Advanced Search (OLGA)

Gene: Il10 (interleukin 10) Rattus norvegicus

Analyze

Symbol:

Il10

Name:

interleukin 10

RGD ID:

2886

Description:

Enables interleukin-10 receptor binding activity. Involved in several processes, including cellular response to estradiol stimulus; liver regeneration; and negative regulation of biosynthetic process. Located in extracellular space. Used to study several diseases, including lung disease (multiple); perinatal necrotizing enterocolitis; sciatic neuropathy; toxic encephalopathy; and transient cerebral ischemia. Biomarker of several diseases, including alcohol use disorder; artery disease (multiple); decubitus ulcer; liver disease (multiple); and lung disease (multiple). Human ortholog(s) of this gene implicated in several diseases, including artery disease (multiple); eye disease (multiple); gastrointestinal system cancer (multiple); hematologic cancer (multiple); and liver disease (multiple). Orthologous to human IL10 (interleukin 10); PARTICIPATES IN Interleukin-10 signaling pathway; interleukin-4 signaling pathway; allograft rejection pathway; INTERACTS WITH (+)-pilocarpine; (-)-epigallocatechin 3-gallate; (2E,4E)-hexa-2,4-dienoic acid.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

CSIF; cytokine synthesis inhibitory factor; If2a; IL-10; IL10X; interferon 2a; interleukin-10

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	IL10 (interleukin 10)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Il10 (interleukin 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Il10 (interleukin 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	IL10 (interleukin 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	IL10 (interleukin 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Il10 (interleukin 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	IL10 (interleukin 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	IL10 (interleukin 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Il10 (interleukin 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Il10 (interleukin 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	PITPNB (phosphatidylinositol transfer protein beta)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Il10 (interleukin 10)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Il10 (interleukin 10)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	IL10 (interleukin 10)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	IL10 (interleukin 10)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	il10 (interleukin 10)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	il10 (interleukin 10)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	il10	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	il10	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	45,024,921 - 45,029,586 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	13	45,025,087 - 45,029,580 (+)	Ensembl				GRCr8
mRatBN7.2	13	42,472,625 - 42,477,308 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	42,472,839 - 42,477,313 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	13	45,079,495 - 45,083,368 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	46,367,625 - 46,371,502 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	43,631,889 - 43,635,783 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	47,738,933 - 47,743,392 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	47,739,526 - 47,743,392 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	13	52,824,594 - 52,828,560 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	13	43,953,900 - 43,957,766 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	13	42,821,569 - 42,825,416 (+)	NCBI		Celera
RGSC_v3.1	13	43,967,906 - 43,972,374 (+)	NCBI
Cytogenetic Map	13	q13	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

abdominal aortic aneurysm (IEP)

Actinic Cheilitis (ISO)

Acute Experimental Pancreatitis (IEP)

acute kidney failure (ISO)

Acute Liver Failure (ISO)

Acute Lung Injury (IDA,IEP,ISO)

acute lymphoblastic leukemia (ISO)

acute myeloid leukemia (ISO)

acute myocardial infarction (IEP)

acute pancreatitis (ISO)

adult respiratory distress syndrome (IEP)

adult T-cell leukemia/lymphoma (ISO)

aggressive periodontitis (ISO)

Airway Obstruction (ISO)

alcohol use disorder (IEP)

allergic conjunctivitis (ISO)

allergic contact dermatitis (ISO)

allergic rhinitis (ISO)

Alveolar Bone Loss (IEP)

Alzheimer's disease (ISO)

anemia (ISO)

Animal Disease Models (ISO)

anogenital venereal wart (ISO)

anti-basement membrane glomerulonephritis (IDA)

aphthous stomatitis (ISO)

appendicitis (ISO)

arteriosclerosis (ISO)

Asthenopia (ISO)

asthma (IEP,IGI,ISO)

atherosclerosis (ISO)

atopic dermatitis (ISO)

autistic disorder (ISO)

autoimmune hemolytic anemia (ISO)

autoimmune hepatitis (ISO)

autoimmune thrombocytopenic purpura (ISO)

B-Cell Chronic Lymphocytic Leukemia (ISO)

bacterial infectious disease (ISO)

bacterial pneumonia (ISO)

Behcet's disease (ISO)

Brain Injuries (IDA,ISO)

