

regulation of DNA-templated transcription (IEA,ISO)

regulation of gene expression (ISO)

regulation of transcription by RNA polymerase II (IBA,IEA,ISO)

response to activity (IEP)

response to cAMP (IEP)

response to corticosterone (IEP)

response to cytokine (IEP)

response to ethanol (IEP)

response to forskolin (IEP)

response to gravity (IEP)

response to immobilization stress (IEP)

response to insulin (IEP)

response to light stimulus (IEP)

response to lipopolysaccharide (IEP)

response to mechanical stimulus (IEP)

response to muscle stretch (ISO)

response to progesterone (IEP)

response to steroid hormone (IEP)

response to toxic substance (IEP)

response to xenobiotic stimulus (IEP,ISO)

skeletal muscle cell differentiation (ISO)

skeletal muscle cell proliferation (IEP)

SMAD protein signal transduction (IEA,ISO)

transcription by RNA polymerase II (IMP)

transforming growth factor beta receptor signaling pathway (IEA,ISO)

Cellular Component

cytoplasm (IEA,ISO)

cytosol (IEA)

endoplasmic reticulum (IDA,IEA,ISO)

nuclear matrix (IDA)

nucleoplasm (IDA,IEA,ISO,TAS)

nucleus (IBA,IDA,IEA,ISO)

protein-DNA complex (IEA,ISO)

transcription factor AP-1 complex (IEA,ISO)

transcription regulator complex (IEA,ISO)

Molecular Function

chromatin binding (IEA,ISO)

DNA binding (IDA,IEA,ISO)

DNA-binding transcription activator activity, RNA polymerase II-specific (IEA,ISO)

DNA-binding transcription factor activity (IEA,IMP,ISO,TAS)

DNA-binding transcription factor activity, RNA polymerase II-specific (IBA)

double-stranded DNA binding (IDA,IEA)

identical protein binding (IEA,ISO)

promoter-specific chromatin binding (IDA)

protein binding (IPI,ISO)

protein-containing complex binding (IDA,IPI)

R-SMAD binding (IEA,ISO)

RNA polymerase II cis-regulatory region sequence-specific DNA binding (IBA,IEA,ISO)

RNA polymerase II core promoter sequence-specific DNA binding (IEA,ISO)

RNA polymerase II-specific DNA-binding transcription factor binding (IEA,ISO)

sequence-specific DNA binding (IDA)

sequence-specific double-stranded DNA binding (IEA,ISO)

transcription cis-regulatory region binding (IEA,ISO)

transcription coregulator binding (IEA,ISO)

transcription factor binding (IPI)

Molecular Pathway Annotations Click to see Annotation Detail View

References

References - curated

#	Reference Title	Reference Citation
1.	Expression and purification of the leucine zipper and DNA-binding domains of Fos and Jun: both Fos and Jun contact DNA directly.	Abate C, etal., Proc Natl Acad Sci U S A 1990 Feb;87(3):1032-6.
2.	Methamphetamine-associated memory is regulated by a writer and an eraser of permissive histone methylation.	Aguilar-Valles A, etal., Biol Psychiatry. 2014 Jul 1;76(1):57-65. doi: 10.1016/j.biopsych.2013.09.014. Epub 2013 Oct 31.
3.	The increase in c-fos expression in epileptic seizures is inhibited by magnetic field application, but not KCa1.1 channel expression.	Akdağ MZ, etal., Electromagn Biol Med. 2023 Apr 3;42(2):81-97. doi: 10.1080/15368378.2023.2247027. Epub 2023 Aug 20.
4.	Characteristics of c-fos gene expression in the brains of rats with different investigative and defensive behaviors.	Babai P, etal., Neurosci Behav Physiol 2001 Nov-Dec;31(6):583-8.
5.	Acute exercise-induced activation of Phox2b-expressing neurons of the retrotrapezoid nucleus in rats may involve the hypothalamus.	Barna BF, etal., Neuroscience. 2014 Jan 31;258:355-63. doi: 10.1016/j.neuroscience.2013.11.031. Epub 2013 Nov 26.
6.	Swim-stress but not opioid withdrawal increases expression of c-fos immunoreactivity in rat periaqueductal gray neurons which project to the rostral ventromedial medulla.	Bellchambers CE, etal., Neuroscience. 1998 Mar;83(2):517-24. doi: 10.1016/s0306-4522(97)00399-0.
7.	Prolactin receptor is associated with c-src kinase in rat liver.	Berlanga JJ, etal., Mol Endocrinol. 1995 Nov;9(11):1461-7. doi: 10.1210/mend.9.11.8584023.
8.	Expression of c-Fos, ICER, Krox-24 and JunB in the whisker-to-barrel pathway of rats: time course of induction upon whisker stimulation by tactile exploration of an enriched environment.	Bisler S, etal., J Chem Neuroanat 2002 Mar;23(3):187-98.
9.	Normalization and subtraction: two approaches to facilitate gene discovery.	Bonaldo MF, etal., Genome Res 1996 Sep;6(9):791-806.
10.	Temporal and regional expression of Fos-related proteins in response to ischemic injury.	Butler TL and Pennypacker KR, Brain Res Bull. 2004 Mar 1;63(1):65-73.
11.	Modulation of cellular AP-1 DNA binding activity by heat shock proteins.	Carter DA FEBS Lett. 1997 Oct 13;416(1):81-5.
12.	Acupuncture attenuates repeated nicotine-induced behavioral sensitization and c-Fos expression in the nucleus accumbens and striatum of the rat.	Chae Y, etal., Neurosci Lett. 2004 Mar 25;358(2):87-90. doi: 10.1016/j.neulet.2003.12.121.
13.	Augmented upregulation by c-fos of angiotensin subtype 1 receptor in nucleus tractus solitarii of spontaneously hypertensive rats.	Chan JY, etal., Hypertension 2002 Sep;40(3):335-41.
14.	Conditioned response evoked by nicotine conditioned stimulus preferentially induces c-Fos expression in medial regions of caudate-putamen.	Charntikov S, etal., Neuropsychopharmacology. 2012 Mar;37(4):876-84. doi: 10.1038/npp.2011.263. Epub 2011 Nov 2.
15.	Distinctive features of Egr transcription factor regulation and DNA binding activity in CA1 of the hippocampus in synaptic plasticity and consolidation and reconsolidation of fear memory.	Cheval H, etal., Hippocampus. 2011 Mar 18. doi: 10.1002/hipo.20926.
16.	Proto-oncogene expression in proliferating and differentiating cardiac and skeletal muscle.	Claycomb WC and Lanson NA, Biochem J. 1987 Nov 1;247(3):701-6. doi: 10.1042/bj2470701.
17.	Induction of differential patterns of local cerebral glucose metabolism and immediate-early genes by acute clozapine and haloperidol.	Cochran SM, etal., Neuropharmacology. 2002 Sep;43(3):394-407.
18.	Calcium channel antagonists delay regression of androgen-dependent tissues and suppress gene activity associated with cell death.	Connor J, etal., Prostate 1988;13(2):119-30.
19.	Isolation and characterization of the c-fos(rat) cDNA and analysis of post-translational modification in vitro.	Curran T, etal., Oncogene 1987;2(1):79-84.
20.	Cloning of the cDNA encoding human C/EBP gamma, a protein binding to the PRE-I enhancer element of the human interleukin-4 promoter.	Davydov IV, etal., Gene. 1995 Aug 19;161(2):271-5.
21.	GH-deficient dw/dw rats and lit/lit mice show increased Fos expression in the hypothalamic arcuate nucleus following systemic injection of GH-releasing peptide-6.	Dickson SL, etal., J Endocrinol. 1995 Sep;146(3):519-26.
22.	Primary gene response to mechanical loading in healing rat Achilles tendons.	Eliasson P, etal., J Appl Physiol (1985). 2013 Jun;114(11):1519-26. doi: 10.1152/japplphysiol.01500.2012. Epub 2013 Mar 21.
23.	An integrated network analysis, RNA-seq and in vivo validation approaches to explore the protective mechanism of Mongolian medicine formulae Ruda-6 against indomethacin-induced gastric ulcer in rats.	Feng L, etal., Front Pharmacol. 2023 Aug 10;14:1181133. doi: 10.3389/fphar.2023.1181133. eCollection 2023.
24.	Is light-regulated AP-1 binding in the rat suprachiasmatic nucleus gated by the circadian clock?	Francois-Bellan AM, etal., Brain Res Mol Brain Res. 2000 Dec 28;85(1-2):161-70.
25.	Anxiety during alcohol withdrawal involves 5-HT2C receptors and M-channels in the lateral habenula.	Fu R, etal., Neuropharmacology. 2020 Feb;163:107863. doi: 10.1016/j.neuropharm.2019.107863. Epub 2019 Nov 26.
26.	miR-21 Gene expression triggered by AP-1 is sustained through a double-negative feedback mechanism.	Fujita S, etal., J Mol Biol. 2008 May 2;378(3):492-504. doi: 10.1016/j.jmb.2008.03.015. Epub 2008 Mar 15.
27.	Midazolam induces expression of c-Fos and EGR-1 by a non-GABAergic mechanism.	Fukuda K, etal., Anesth Analg 2002 Aug;95(2):373-8, table of contents.
28.	Protective effects of acetaminophen on ibuprofen-induced gastric mucosal damage in rats with associated suppression of matrix metalloproteinase.	Fukushima E, etal., J Pharmacol Exp Ther. 2014 Apr;349(1):165-73. doi: 10.1124/jpet.113.210021. Epub 2014 Feb 4.
29.	Heterogeneous neuronal activity in the lateral habenula after short- and long-term cocaine self-administration in rats.	Gao P, etal., Eur J Neurosci. 2018 Jan;47(1):83-94. doi: 10.1111/ejn.13780. Epub 2017 Dec 8.
30.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
31.	MiR-101a-3p Attenuated Pilocarpine-Induced Epilepsy by Downregulating c-FOS.	Geng J, etal., Neurochem Res. 2021 May;46(5):1119-1128. doi: 10.1007/s11064-021-03245-w. Epub 2021 Feb 9.
32.	Mapping of c-fos gene expression in the brain during morphine dependence and precipitated withdrawal, and phenotypic identification of the striatal neurons involved.	Georges F, etal., Eur J Neurosci. 2000 Dec;12(12):4475-86. doi: 10.1046/j.0953-816x.2000.01334.x.
33.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
34.	Selective participation of c-Jun with Fra-2/c-Fos promotes aggressive tumor phenotypes and poor prognosis in tongue cancer.	Gupta S, etal., Sci Rep. 2015 Nov 19;5:16811. doi: 10.1038/srep16811.
35.	The neural correlates and role of D1 dopamine receptors in renewal of extinguished alcohol-seeking.	Hamlin AS, etal., Neuroscience. 2007 May 11;146(2):525-36. doi: 10.1016/j.neuroscience.2007.01.063. Epub 2007 Mar 23.
36.	Time-course of immediate early gene expression in hippocampal subregions of adrenalectomized rats after acute corticosterone challenge.	Hansson AC and Fuxe K, Brain Res. 2008 Jun 18;1215:1-10. Epub 2008 Apr 10.
37.	Using c-fos as a neural marker of pain.	Harris JA Brain Res Bull 1998;45(1):1-8.
38.	Relapse to cocaine-seeking increases activity-regulated gene expression differentially in the striatum and cerebral cortex of rats following short or long periods of abstinence.	Hearing MC, etal., Brain Struct Funct. 2008 Sep;213(1-2):215-27. doi: 10.1007/s00429-008-0182-4. Epub 2008 May 17.