Breast Neoplasms (ISO)

Bronchial Hyperreactivity (ISO)

bronchus carcinoma (ISO)

Burns (IEP,ISO)

carotid artery disease (ISO)

carotid stenosis (ISO)

celiac disease (ISO)

central nervous system lymphoma (ISO)

cerebral infarction (ISO)

cervical cancer (ISO)

Chagas Cardiomyopathy (IDA)

Chemically-Induced Disorders (ISO)

choroid disease (ISO)

Choroidal Neovascularization (ISO)

Chronic Bronchitis (IEP)

Chronic Hepatitis C (ISO)

chronic myeloid leukemia (ISO)

Chronic Periodontitis (ISO)

colitis (IEP,ISO)

colon cancer (ISO)

common cold (ISO)

congestive heart failure (IEP)

coronary artery disease (ISO)

Coronavirus infectious disease (ISO)

COVID-19 (ISO)

Crohn's disease (ISO)

cutaneous leishmaniasis (ISO)

cytomegalovirus retinitis (ISO)

decubitus ulcer (IEP)

diabetes mellitus (ISO)

Diabetic Cardiomyopathies (IDA)

Diabetic Nephropathies (ISO)

diabetic retinopathy (ISO)

diffuse scleroderma (ISO)

dilated cardiomyopathy (IEP)

disseminated intravascular coagulation (ISO)

drug allergy (ISO)

dry eye syndrome (ISO)

Dysbiosis (IEP)

Dyspepsia (ISO)

Eales Disease (ISO)

endometrial cancer (ISO)

endometriosis (IDA,ISO)

Endotoxemia (IEP,ISO)

Entamoebiasis (ISO)

Enterocolitis (ISO)

Enterovirus Infections (ISO)

esophageal cancer (ISO)

Experimental Arthritis (IDA,IEP,ISO)

Experimental Autoimmune Encephalomyelitis (IDA)

Experimental Autoimmune Myocarditis (IEP)

Experimental Autoimmune Uveitis (IEP,ISO)

Experimental Autoimmune Uveoretinitis (IDA,ISO)

Experimental Colitis (IEP,ISO)

Experimental Diabetes Mellitus (IEP,ISO)

Experimental Liver Cirrhosis (IDA,IMP,ISO)

Experimental Mammary Neoplasms (ISO)

Experimental Radiation Injuries (IDA,IEP)

Eye Burns (IDA)

factor VIII deficiency (ISO)

Fanconi anemia (ISO)

Femoral Fractures (IEP)

gallbladder carcinoma (ISO)

gastric dilatation (ISO)

Gastro-Enteropancreatic Neuroendocrine Tumor (ISO)

Genetic Predisposition to Disease (ISO)

gestational diabetes (ISO)

glomerulonephritis (ISO)

glucosephosphate dehydrogenase deficiency (ISO)

graft-versus-host disease (ISO)

granulomatosis with polyangiitis (ISO)

Graves ophthalmopathy (ISO)

Graves' disease (ISO)

Hearing Loss (IDA,ISO)

Heat Stroke (ISO)

Hemorrhagic Shock (IEP)

Heparin-induced Thrombocytopenia (ISO)

hepatitis B (ISO)

hepatitis C (ISO)

hepatocellular carcinoma (IDA,ISO)

herpes simplex virus keratitis (ISO)

herpes zoster (ISO)

high grade glioma (ISO)

Hodgkin's lymphoma (ISO)

human immunodeficiency virus infectious disease (ISO)

Human Influenza (ISO)

Human Viral Hepatitis (ISO)

Hyperalgesia (IDA,IEP,ISO)

hypertension (IEP)

hyperthyroidism (IEP,ISO)

hypothyroidism (IEP)

ileitis (ISO)

Immediate Hypersensitivity (ISO)

Inflammation (IEP,ISO)

inflammatory bowel disease (ISO,ISS)

intermediate uveitis (ISO)

intestinal obstruction (IEP)

irritable bowel syndrome (ISO)

Kidney Reperfusion Injury (IDA,ISO)

leishmaniasis (ISO)

lip cancer (ISO)

liver benign neoplasm (IEP)

liver cancer (ISO)

liver carcinoma (ISO)

liver cirrhosis (ISO)

Liver Reperfusion Injury (IDA)

lung disease (IDA,IEP,ISO)