39.	Increased expression of the receptor for activation of NF-kappaB and decreased runt-related transcription factor 2 expression in bone of rats with streptozotocin-induced diabetes.	Hie M and Tsukamoto I, Int J Mol Med. 2010 Oct;26(4):611-8. doi: 10.3892/ijmm_00000506.
40.	Zinc deficiency decreases osteoblasts and osteoclasts associated with the reduced expression of Runx2 and RANK.	Hie M, etal., Bone. 2011 Dec;49(6):1152-9. doi: 10.1016/j.bone.2011.08.019. Epub 2011 Aug 26.
41.	Scutellaria baicalensis alleviates cantharidin-induced rat hemorrhagic cystitis through inhibition of cyclooxygenase-2 overexpression.	Huan SK, etal., Molecules. 2012 May 25;17(6):6277-89. doi: 10.3390/molecules17066277.
42.	Molecular changes consistent with increased proliferation and invasion are common in rectal cancer.	Hughes R, etal., Clin Transl Oncol. 2011 Oct;13(10):753-9. doi: 10.1007/s12094-011-0728-4.
43.	Ethanol increases osteoclastogenesis associated with the increased expression of RANK, PU.1 and MITF in vitro and in vivo.	Iitsuka N, etal., Int J Mol Med. 2012 Jul;30(1):165-72. doi: 10.3892/ijmm.2012.974. Epub 2012 Apr 20.
44.	Repetitive stretch induces c-fos and myogenin mRNA within several hours in skeletal muscle removed from rats.	Ikeda S, etal., Arch Phys Med Rehabil 2003 Mar;84(3):419-23.
45.	Similarity of distributions of spinal c-Fos and plasma extravasation after acute chemical irritation of the bladder and the prostate.	Ishigooka M, etal., J Urol 2000 Nov;164(5):1751-6.
46.	N-(2-hydroxy phenyl) acetamide produces profound inhibition of c-Fos protein and mRNA expression in the brain of adjuvant-induced arthritic rats.	Jawed H, etal., Mol Cell Biochem. 2014 Feb;387(1-2):81-90. doi: 10.1007/s11010-013-1873-6. Epub 2013 Nov 2.
47.	Clusterin regulates ß-amyloid toxicity via Dickkopf-1-driven induction of the wnt-PCP-JNK pathway.	Killick R, etal., Mol Psychiatry. 2014 Jan;19(1):88-98. doi: 10.1038/mp.2012.163. Epub 2012 Nov 20.
48.	Vitamin B-6-supplemented diets compared with a low vitamin B-6 diet suppress azoxymethane-induced colon tumorigenesis in mice by reducing cell proliferation.	Komatsu SI, etal., J Nutr. 2001 Aug;131(8):2204-7.
49.	Administration of ricin induces a severe inflammatory response via nonredundant stimulation of ERK, JNK, and P38 MAPK and provides a mouse model of hemolytic uremic syndrome.	Korcheva V, etal., Am J Pathol. 2005 Jan;166(1):323-39.
50.	Acute nicotine enhances spontaneous recovery of contextual fear and changes c-fos early gene expression in infralimbic cortex, hippocampus, and amygdala.	Kutlu MG, etal., Learn Mem. 2016 Jul 15;23(8):405-14. doi: 10.1101/lm.042655.116. Print 2016 Aug.
51.	Expression of AP-1 family transcription factors in the amygdala during conditioned taste aversion learning: role for Fra-2.	Kwon B, etal., Brain Res. 2008 May 1;1207:128-41. Epub 2008 Feb 9.
52.	Morphine withdrawal precipitated by specific mu, delta or kappa opioid receptor antagonists: a c-Fos protein study in the rat central nervous system.	Le Guen S, etal., Eur J Neurosci. 2003 Jun;17(11):2425-37. doi: 10.1046/j.1460-9568.2003.02678.x.
53.	Increased activity of activator protein-1 transcription factor components ATF2, c-Jun, and c-Fos in human and mouse autosomal dominant polycystic kidney disease.	Le NH, etal., J Am Soc Nephrol. 2005 Sep;16(9):2724-31. Epub 2005 Jul 27.
54.	Inhibitory effects of ginseng total saponins on behavioral sensitization and dopamine release induced by cocaine.	Lee B, etal., Biol Pharm Bull. 2008 Mar;31(3):436-41. doi: 10.1248/bpb.31.436.
55.	Retinoid receptor-specific agonists alleviate experimental glomerulonephritis.	Lehrke I, etal., Am J Physiol Renal Physiol. 2002 Apr;282(4):F741-51.
56.	Differential expression of protooncogenes related to transformation and cancer progression in rat myoblasts.	Leibovitch SA, etal., Cancer Res. 1986 Aug;46(8):4097-103.
57.	Characterization of the chromosomal binding sites and dimerization partners of the viral oncoprotein Meq in Marek's disease virus-transformed T cells.	Levy AM, etal., J Virol. 2003 Dec;77(23):12841-51.
58.	Antidepressant effect of electroacupuncture on modulating the expression of c-Fos/AP-1 through the JNK signaling pathway.	Li X, etal., Anat Rec (Hoboken). 2021 Nov;304(11):2480-2493. doi: 10.1002/ar.24740. Epub 2021 Aug 25.
59.	NMDA and dopamine D1 receptors within NAc-shell regulate IEG proteins expression in reward circuit during cocaine memory reconsolidation.	Li Y, etal., Neuroscience. 2016 Feb 19;315:45-69. doi: 10.1016/j.neuroscience.2015.11.063. Epub 2015 Dec 8.
60.	Effects of intrathecal isoflurane administration on nociception and Fos expression in the rat spinal cord.	Liu CR, etal., Eur J Anaesthesiol. 2011 Feb;28(2):112-9. doi: 10.1097/EJA.0b013e328340514a.
61.	Antenatal Taurine Improves Intrauterine Growth-Restricted Fetal Rat Brain Development Which Is Associated with Increasing the Activity of PKA-CaMKII/c-fos Signal Pathway.	Liu F, etal., Neuropediatrics. 2015 Oct;46(5):299-306. doi: 10.1055/s-0035-1558434. Epub 2015 Aug 31.
62.	Increased susceptibility to transcriptional changes with novel stressor in adrenal medulla of rats exposed to prolonged cold stress.	Liu X, etal., Brain Res Mol Brain Res. 2005 Nov 18;141(1):19-29. Epub 2005 Sep 19.
63.	Immunohistochemical detection of RAS, JUN, FOS, and p53 oncoprotein expression in human colorectal adenomas and carcinomas.	Magrisso IJ, etal., Lab Invest. 1993 Dec;69(6):674-81.
64.	A selective inhibition of c-Fos/activator protein-1 as a potential therapeutic target for intervertebral disc degeneration and associated pain.	Makino H, etal., Sci Rep. 2017 Dec 5;7(1):16983. doi: 10.1038/s41598-017-17289-y.
65.	Heterodimerization with different Jun proteins controls c-Fos intranuclear dynamics and distribution.	Malnou CE, etal., J Biol Chem. 2010 Feb 26;285(9):6552-62. doi: 10.1074/jbc.M109.032680. Epub 2010 Jan 6.
66.	Post-sensitization treatment with rimonabant blocks the expression of cocaine-induced behavioral sensitization and c-Fos protein in mice.	Marinho EAV, etal., Pharmacol Biochem Behav. 2017 May;156:16-23. doi: 10.1016/j.pbb.2017.03.006. Epub 2017 Mar 31.
67.	Frequency of cocaine self-administration influences drug seeking in the rat: optogenetic evidence for a role of the prelimbic cortex.	Martín-García E, etal., Neuropsychopharmacology. 2014 Sep;39(10):2317-30. doi: 10.1038/npp.2014.66. Epub 2014 Mar 17.
68.	Expression and light sensitivity of clock genes Per1 and Per2 and immediate-early gene c-fos within the retina of early postnatal Wistar rats.	Matejů K, etal., J Comp Neurol. 2010 Sep 1;518(17):3630-44. doi: 10.1002/cne.22421.
69.	Characterization and identification of subpopulations of mononuclear preosteoclasts induced by TNF-α in combination with TGF-β in rats.	Matsubara R, etal., PLoS One. 2012;7(10):e47930. doi: 10.1371/journal.pone.0047930. Epub 2012 Oct 24.
70.	Rat maf-related factors: the specificities of DNA binding and heterodimer formation.	Matsushima-Hibiya Y, etal., Biochem Biophys Res Commun 1998 Apr 17;245(2):412-8.
71.	Parathyroid hormone regulates the expression of the receptor protein tyrosine phosphatase, OST-PTP, in rat osteoblast-like cells.	Mauro LJ, etal., Endocrinology. 1996 Mar;137(3):925-33. doi: 10.1210/endo.137.3.8603605.
72.	Mild stress sensitizes the brain's response to morphine.	Mayer P, etal., Brain Res Mol Brain Res. 2002 Aug 15;104(2):143-7. doi: 10.1016/s0169-328x(02)00330-3.
73.	Alcohol Induces Parallel Changes in Hippocampal Histone H3 Phosphorylation and c-Fos Protein Expression in Male Rats.	McClain JA and Nixon K, Alcohol Clin Exp Res. 2016 Jan;40(1):102-12. doi: 10.1111/acer.12933.
74.	Impaired activation of AP-1 and altered expression of constituent proteins in rat adrenal during ageing.	Medicherla R, etal., Mech Ageing Dev. 2001 Aug;122(11):1169-86.
75.	Rapid effects of triiodothyronine on immediate-early gene expression in Schwann cells.	Mercier G, etal., Glia. 2001 Aug;35(2):81-9.
76.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
77.	Central administration of galanin N-terminal fragment 1-15 decreases the voluntary alcohol intake in rats.	Millón C, etal., Addict Biol. 2019 Jan;24(1):76-87. doi: 10.1111/adb.12582. Epub 2017 Dec 6.
78.	c-fos and cleaved caspase-3 expression after perinatal exposure to ethanol, cocaine, or the combination of both drugs.	Mitchell ES and Snyder-Keller A, Brain Res Dev Brain Res. 2003 Dec 30;147(1-2):107-17. doi: 10.1016/j.devbrainres.2003.08.010.
79.	Differential expression of activator protein-1 transcription factors in pregnant rat myometrium.	Mitchell JA and Lye SJ, Biol Reprod. 2002 Jul;67(1):240-6.
80.	Mechanical stretch and progesterone differentially regulate activator protein-1 transcription factors in primary rat myometrial smooth muscle cells.	Mitchell JA, etal., Am J Physiol Endocrinol Metab. 2004 Sep;287(3):E439-45. Epub 2004 May 4.
81.	Inducible-NOS but not neuronal-NOS participate in the acute effect of TNF-alpha on hypothalamic insulin-dependent inhibition of food intake.	Moraes JC, etal., FEBS Lett. 2006 Aug 21;580(19):4625-31. doi: 10.1016/j.febslet.2006.07.042. Epub 2006 Jul 21.
82.	Male rats exposed to cocaine in utero demonstrate elevated expression of Fos in the prefrontal cortex in response to environment.	Morrow BA, etal., Neuropsychopharmacology 2002 Mar;26(3):275-85.
83.	Proto-oncogene c-fos induction in thiamine-deficient encephalopathy. Protective effects of nicardipine on pyrithiamine-induced lesions.	Munujos P, etal., J Neurol Sci. 1993 Sep;118(2):175-80. doi: 10.1016/0022-510x(93)90107-a.
84.	Pregnenolone sulfate activates basic region leucine zipper transcription factors in insulinoma cells: role of voltage-gated Ca2+ channels and transient receptor potential melastatin 3 channels.	Müller I, etal., Mol Pharmacol. 2011 Dec;80(6):1179-89. doi: 10.1124/mol.111.074781. Epub 2011 Sep 23.
85.	Renal ischemia-induced cholesterol loading: transcription factor recruitment and chromatin remodeling along the HMG CoA reductase gene.	Naito M, etal., Am J Pathol. 2009 Jan;174(1):54-62. doi: 10.2353/ajpath.2009.080602. Epub 2008 Dec 18.
86.	Fos induction in the amygdala by vestibular information during hypergravity stimulation.	Nakagawa A, etal., Brain Res 2003 Oct 3;986(1-2):114-23.
87.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
88.	Modulation of c-myc and c-fos gene expression in regenerating rat liver by 2-mercaptopropionylglycine.	Ohri S, etal., Cell Biol Int 2002;26(2):187-92.
89.	Expressions of junB and c-fos are enhanced in 4-nitroquinoline 1-oxide-induced rat tongue cancers.	Ohyama M, etal., Pathol Int. 2004 Jan;54(1):35-40.
90.	Differential expression of c-fos and tyrosine hydroxylase mRNA in the adrenal gland of the infant rat: evidence for an adrenal hyporesponsive period.	Okimoto DK, etal., Endocrinology 2002 May;143(5):1717-25.
91.	Online Mendelian Inheritance in Man, OMIM (TM).	Online Mendelian Inheritance in Man, OMIM (TM).
92.	Strain differences in Fos expression following airpuff startle in Spontaneously Hypertensive and Wistar Kyoto rats.	Palmer AA and Printz MP, Neuroscience 1999 Mar;89(3):965-78.
93.	Alterations of orexinergic and melanin-concentrating hormone neurons in experimental sleeping sickness.	Palomba M, etal., Neuroscience. 2015 Apr 2;290:185-95. doi: 10.1016/j.neuroscience.2014.12.066. Epub 2015 Jan 13.
94.	Knockdown of c-Fos suppresses the growth of human colon carcinoma cells in athymic mice.	Pandey MK, etal., Int J Cancer. 2012 Jan 1;130(1):213-22. doi: 10.1002/ijc.25997. Epub 2011 Apr 8.
95.	Experience-dependent decrease in synaptically localized Fra-1.	Paratcha G, etal., Brain Res Mol Brain Res. 2000 May 31;78(1-2):120-30.
96.	Distribution of c-Fos immunoreactivity in the rat brain following abuse-like toluene vapor inhalation.	Perit KE, etal., Neurotoxicol Teratol. 2012 Jan-Feb;34(1):37-46. doi: 10.1016/j.ntt.2011.10.007. Epub 2011 Oct 30.
97.	Neural substrate of nicotine addiction as defined by functional brain maps of gene expression.	Pich EM, etal., J Physiol Paris. 1998 Jun-Aug;92(3-4):225-8. doi: 10.1016/s0928-4257(98)80015-6.
98.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
99.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
100.	Contribution of REM sleep to Fos and FRA expression in the vestibular nuclei of rat leading to vestibular adaptation during the STS-90 Neurolab Mission.	Pompeiano O Arch Ital Biol. 2007 Jan;145(1):55-85.
101.	Cell selective induction and transcriptional activation of immediate early genes by hypoxia.	Prabhakar NR, etal., Brain Res. 1995 Oct 30;697(1-2):266-70. doi: 10.1016/0006-8993(95)00994-2.
102.	Constitutive activation of transcription factor AP-1 in cervical cancer and suppression of human papillomavirus (HPV) transcription and AP-1 activity in HeLa cells by curcumin.	Prusty BK and Das BC, Int J Cancer. 2005 Mar 1;113(6):951-60.
103.	Effects of electroacupuncture on expression of c-fos protein and N-methyl-D-aspartate receptor 1 in the rostral ventromedial medulla of rats with chronic visceral hyperalgesia.	Qi DB and Li WM, Zhong Xi Yi Jie He Xue Bao. 2012 Apr;10(4):416-23. doi: 10.3736/jcim20120410.
104.	Reduced adrenal activation in a rat line selected for high alcohol sensitivity.	Raatesalmi K, etal., Alcohol Clin Exp Res. 2002 Sep;26(9):1344-9. doi: 10.1097/01.ALC.0000030560.28034.5D.
105.	GOA pipeline	RGD automated data pipeline
106.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
107.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
108.	Expression of transcription factors CREB and c-Fos in the brains of terminal Creutzfeldt-Jakob disease cases.	Rodriguez A and Ferrer I, Neurosci Lett. 2007 Jun 21;421(1):10-5. Epub 2007 May 4.
109.	The moonlighting protein c-Fos activates lipid synthesis in neurons, an activity that is critical for cellular differentiation and cortical development.	Rodríguez-Berdini L, etal., J Biol Chem. 2020 Jun 26;295(26):8808-8818. doi: 10.1074/jbc.RA119.010129. Epub 2020 May 8.
110.	Amphetamine and pseudoephedrine cross-tolerance measured by c-Fos protein expression in brains of chronically treated rats.	Ruksee N, etal., BMC Neurosci. 2008 Oct 6;9:99. doi: 10.1186/1471-2202-9-99.
111.	ITF expression in mouse brain during acquisition of alcohol self-administration.	Ryabinin AE, etal., Brain Res. 2001 Jan 26;890(1):192-5. doi: 10.1016/s0006-8993(00)03251-0.
112.	Interfering with Fos expression in rat perirhinal cortex impairs recognition memory.	Seoane A, etal., Hippocampus. 2012 Nov;22(11):2101-13. doi: 10.1002/hipo.22028. Epub 2012 Apr 25.
113.	Regulation of AP1 (Jun/Fos) factor expression and activation in ovarian granulosa cells. Relation of JunD and Fra2 to terminal differentiation.	Sharma SC and Richards JS, J Biol Chem. 2000 Oct 27;275(43):33718-28.
114.	Involvement of AMPA/Kainate Glutamate Receptor in the Extinction and Reinstatement of Morphine-Induced Conditioned Place Preference: A Behavioral and Molecular Study.	Siahposht-Khachaki A, etal., Cell Mol Neurobiol. 2017 Mar;37(2):315-328. doi: 10.1007/s10571-016-0371-2. Epub 2016 Apr 6.
115.	Effect of postnatal treadmill exercise on c-Fos expression in the hippocampus of rat pups born from the alcohol-intoxicated mothers.	Sim YJ, etal., Brain Dev. 2008 Feb;30(2):118-25. doi: 10.1016/j.braindev.2007.07.003. Epub 2007 Aug 27.