Lung Neoplasms (ISO)

lung non-small cell carcinoma (ISO)

lymphoplasmacytic lymphoma (ISO)

major depressive disorder (ISO)

Malignant Pleural Effusions (ISO)

metabolic dysfunction-associated steatohepatitis (IEP,ISO)

metabolic dysfunction-associated steatotic liver disease (ISO)

middle cerebral artery infarction (ISO)

Middle East respiratory syndrome (ISO)

mitral valve stenosis (ISO)

mucositis (ISO)

multiple myeloma (ISO)

Multiple Organ Failure (ISO)

multiple sclerosis (ISO)

Murine Acquired Immunodeficiency Syndrome (ISO)

myocardial infarction (ISO)

Myocardial Reperfusion Injury (IDA,IEP)

myocarditis (IDA,ISO)

Nasal Polyps (ISO)

Neoplasm Metastasis (ISO)

Neuralgia (IDA,IMP,ISO)

obesity (IEP,ISO)

obstructive sleep apnea (IEP)

occupational dermatitis (ISO)

Ocular Toxoplasmosis (ISO)

ocular tuberculosis (ISO)

open-angle glaucoma (ISO)

oral squamous cell carcinoma (ISO)

otitis media (IEP,ISO)

ovarian cancer (ISO)

pancreatic cancer (ISO)

panuveitis (ISO)

Penetrating Wounds (IDA)

pericardial effusion (ISO)

perinatal necrotizing enterocolitis (IDA,ISO)

periodontitis (IEP,ISO)

Plaque, Atherosclerotic (ISO)

plasmacytoma (ISO)

pleurisy (ISO)

pneumonia (ISO)

postpartum depression (IEP)

Pregnancy-associated Malaria (ISO)

primary biliary cholangitis (ISO)

Primary Graft Dysfunction (IDA)

Prostatic Neoplasms (ISO)

prostatitis (IEP,ISO)

Pseudomonas Aeruginosa Keratitis (ISO)

psoriasis (ISO)

pulmonary eosinophilia (ISO)

pulmonary hypertension (ISO)

Reperfusion Injury (IDA,IEP,ISO)

respiratory allergy (ISO)

respiratory syncytial virus infectious disease (ISO)

retinal artery occlusion (ISO)

retinal disease (ISO)

retinopathy of prematurity (ISO)

Retroviridae Infections (ISO)

rheumatic heart disease (ISO)

rheumatoid arthritis (ISO)

Rhinosinusitis (ISO)

schizophrenia (ISO)

sciatic neuropathy (IDA,IEP)

Seasonal Allergic Rhinitis (ISO)

Sepsis (IDA,IEP,ISO)

severe acute respiratory syndrome (IEP,ISO)

shigellosis (ISO)

Shwartzman phenomenon (ISO)

sickle cell anemia (ISO)

Sjogren's syndrome (ISO)

skin disease (ISO)

Spinal Cord Injuries (IEP)

Splenomegaly (ISO)

Staphylococcal Infections (IDA)

Staphylococcal Pneumonia (ISO)

steatotic liver disease (IEP)

stomach cancer (ISO)

stroke (IDA,IEP,ISO)

systemic lupus erythematosus (ISO)

thrombocytopenia (ISO)

thrombosis (ISO)

thyrotoxicosis (IEP)

tongue squamous cell carcinoma (IEP)

toxic encephalopathy (IDA)

toxic shock syndrome (ISO)

Toxoplasma Chorioretinitis (ISO)

trachoma (ISO)

transient cerebral ischemia (IDA)

Transplant Rejection (IDA,ISO)

trichinosis (ISO)

type 1 diabetes mellitus (ISO)

type 2 diabetes mellitus (ISO)

ulcerative colitis (ISO)

uveitis (ISO)

vasculitis (ISO)

Venous Thrombosis (ISO)

Ventilator-Induced Lung Injury (IDA)

viral pneumonia (ISO)

visceral leishmaniasis (ISO)

Weight Loss (ISO)

Wilson disease (ISO)

Wounds and Injuries (IEP)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-catechin (ISO)

(+)-pilocarpine (EXP)

(+)-syringaresinol beta-D-glucoside (ISO)

(+)-Tetrandrine (ISO)

(-)-citrinin (ISO)