116.	Improved survival in patients with advanced colorectal carcinoma failing 5-fluorouracil who received irinotecan hydrochloride and have high intratumor C-fos expression.	Singh A, etal., Am J Clin Oncol. 1998 Oct;21(5):466-9.
117.	c-Fos downregulation positively regulates EphA5 expression in a congenital hypothyroidism rat model.	Song H, etal., J Mol Histol. 2018 Apr;49(2):147-155. doi: 10.1007/s10735-018-9754-7. Epub 2018 Jan 12.
118.	Neonatal hypoxic-ischemic encephalopathy reduces c-Fos activation in the rat hippocampus: evidence of a long-lasting effect.	Souza A, etal., Int J Dev Neurosci. 2014 Nov;38:213-22. doi: 10.1016/j.ijdevneu.2014.09.003. Epub 2014 Sep 27.
119.	Effects of all-trans retinoic acid as a potential chemopreventive agent on the formation of azoxymethane-induced aberrant crypt foci: differential expression of c-myc and c-fos MRNA and protein.	Stopera SA and Bird RP, Int J Cancer. 1993 Mar 12;53(5):798-803.
120.	Colonic aberrant crypt foci are associated with increased expression of c-fos: the possible role of modified c-fos expression in preneoplastic lesions in colon cancer.	Stopera SA, etal., Carcinogenesis. 1992 Apr;13(4):573-8.
121.	Activation of the cAMP pathway synergistically increases IL-1-induced IL-6 gene expression in FRTL-5 thyroid cells: involvement of AP-1 transcription factors.	Szabo-Fresnais N, etal., Mol Cell Endocrinol. 2008 Mar 12;284(1-2):28-37. Epub 2008 Jan 8.
122.	Differential activation of c‑Fos in the paraventricular nuclei of the hypothalamus and thalamus following myocardial infarction in rats.	Tae HJ, etal., Mol Med Rep. 2016 Oct;14(4):3503-8. doi: 10.3892/mmr.2016.5731. Epub 2016 Sep 7.
123.	Endogenous prolactin-releasing peptide regulates food intake in rodents.	Takayanagi Y, etal., J Clin Invest. 2008 Dec;118(12):4014-24. doi: 10.1172/JCI34682. Epub 2008 Nov 3.
124.	Suppression of c-fos induction in the nucleus accumbens prevents acquisition but not expression of morphine-conditioned place preference.	Tolliver BK, etal., Eur J Neurosci. 2000 Sep;12(9):3399-406. doi: 10.1046/j.1460-9568.2000.00214.x.
125.	Colonic inflammation induces fos expression in the thoracolumbar spinal cord increasing activity in the spinoparabrachial pathway.	Traub RJ and Murphy A, Pain 2002 Jan;95(1-2):93-102.
126.	Immunohistochemistry of cerebellar seizures: mossy fiber afferents play an important role in seizure spread and initiation in the rat.	Tóth Z, etal., Acta Histochem. 2015 Jan;117(1):47-55. doi: 10.1016/j.acthis.2014.11.002. Epub 2014 Nov 22.
127.	Non-competitive antagonists of NMDA and AMPA receptors decrease seizure-induced c-fos protein expression in the cerebellum and protect against seizure symptoms in adult rats.	Tóth Z, etal., Acta Histochem. 2018 Apr;120(3):236-241. doi: 10.1016/j.acthis.2018.02.004. Epub 2018 Feb 22.
128.	JNK signalling regulates antioxidant responses in neurons.	Ugbode C, etal., Redox Biol. 2020 Oct;37:101712. doi: 10.1016/j.redox.2020.101712. Epub 2020 Sep 4.
129.	Transient expression of E1A and Ras oncogenes causes downregulation of c-fos gene transcription in nontransformed REF52 cells.	Usenko T, etal., Oncogene 2003 Oct 23;22(48):7661-6.
130.	Basic fibroblast growth factor stimulates collagenase-3 promoter activity in osteoblasts through an activator protein-1-binding site.	Varghese S, etal., Endocrinology. 2000 Jun;141(6):2185-91.
131.	[Electroacupuncture improves intestinal function by down-regulating expression of 5-HT1AR and c-fos proteins in the hypothalamus and colon tissues via brain-gut axis in rats with functional diarrhea].	Wang Q, etal., Zhen Ci Yan Jiu. 2019 Jul 25;44(7):501-5. doi: 10.13702/j.1000-0607.180023.
132.	Chronic alcohol intake reduces retinoic acid concentration and enhances AP-1 (c-Jun and c-Fos) expression in rat liver.	Wang XD, etal., Hepatology. 1998 Sep;28(3):744-50. doi: 10.1002/hep.510280321.
133.	Different pattern of brain c-Fos expression following re-exposure to ethanol or sucrose self-administration environment.	Wedzony K, etal., Naunyn Schmiedebergs Arch Pharmacol. 2003 Nov;368(5):331-41. doi: 10.1007/s00210-003-0811-7. Epub 2003 Oct 22.
134.	Effect of the traditional Chinese medicine Qi Teng Xiao Zhuo granules on chronic glomerulonephritis rats studied by using long noncoding RNAs expression profiling.	Wei LB, etal., Gene. 2020 Feb 20;728:144279. doi: 10.1016/j.gene.2019.144279. Epub 2019 Dec 9.
135.	Restraint-induced fra-2 and c-fos expression in the rat forebrain: relationship to stress duration.	Weinberg MS, etal., Neuroscience. 2007 Dec 5;150(2):478-86. Epub 2007 Sep 14.
136.	Cardiac gene expression profile in rats with terminal heart failure and cachexia.	Wellner M, etal., Physiol Genomics. 2005 Feb 10;20(3):256-67. Epub 2004 Dec 28.
137.	Binge ethanol effects on prefrontal cortex neurons, spatial working memory and task-induced neuronal activation in male and female rats.	West RK, etal., Physiol Behav. 2018 May 1;188:79-85. doi: 10.1016/j.physbeh.2018.01.027. Epub 2018 Jan 31.
138.	Gender-specific effects of social housing on chronic stress-induced limbic Fos expression.	Westenbroek C, etal., Neuroscience 2003;121(1):189-99.
139.	The galanin receptor-3 antagonist, SNAP 37889, inhibits cue-induced reinstatement of alcohol-seeking and increases c-Fos expression in the nucleus accumbens shell of alcohol-preferring rats.	Wilson KE, etal., J Psychopharmacol. 2018 Aug;32(8):911-921. doi: 10.1177/0269881118780015. Epub 2018 Jun 21.
140.	The differential molecular mechanisms underlying proenkephalin mRNA expression induced by forskolin and phorbol-12-myristic-13-acetate in primary cultured astrocytes.	Won JS and Suh HW, Brain Res Mol Brain Res. 2000 Dec 8;84(1-2):41-51.
141.	The comparative analysis of proenkephalin mRNA expression induced by cholera toxin and pertussis toxin in primary cultured rat cortical astrocytes.	Won JS and Suh HW, Brain Res Mol Brain Res. 2001 Mar 31;88(1-2):83-93.
142.	c-Fos is upregulated in the genital tubercle of DEHP-induced hypospadiac rats and the prepuce of patients with hypospadias.	Xiang H, etal., Syst Biol Reprod Med. 2021 Jun;67(3):193-200. doi: 10.1080/19396368.2020.1862356. Epub 2021 Feb 22.
143.	Alterations of estradiol-induced histone H3 acetylation in the preoptic area and anteroventral periventricular nucleus of middle-aged female rats.	Xu W, etal., Biochem Biophys Res Commun. 2019 Aug 27;516(3):894-899. doi: 10.1016/j.bbrc.2019.06.145. Epub 2019 Jul 1.
144.	Vesicular glutamate transporter-3 contributes to visceral hyperalgesia induced by Trichinella spiralis infection in rats.	Yang CQ, etal., Dig Dis Sci. 2012 Apr;57(4):865-72. doi: 10.1007/s10620-011-1970-x. Epub 2011 Dec 9.
145.	Paecilomycies japonica reduces repeated nicotine-induced neuronal and behavioral activation in rats.	Ye M, etal., BMC Complement Altern Med. 2015 Jul 14;15:227. doi: 10.1186/s12906-015-0739-8.
146.	The effect of c-fos on acute myocardial infarction and the significance of metoprolol intervention in a rat model.	Zhang S, etal., Cell Biochem Biophys. 2013 Mar;65(2):249-55. doi: 10.1007/s12013-012-9428-0.
147.	Calcitonin gene-related peptide facilitates sensitization of the vestibular nucleus in a rat model of chronic migraine.	Zhang Y, etal., J Headache Pain. 2020 Jun 10;21(1):72. doi: 10.1186/s10194-020-01145-y.
148.	c-Fos is a mechanosensor that regulates inflammatory responses and lung barrier dysfunction during ventilator-induced acute lung injury.	Zhou L, etal., BMC Pulm Med. 2022 Jan 6;22(1):9. doi: 10.1186/s12890-021-01801-2.
149.	Target organ protection from a novel angiotensin II receptor (AT1) vaccine ATR12181 in spontaneously hypertensive rats.	Zhu F, etal., Cell Mol Immunol. 2006 Apr;3(2):107-14.