(-)-epigallocatechin 3-gallate (EXP,ISO)

(2E,4E)-hexa-2,4-dienoic acid (EXP,ISO)

(4-oxo-3-\{[5-(trifluoromethyl)-1,3-benzothiazol-2-yl]methyl\}-3,4-dihydrophthalazin-1-yl)acetic acid (ISO)

(R)-adrenaline (ISO)

(R)-carnitine (EXP)

(R)-lipoic acid (EXP)

(R,R,R)-alpha-tocopherol (EXP,ISO)

(S)-amphetamine (ISO)

(S)-colchicine (EXP)

(S)-nicotine (ISO)

1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (EXP)

1,2-dimethylhydrazine (EXP,ISO)

1,3,5-trinitrobenzene (ISO)

1,4-benzoquinone (ISO)

1,4-phenylenediamine (ISO)

1-[(2,3,4-trimethoxyphenyl)methyl]piperazine (ISO)

1-chloro-2,4,6-trinitrobenzene (ISO)

1-chloro-2,4-dinitrobenzene (ISO)

1-fluoro-2,4-dinitrobenzene (ISO)

1-naphthyl isothiocyanate (EXP,ISO)

17alpha-ethynylestradiol (EXP,ISO)

17beta-estradiol (EXP,ISO)

17beta-estradiol 3-benzoate (EXP)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (ISO)

2,4,6-trinitrobenzenesulfonic acid (EXP,ISO)

2,4-D (ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

2,5-dihydroxybenzoic acid (ISO)

2,6-di-tert-butyl-4-methylphenol (ISO)

2-acetamidofluorene (EXP)

2-amino-2-deoxy-D-galactopyranose (EXP,ISO)

2-chloroethanol (ISO)

2-deoxy-D-glucose (ISO)

2-naphthylamine (ISO)

2-tert-butylhydroquinone (EXP)

3,3',4,4',5-pentachlorobiphenyl (EXP,ISO)

3,3',5,5'-tetrabromobisphenol A (ISO)

3,3',5-triiodo-L-thyronine (ISO)

3,4-dihydroxybenzoic acid (EXP)

3-[3-(tert-butylsulfanyl)-1-(4-chlorobenzyl)-5-(propan-2-yl)-1H-indol-2-yl]-2,2-dimethylpropanoic acid (ISO)

3-acetyldeoxynivalenol (ISO)

3-chloropropane-1,2-diol (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

3-phenylprop-2-enal (ISO)

4'-hydroxydiclofenac (ISO)

4,4'-sulfonyldiphenol (EXP,ISO)

4-(ethoxymethylene)-2-phenyloxazol-5-one (ISO)

4-chloro-m-cresol (ISO)

4-hydroxy-TEMPO (ISO)

4-hydroxynon-2-enal (ISO)

4-methylhistamine (ISO)

4-nitroquinoline N-oxide (ISO)

4-nonylphenol (ISO)

4-octylphenol (ISO)

4-phenylbutyric acid (ISO)

4-tolyl isocyanate (ISO)

5-[3-(tert-butylamino)-2-hydroxypropoxy]-1,2,3,4-tetrahydronaphthalene-2,3-diol (ISO)

5-aminoimidazole-4-carboxamide (EXP)

5-aza-2'-deoxycytidine (ISO)

5-fluorouracil (EXP,ISO)

5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP,ISO)

6-chloro-2,3,4,9-tetrahydro-1H-carbazole-1-carboxamide (EXP)

6-Methoxyflavone (ISO)

6-O-alpha-D-glucopyranosyl-D-fructofuranose (ISO)

6-propyl-2-thiouracil (EXP)

6alpha-methylprednisolone (ISO)

7,12-dimethyltetraphene (EXP)

7,9-dihydro-1H-purine-2,6,8(3H)-trione (EXP)

7-ketocholesterol (ISO)

Abemaciclib (ISO)

acetaldehyde (ISO)

acetic acid (EXP)

acetylsalicylic acid (EXP,ISO)

acrolein (ISO)

acrylamide (EXP)

actinomycin D (ISO)

adapalene (ISO)

adenosine (ISO)

adenosine 5'-[gamma-thio]triphosphate (ISO)

aflatoxin B1 (ISO)

Aflatoxin B2 alpha (ISO)