Additional References at PubMed

PMID:1298921	PMID:7990028	PMID:8206384	PMID:9098922	PMID:9294610	PMID:9732876	PMID:9847304	PMID:9879931	PMID:10508860	PMID:10523647	PMID:10704222	PMID:11053448
PMID:11747369	PMID:11766904	PMID:11860940	PMID:11861123	PMID:11925568	PMID:11939505	PMID:12064606	PMID:12121970	PMID:12184859	PMID:12220541	PMID:12370534	PMID:12384476
PMID:12429561	PMID:12443984	PMID:12486129	PMID:12528378	PMID:12531532	PMID:12535784	PMID:12606042	PMID:12629509	PMID:12714357	PMID:12787062	PMID:12802426	PMID:12834907
PMID:12943993	PMID:14625026	PMID:14674859	PMID:14757116	PMID:14767061	PMID:14979778	PMID:15014501	PMID:15024755	PMID:15033433	PMID:15044536	PMID:15051527	PMID:15115808
PMID:15136564	PMID:15189768	PMID:15249992	PMID:15254773	PMID:15306261	PMID:15334681	PMID:15380004	PMID:15453261	PMID:15458969	PMID:15522236	PMID:15609068	PMID:15701816
PMID:15702242	PMID:15748507	PMID:15842237	PMID:15922053	PMID:15926928	PMID:16039502	PMID:16055265	PMID:16095819	PMID:16097052	PMID:16110275	PMID:16130823	PMID:16169531
PMID:16259361	PMID:16344157	PMID:16531639	PMID:16547969	PMID:16555238	PMID:16604387	PMID:16633904	PMID:16850590	PMID:16926533	PMID:16927803	PMID:16962079	PMID:17005860
PMID:17006656	PMID:17020011	PMID:17101878	PMID:17111371	PMID:17120244	PMID:17147208	PMID:17152352	PMID:17194726	PMID:17216194	PMID:17217916	PMID:17218446	PMID:17244536
PMID:17393298	PMID:17448703	PMID:17482654	PMID:17504975	PMID:17506118	PMID:17513031	PMID:17514764	PMID:17524563	PMID:17551755	PMID:17553714	PMID:17562390	PMID:17592200
PMID:17622784	PMID:17654838	PMID:17661378	PMID:17669374	PMID:17681951	PMID:17706947	PMID:17828499	PMID:17850462	PMID:17853060	PMID:17873368	PMID:17884026	PMID:17936859
PMID:18030677	PMID:18067977	PMID:18092182	PMID:18097765	PMID:18172855	PMID:18197392	PMID:18255166	PMID:18264770	PMID:18282559	PMID:18282728	PMID:18289515	PMID:18292448
PMID:18349210	PMID:18374995	PMID:18385988	PMID:18390209	PMID:18395612	PMID:18396266	PMID:18401735	PMID:18404982	PMID:18405607	PMID:18513320	PMID:18571897	PMID:18576208
PMID:18596606	PMID:18615585	PMID:18706934	PMID:18717731	PMID:18755745	PMID:18761364	PMID:18784083	PMID:18822274	PMID:18823956	PMID:18846332	PMID:18854993	PMID:18973603
PMID:19013218	PMID:19013506	PMID:19015001	PMID:19041662	PMID:19051121	PMID:19120105	PMID:19135129	PMID:19180197	PMID:19180910	PMID:19194492	PMID:19225867	PMID:19232381
PMID:19255142	PMID:19270309	PMID:19285114	PMID:19309441	PMID:19365557	PMID:19383518	PMID:19397204	PMID:19409426	PMID:19428634	PMID:19463813	PMID:19484338	PMID:19524553
PMID:19536505	PMID:19538471	PMID:19540880	PMID:19544747	PMID:19548582	PMID:19559985	PMID:19596457	PMID:19620067	PMID:19633138	PMID:19716862	PMID:19722155	PMID:19723547
PMID:19777800	PMID:19782659	PMID:19843805	PMID:19847806	PMID:19850746	PMID:19915516	PMID:20045008	PMID:20051354	PMID:20079346	PMID:20100550	PMID:20114033	PMID:20302893
PMID:20359502	PMID:20442316	PMID:20600641	PMID:20608965	PMID:20663035	PMID:20688121	PMID:20732311	PMID:20734160	PMID:20809981	PMID:20832430	PMID:20848228	PMID:21059365
PMID:21061149	PMID:21092560	PMID:21097414	PMID:21135158	PMID:21155252	PMID:21171326	PMID:21174797	PMID:21179853	PMID:21180049	PMID:21180051	PMID:21184750	PMID:21186627
PMID:21225009	PMID:21285311	PMID:21287731	PMID:21319893	PMID:21340718	PMID:21341886	PMID:21376756	PMID:21404708	PMID:21439021	PMID:21507338	PMID:21524663	PMID:21525724
PMID:21609285	PMID:21723961	PMID:21736812	PMID:21925583	PMID:22000863	PMID:22094385	PMID:22097274	PMID:22147266	PMID:22178607	PMID:22284419	PMID:22323725	PMID:22387553
PMID:22432135	PMID:22446013	PMID:22455809	PMID:22456943	PMID:22462413	PMID:22516520	PMID:22521827	PMID:22534624	PMID:22611921	PMID:22613772	PMID:22693577	PMID:22771876
PMID:22792289	PMID:22846568	PMID:22851043	PMID:22917527	PMID:22960202	PMID:22982514	PMID:23018815	PMID:23158763	PMID:23181383	PMID:23183219	PMID:23195113	PMID:23233946
PMID:23306170	PMID:23333670	PMID:23395171	PMID:23591003	PMID:23593280	PMID:23624190	PMID:23660497	PMID:23818940	PMID:23870463	PMID:23922220	PMID:23980096	PMID:24023832
PMID:24049115	PMID:24118230	PMID:24184327	PMID:24292370	PMID:24308227	PMID:24316406	PMID:24321404	PMID:24333564	PMID:24567082	PMID:24598462	PMID:24915133	PMID:24939298
PMID:24978397	PMID:25031700	PMID:25354492	PMID:25446350	PMID:25474904	PMID:25592718	PMID:25674230	PMID:25710066	PMID:26072392	PMID:26082062	PMID:26087133	PMID:26216073
PMID:26314630	PMID:26452320	PMID:26475860	PMID:26514923	PMID:26774022	PMID:27028464	PMID:27030665	PMID:27078100	PMID:27164028	PMID:27239846	PMID:27384705	PMID:27865919
PMID:27923581	PMID:28185007	PMID:28469203	PMID:28472857	PMID:28634074	PMID:28730575	PMID:28764933	PMID:29093345	PMID:29165002	PMID:29214513	PMID:29225069	PMID:29450645
PMID:29938674	PMID:30244018	PMID:30851318	PMID:31257474	PMID:31364821	PMID:31373119	PMID:31408622	PMID:31968225	PMID:32235506	PMID:32702030	PMID:32785417	PMID:33183026
PMID:33212101	PMID:33239732	PMID:33940958	PMID:35244314	PMID:36152451	PMID:36216550	PMID:36343695	PMID:36344400	PMID:36690096	PMID:37567256	PMID:37858915	PMID:38228055
PMID:38338735

Genomics

Comparative Map Data

Fos
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	110,852,188 - 110,855,054 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	6	110,852,190 - 110,855,598 (+)	Ensembl				GRCr8
mRatBN7.2	6	105,121,170 - 105,124,036 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	105,121,170 - 105,124,036 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	6	105,290,640 - 105,293,508 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	105,589,531 - 105,592,399 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	104,959,176 - 104,962,044 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	109,300,433 - 109,303,299 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	109,300,433 - 109,303,299 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	6	116,249,742 - 116,252,608 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	6	109,559,135 - 109,562,001 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	6	102,942,464 - 102,945,330 (+)	NCBI		Celera
RGSC_v3.1	6	109,562,609 - 109,566,002 (+)	NCBI
Cytogenetic Map	6	q31	NCBI

FOS
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	14	75,278,828 - 75,282,230 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	14	75,278,826 - 75,283,190 (+)	Ensembl			hg38	GRCh38
GRCh37	14	75,745,531 - 75,748,933 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	14	74,815,284 - 74,818,666 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	14	74,815,283 - 74,818,666	NCBI
Celera	14	55,783,567 - 55,787,023 (+)	NCBI		Celera
Cytogenetic Map	14	q24.3	NCBI
HuRef	14	55,913,924 - 55,917,380 (+)	NCBI		HuRef
CHM1_1	14	75,683,266 - 75,686,721 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	14	69,488,228 - 69,491,630 (+)	NCBI		T2T-CHM13v2.0

Fos
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	12	85,520,664 - 85,524,048 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	12	85,520,664 - 85,524,047 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	12	85,473,890 - 85,477,274 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	12	85,473,890 - 85,477,273 (+)	Ensembl			mm10	GRCm38
MGSCv37	12	86,814,851 - 86,818,219 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	12	86,363,004 - 86,366,372 (+)	NCBI		MGSCv36	mm8
Celera	12	86,933,225 - 86,936,593 (+)	NCBI		Celera
Cytogenetic Map	12	D2	NCBI
cM Map	12	39.7	NCBI

Fos
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955523	305,728 - 310,728 (-)	Ensembl
ChiLan1.0	NW_004955523	307,181 - 310,728 (-)	NCBI	ChiLan1.0	ChiLan1.0

FOS
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	15	76,362,508 - 76,366,629 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	14	75,579,607 - 75,583,133 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	14	55,832,570 - 55,835,984 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	14	74,676,316 - 74,679,766 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	14	74,676,316 - 74,679,766 (+)	Ensembl			panPan2	panpan1.1

FOS
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	8	48,330,856 - 48,334,273 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	8	48,331,026 - 48,333,467 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	8	48,014,730 - 48,018,137 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	8	48,558,356 - 48,561,763 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	8	48,558,343 - 48,561,758 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	8	48,229,017 - 48,232,423 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	8	48,250,295 - 48,253,702 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	8	48,649,028 - 48,652,435 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Fos
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	27,680,843 - 27,684,228 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936488	4,384,705 - 4,388,122 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936488	4,384,710 - 4,388,118 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

FOS
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	98,449,349 - 98,455,554 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	7	98,449,508 - 98,451,971 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	104,293,828 - 104,296,291 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

FOS
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	24	52,497,465 - 52,501,161 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	24	52,497,521 - 52,501,514 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666053	40,725,132 - 40,728,594 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Fos
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624734	26,423,079 - 26,427,732 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624734	26,424,053 - 26,427,431 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Fos
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	7	99,575,709 - 99,579,136 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Fos
11 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	143
Count of miRNA genes:	105
Interacting mature miRNAs:	116
Transcripts:	ENSRNOT00000010712
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
4145119	Mcs25	Mammary carcinoma susceptibility QTL 25		0.0001	mammary gland integrity trait (VT:0010552)	ratio of deaths to total study population during a period of time (CMO:0001023)	6	71278722	116278722	Rat
2293088	Iddm28	Insulin dependent diabetes mellitus QTL 28	5.21		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	6	68767270	135411972	Rat
1331799	Bp211	Blood pressure QTL 211	3.66407		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	6	88019181	136741135	Rat
10054138	Gmadr3	Adrenal mass QTL 3	3.68	0.00045	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	6	90871046	135871046	Rat
1581563	Uae33	Urinary albumin excretion QTL 33			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	93560258	136550638	Rat
1641917	Colcr5	Colorectal carcinoma resistance QTL 5	3.18	0.0009	intestine integrity trait (VT:0010554)	benign colorectal tumor number (CMO:0001795)	6	98944780	143944780	Rat
61414	Pia3	Pristane induced arthritis QTL 3	4.5		joint integrity trait (VT:0010548)	post-insult time to onset of experimental arthritis (CMO:0001450)	6	100704576	136029228	Rat
724524	Uae2	Urinary albumin excretion QTL 2	2.7	0.0005	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	79198463	144254945	Rat
1358355	Srcrt4	Stress Responsive Cort QTL 4	6.39		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	6	106095977	147156653	Rat
737827	Hcar11	Hepatocarcinoma resistance QTL 11	4.4		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	6	46050607	116278722	Rat
2303624	Vencon5	Ventilatory control QTL 5	4.45		respiration trait (VT:0001943)	minute ventilation (CMO:0000132)	6	93778632	138778632	Rat
1576309	Emca7	Estrogen-induced mammary cancer QTL 7	4		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	6	20859430	113082285	Rat
61329	Eae9	Experimental allergic encephalomyelitis QTL 9	3.7		body mass (VT:0001259)	change in body weight (CMO:0002045)	6	84490437	129490437	Rat
10054123	Srcrt6	Stress Responsive Cort QTL 6	2.5	0.0043	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	6	90871046	135871046	Rat
724536	Uae7	Urinary albumin excretion QTL 7	3.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	6	93560258	136550638	Rat
2313399	Anxrr28	Anxiety related response QTL 28			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	6	101593607	138161926	Rat
1576302	Schws4	Schwannoma susceptibility QTL 4		0.0078	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	6	78204640	123204640	Rat
1581550	Pur8	Proteinuria QTL 8			urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	6	93560258	136550638	Rat
1300075	Glom7	Glomerulus QTL 7	5.6	0.0000002	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	6	76937178	121937178	Rat
1331789	Rf37	Renal function QTL 37	3.224		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	6	86494122	112380234	Rat
1331725	Bp212	Blood pressure QTL 212	3.52475		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	6	99437079	125323237	Rat
12801471	Schws9	Schwannoma susceptibility QTL 9			nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	6	101593607	146593607	Rat
1331722	Thshl1	Thyroid stimulating hormone level QTL 1	11.7	0.0001	blood thyroid-stimulating hormone amount (VT:0005119)	serum thyroid stimulating hormone level (CMO:0001248)	6	99708426	112483760	Rat

Markers in Region

Fos

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	105,122,222 - 105,122,470 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	109,301,486 - 109,301,733	NCBI	Rnor6.0
Rnor_5.0	6	116,251,308 - 116,251,555	UniSTS	Rnor5.0
RGSC_v3.4	6	109,560,188 - 109,560,435	UniSTS	RGSC3.4
Celera	6	102,943,517 - 102,943,764	UniSTS
Cytogenetic Map	6	q31	UniSTS

WI-19801

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	105,123,847 - 105,124,149 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	109,303,111 - 109,303,412	NCBI	Rnor6.0
Rnor_5.0	6	116,249,629 - 116,249,930	UniSTS	Rnor5.0
RGSC_v3.4	6	109,561,813 - 109,562,114	UniSTS	RGSC3.4
Celera	6	102,945,142 - 102,945,443	UniSTS
Cytogenetic Map	6	q31	UniSTS

PMC151804P3

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	105,122,906 - 105,123,431 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	109,302,170 - 109,302,694	NCBI	Rnor6.0
Rnor_5.0	6	116,250,347 - 116,250,871	UniSTS	Rnor5.0
RGSC_v3.4	6	109,560,872 - 109,561,396	UniSTS	RGSC3.4
Celera	6	102,944,201 - 102,944,725	UniSTS
Cytogenetic Map	6	q31	UniSTS

PMC108124P1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	105,122,435 - 105,123,350 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	109,301,699 - 109,302,613	NCBI	Rnor6.0
Rnor_5.0	6	116,250,428 - 116,251,342	UniSTS	Rnor5.0
RGSC_v3.4	6	109,560,401 - 109,561,315	UniSTS	RGSC3.4
Celera	6	102,943,730 - 102,944,644	UniSTS
Cytogenetic Map	6	q31	UniSTS

PMC321436P2

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	6	110,853,933 - 110,854,154 (+)	Marker Load Pipeline
mRatBN7.2	6	105,122,914 - 105,123,136 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	109,302,178 - 109,302,399	NCBI	Rnor6.0
Rnor_5.0	6	116,250,642 - 116,250,863	UniSTS	Rnor5.0
RGSC_v3.4	6	109,560,880 - 109,561,101	UniSTS	RGSC3.4
Celera	6	102,944,209 - 102,944,430	UniSTS
Cytogenetic Map	6	q31	UniSTS

PMC99986P2

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	105,120,896 - 105,121,180 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	109,300,160 - 109,300,443	NCBI	Rnor6.0
Rnor_5.0	6	116,252,598 - 116,252,881	UniSTS	Rnor5.0
RGSC_v3.4	6	109,558,862 - 109,559,145	UniSTS	RGSC3.4
Celera	6	102,942,191 - 102,942,474	UniSTS
Cytogenetic Map	6	q31	UniSTS

BP240034A10G4

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	105,124,058 - 105,124,364 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	109,303,322 - 109,303,627	NCBI	Rnor6.0
Rnor_5.0	6	116,249,414 - 116,249,719	UniSTS	Rnor5.0
RGSC_v3.4	6	109,562,024 - 109,562,329	UniSTS	RGSC3.4
Celera	6	102,945,353 - 102,945,658	UniSTS
Cytogenetic Map	6	q31	UniSTS

Fos

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	105,124,316 - 105,124,496 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	109,303,580 - 109,303,759	NCBI	Rnor6.0
Rnor_5.0	6	116,249,282 - 116,249,461	UniSTS	Rnor5.0
RGSC_v3.4	6	109,562,282 - 109,562,461	UniSTS	RGSC3.4
Celera	6	102,945,611 - 102,945,790	UniSTS
Cytogenetic Map	6	q31	UniSTS

Fos

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	105,124,370 - 105,124,546 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	109,303,634 - 109,303,809	NCBI	Rnor6.0
Rnor_5.0	6	116,249,232 - 116,249,407	UniSTS	Rnor5.0
RGSC_v3.4	6	109,562,336 - 109,562,511	UniSTS	RGSC3.4
Celera	6	102,945,665 - 102,945,840	UniSTS
Cytogenetic Map	6	q31	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_022197	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF126534	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF277645	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY780201	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY780202	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY780203	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY786174	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY828998	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY828999	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473982	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ089699	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ225996	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228884	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000006	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M34001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U02631	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000010712 ⟹ ENSRNOP00000010712

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	6	110,852,190 - 110,855,598 (+)	Ensembl
mRatBN7.2 Ensembl	6	105,121,170 - 105,124,036 (+)	Ensembl
Rnor_6.0 Ensembl	6	109,300,433 - 109,303,299 (+)	Ensembl

RefSeq Acc Id:

NM_022197 ⟹ NP_071533

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	110,852,188 - 110,855,054 (+)	NCBI
mRatBN7.2	6	105,121,170 - 105,124,036 (+)	NCBI
Rnor_6.0	6	109,300,433 - 109,303,299 (+)	NCBI
Rnor_5.0	6	116,249,742 - 116,252,608 (-)	NCBI
RGSC_v3.4	6	109,559,135 - 109,562,001 (+)	RGD
Celera	6	102,942,464 - 102,945,330 (+)	RGD