Aflatoxin G1 (ISO)

agathisflavone (EXP)

albendazole (ISO)

albuterol (EXP)

aldehydo-D-glucose (ISO)

all-trans-retinoic acid (ISO)

all-trans-retinyl palmitate (ISO)

alloxan (ISO)

alpha-D-galactose (ISO)

alpha-galactosylceramide (ISO)

alpha-naphthoflavone (ISO)

alternariol (ISO)

aluminium oxide (ISO)

amiodarone (ISO)

amitrole (EXP)

amlexanox (ISO)

ammonium chloride (EXP)

Ammothamnine (EXP)

amphibole asbestos (ISO)

amphotericin B (ISO)

anthocyanin (EXP)

anthra[1,9-cd]pyrazol-6(2H)-one (ISO)

apigenin (ISO)

apilimod (ISO)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenous acid (EXP,ISO)

asbestos (ISO)

asperentin (ISO)

asperuloside (ISO)

astaxanthin (EXP,ISO)

atrazine (ISO)

atropine (EXP)

Azoxymethane (EXP,ISO)

baicalein (ISO)

Bardoxolone methyl (ISO)

Bavachinin (ISO)

beclomethasone (ISO)

benzalkonium chloride (ISO)

benzene (ISO)

benzene-1,2,4-triol (ISO)

benzo[a]pyrene (ISO)

benzocaine (ISO)

berberine (EXP,ISO)

Bergenin (EXP)

beryllium sulfate (ISO)

beta-D-glucan (ISO)

beta-patchoulene (EXP)

biliverdin (ISO)

biochanin A (ISO)

bis(2-chloroethyl) sulfide (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisoprolol (ISO)

bisphenol A (EXP,ISO)

Bisphenol A diglycidyl ether (EXP)

bisphenol AF (ISO)

bisphenol F (ISO)

bleomycin A2 (ISO)

boric acid (EXP)

boron atom (EXP)

bortezomib (ISO)

BQ 123 (ISO)

Bryostatin (ISO)

bryostatin 1 (ISO)

bucladesine (ISO)

Bufotalin (ISO)

butachlor (ISO)

butan-1-ol (ISO)

butane-2,3-dione (ISO)

butylated hydroxyanisole (EXP)

Butylbenzyl phthalate (ISO)

C60 fullerene (ISO)

cadmium acetate (ISO)

cadmium atom (EXP,ISO)

cadmium dichloride (EXP,ISO)

cadmium selenide (ISO)

caffeine (ISO)

calciol (EXP,ISO)

calcitriol (EXP,ISO)

calcium carbonate (EXP)

Calcium propionate (EXP)

cannabidiol (EXP,ISO)

capmatinib (ISO)

capsaicin (EXP,ISO)

carbachol (ISO)

carbamate ester (ISO)

Carbaprostacyclin (ISO)

carbendazim (EXP)

carbon monoxide (EXP,ISO)

carbon nanotube (ISO)

carnosine (ISO)

carrageenan (EXP,ISO)

carteolol (ISO)

carvedilol (EXP,ISO)

catechol (ISO)

cefotaxime (ISO)

cefoxitin (ISO)

ceftazidime pentahydrate (ISO)

cefuroxime (ISO)

celastrol (ISO)

celecoxib (EXP,ISO)

cerium trichloride (ISO)

ceruletide (EXP)

CGS-21680 (ISO)

chenodeoxycholic acid (ISO)

chitosan (ISO)

chloroethene (ISO)

chloroquine (ISO)

chlorpyrifos (ISO)

cholesterol (ISO)

choline (ISO)

chromium atom (EXP)

chrysene (ISO)

chrysin (EXP,ISO)

ciprofloxacin (EXP,ISO)

cis-caffeic acid (ISO)

cisplatin (EXP,ISO)

citronellol (EXP)

clenbuterol (EXP,ISO)

clodronic acid (ISO)

clonidine (ISO)

clonidine (amino form) (ISO)

clonidine (imino form) (ISO)

clozapine (EXP)

cobalt dichloride (ISO)

cocaine (ISO)

coenzyme Q10 (EXP,ISO)

colforsin daropate hydrochloride (ISO)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (EXP)

cordycepin (EXP,ISO)

cortisol (ISO)

costunolide (ISO)

coumarins (ISO)

crocidolite asbestos (ISO)

crocin-1 (EXP)

crotonaldehyde (ISO)