Sequence:

show sequence

CCAACCGCGATTGCAGCTAGCAACTGAGAAGACTGGATAGAGCCGGCGGAGCCGCGAACGAGCA
GTGACCGCGCTCCCACCCAGCTCTGCTCTGCAGCTCCCACCAGTGTCTACCCCTGGACCCCTCG
CCGAGCTTTGCCCAAACCACGACCATGATGTTCTCGGGTTTCAACGCGGACTACGAGGCGTCAT
CCTCCCGCTGCAGTAGCGCCTCCCCGGCCGGGGACAGCCTTTCCTACTACCATTCCCCAGCCGA
CTCCTTCTCCAGCATGGGCTCCCCTGTCAACACACAGGACTTTTGCGCAGATCTGTCCGTCTCT
AGTGCCAACTTTATCCCCACGGTGACAGCCATCTCCACCAGCCCAGACCTGCAGTGGCTGGTGC
AGCCCACTCTGGTCTCCTCCGTGGCCCCATCGCAGACCAGAGCGCCCCATCCTTACGGACTCCC
CACCCCGTCGACCGGGGCTTACGCCAGAGCGGGAGTGGTGAAGACCATGTCAGGCGGCAGAGCG
CAGAGCATCGGCAGAAGGGGCAAAGTAGAGCAGCTATCTCCTGAAGAGGAAGAGAAACGGAGAA
TCCGAAGGGAAAGGAATAAGATGGCTGCAGCCAAGTGCCGGAATCGGAGGAGGGAGCTGACAGA
TACGCTCCAAGCGGAGACAGATCAACTTGAAGACGAGAAGTCTGCGTTGCAGACCGAGATTGCC
AATCTACTGAAAGAGAAGGAAAAACTGGAGTTTATTTTGGCAGCCCACCGACCTGCCTGCAAGA
TCCCCAATGACCTGGGCTTCCCAGAGGAGATGTCTGTGACCTCCCTGGACTTGACTGGGGGTCT
GCCTGAGGCTACCACCCCAGAGTCTGAGGAGGCCTTCACCCTGCCTCTTCTCAATGACCCTGAG
CCCAAGCCATCCTTGGAGCCGGTCAAGAACATTAGCAACATGGAGCTGAAGGCTGAACCCTTTG
ATGACTTCTTGTTTCCGGCATCATCTAGGCCCAGTGGCTCGGAGACTGCCCGCTCTGTGCCAGA
TGTGGACCTGTCTGGTTCCTTCTATGCAGCAGACTGGGAGCCTCTGCACAGCAGTTCCCTGGGG
ATGGGGCCCATGGTCACAGAGCTGGAGCCCCTGTGCACTCCCGTTGTCACCTGCACTCCCAGCT
GCACTACCTATACGTCTTCCTTTGTCTTCACCTACCCCGAGGCTGACTCCTTCCCTAGCTGCGC
AGCTGCCCACCGAAAGGGCAGCAGCAGCAACGAGCCCTCCTCTGACTCACTGAGCTCGCCCACA
CTGCTAGCCCTGTGAGCAGTCAGAGAAGGCAGGGCAGCCGGCACTGACTGAGCTGGTGCATTAC
AGAGAGAAGAAACAAGTCTTCCCTCGAGGGGTTCCCGTAGACCTAGGGAGGACCTTATCTGTGC
GTGAAACACACCAGGCTGTGGACCTCAAGGACTTGAAAGCATCCACATCTGGACTCCAGTCCTC
ACCTCTTCCGGAGATGTAGCAAAAAAACAAAAAAACAAAACAAAAAAAAAACAAAACAAAAAAT
CAAAAGCAACCGCATGGAGTGTATTGTTTGTAGTGACACCTGAGAGCTGGTAG

hide sequence

Protein Sequences


Protein RefSeqs	NP_071533	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA42348	(Get FASTA)	NCBI Sequence Viewer
	AAG47951	(Get FASTA)	NCBI Sequence Viewer
	AAV33852	(Get FASTA)	NCBI Sequence Viewer
	AAV33853	(Get FASTA)	NCBI Sequence Viewer
	AAV33854	(Get FASTA)	NCBI Sequence Viewer
	AAV41063	(Get FASTA)	NCBI Sequence Viewer
	AAW65541	(Get FASTA)	NCBI Sequence Viewer
	AAW65542	(Get FASTA)	NCBI Sequence Viewer
	AAZ13764	(Get FASTA)	NCBI Sequence Viewer
	EDL81573	(Get FASTA)	NCBI Sequence Viewer
	EDL81574	(Get FASTA)	NCBI Sequence Viewer
	EDL81575	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000010712
	ENSRNOP00000010712.2
GenBank Protein	P12841	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_071533 ⟸ NM_022197

- UniProtKB:

Q4FDN1 (UniProtKB/Swiss-Prot), P12841 (UniProtKB/Swiss-Prot), A6JE29 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNTQDFCADLSVSSANFIPTV
TAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGLPTPSTGAYARAGVVKTMSGGRAQSIGRRGK
VEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEK
LEFILAAHRPACKIPNDLGFPEEMSVTSLDLTGGLPEATTPESEEAFTLPLLNDPEPKPSLEPV
KNISNMELKAEPFDDFLFPASSRPSGSETARSVPDVDLSGSFYAADWEPLHSSSLGMGPMVTEL
EPLCTPVVTCTPSCTTYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLAL

hide sequence

Ensembl Acc Id:

ENSRNOP00000010712 ⟸ ENSRNOT00000010712

Protein Domains

bZIP

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P12841-F1-model_v2	AlphaFold	P12841	1-380	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13694742

Promoter ID:

EPDNEW_R5267

Type:

single initiation site

Name:

Fos_1

Description:

Fos proto-oncogene, AP-1 transcription factor subunit

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	6	109,300,435 - 109,300,495	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:2626	AgrOrtholog
BioCyc Gene	G2FUF-36778	BioCyc
Ensembl Genes	ENSRNOG00000008015	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000010712	ENTREZGENE
	ENSRNOT00000010712.4	UniProtKB/Swiss-Prot
Gene3D-CATH	1.20.5.170	UniProtKB/Swiss-Prot
InterPro	AP-1	UniProtKB/Swiss-Prot
	bZIP	UniProtKB/Swiss-Prot
	bZIP_sf	UniProtKB/Swiss-Prot
KEGG Report	rno:314322	UniProtKB/Swiss-Prot
NCBI Gene	Fos	ENTREZGENE
PANTHER	PTHR23351	UniProtKB/Swiss-Prot
	PTHR23351:SF4	UniProtKB/Swiss-Prot
Pfam	bZIP_1	UniProtKB/Swiss-Prot
PhenoGen	Fos	PhenoGen
PRINTS	LEUZIPPRFOS	UniProtKB/Swiss-Prot
PROSITE	BZIP	UniProtKB/Swiss-Prot
	BZIP_BASIC	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000008015	RatGTEx
SMART	BRLZ	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF57959	UniProtKB/Swiss-Prot
UniProt	A6JE29	ENTREZGENE, UniProtKB/TrEMBL
	A6JE31_RAT	UniProtKB/TrEMBL
	FOS_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q4FDN1	ENTREZGENE
	Q5G6W2_RAT	UniProtKB/TrEMBL
	Q5G6W3_RAT	UniProtKB/TrEMBL
	Q5U7E3_RAT	UniProtKB/TrEMBL
	Q5U873_RAT	UniProtKB/TrEMBL
	Q5U874_RAT	UniProtKB/TrEMBL
	Q5U875_RAT	UniProtKB/TrEMBL
UniProt Secondary	Q4FDN1	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2017-03-07	Fos	Fos proto-oncogene, AP-1 transcription factor subunit	Fos	FBJ osteosarcoma oncogene	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-02-15	Fos	FBJ osteosarcoma oncogene	Fos	FBJ murine osteosarcoma viral oncogene homolog	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-02-28	Fos	FBJ murine osteosarcoma viral oncogene homolog	c-fos	c-fos oncogene	Data merged from RGD:735054	737654	APPROVED
2005-01-20	Fos	FBJ murine osteosarcoma viral oncogene homolog		v-fos FBJ murine osteosarcoma viral oncogene homolog	Name updated	1299863	APPROVED
2002-06-10	Fos	v-fos FBJ murine osteosarcoma viral oncogene homolog			Name updated	70585	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_function	may play a role in androgen regulated apoptosis	70259
gene_physical_interaction	forms heterodimeric complexes with proteins of the Jun family which then bind to the AP-1 gene promoter site to regulate gene expression	1302797
gene_process	increases the intracellular calcium ion levels which helps in the degradation of phosphatidyl inositol and activation of protein kinase C	70259
gene_process	increases transcription associated with cell death in prostate regression	70259
gene_regulation	expression is induced in response to airpuff startle in hypothalamus, thalamus, midbrain, pons and medulla	1358971

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

Send us a Message

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)