Cuprizon (ISO)

curcumin (EXP,ISO)

cycloastragenol (EXP)

cycloheximide (EXP,ISO)

Cyclopamine (ISO)

cyclophosphamide (EXP,ISO)

cyclosporin A (EXP,ISO)

cyhalothrin (EXP)

cypermethrin (EXP,ISO)

D-glucose (ISO)

D-penicillamine (EXP)

danazol (EXP)

dantrolene (EXP,ISO)

dapagliflozin (EXP)

DAPT (EXP)

decabromodiphenyl ether (EXP,ISO)

deguelin (ISO)

deoxycholic acid (ISO)

deoxynivalenol (ISO)

desferrioxamine B (EXP)

dexamethasone (ISO)

dexamethasone phosphate (EXP)

dextran (ISO)

dextran sulfate (EXP,ISO)

dextromethorphan (ISO)

Di-n-octyl phthalate (ISO)

diallyl trisulfide (ISO)

diarsenic trioxide (EXP,ISO)

diazinon (ISO)

diazoxide (ISO)

dibutyl phthalate (ISO)

dichloroacetic acid (ISO)

dichloromethane (ISO)

dichlorvos (EXP)

diclofenac (EXP,ISO)

dicyclohexylmethane-4,4'-diisocyanate (ISO)

Didecyldimethylammonium (ISO)

dieldrin (EXP)

diethyl maleate (ISO)

diethyl phthalate (EXP,ISO)

Diisodecyl phthalate (ISO)

diisononyl phthalate (ISO)

diisopropyl fluorophosphate (ISO)

Dimaprit (ISO)

dimethoate (ISO)

dioxygen (EXP,ISO)

diphenyl diselenide (EXP)

diphenylmethane-4,4'-diisocyanate (ISO)

diprotium oxide (EXP)

disodium selenite (EXP)

dobutamine (ISO)

donepezil hydrochloride (ISO)

dopamine (EXP)

dorsomorphin (EXP,ISO)

doxorubicin (EXP,ISO)

dydrogesterone (ISO)

edaravone (EXP)

elemental boron (EXP)

elemental selenium (EXP,ISO)

emamectin benzoate (ISO)

emodin (ISO)

estriol (ISO)

ethambutol (EXP)

ethanol (EXP,ISO)

ethionamide (EXP)

eticlopride(1+) (EXP)

eugenol (ISO)

excitatory amino acid agonist (EXP)

famotidine (ISO)

fasudil (EXP)

febuxostat (EXP)

ferrostatin-1 (ISO)

flavokawain B (ISO)

flavonoids (ISO)

fluoxetine (ISO)

flurbiprofen (ISO)

flutamide (EXP)

folic acid (ISO)

fonofos (ISO)

formaldehyde (EXP,ISO)

formoterol fumarate (EXP)

fragrance (ISO)

fructose (EXP,ISO)

fucoidan (EXP)

fucoxanthin (ISO)

fulvestrant (ISO)

furan (EXP)

furosemide (ISO)

gadolinium trichloride (EXP)

galactose (ISO)

galanthamine (EXP)

gardiquimod (ISO)

gemcitabine (ISO)

gemfibrozil (EXP)

Geniposide (ISO)

genistein (EXP,ISO)

gentamycin (EXP,ISO)

geraniol (ISO)

gliclazide (EXP)

glucose (ISO)

glucuronoxylomannan (ISO)

glutathione (ISO)

glyburide (ISO)

glycocholic acid (ISO)

glyphosate (EXP,ISO)

gold atom (ISO)

gold(0) (ISO)

gossypin (EXP)

graphite (ISO)

GSK-J4 (ISO)

haloperidol (ISO)

helenalin (ISO)

heroin (ISO)

hesperidin (EXP)

hexachlorobenzene (EXP,ISO)

hexadecanoic acid (ISO)

hexamethylene diisocyanate (ISO)

histamine (ISO)

homocysteine (EXP)

HU-308 (EXP,ISO)

hydralazine (ISO)

hydrogen peroxide (ISO)

hydroquinone (ISO)

hydroxychloroquine (ISO)

hydroxylamine (EXP)

hydroxysafflor yellow A (ISO)

hypochlorous acid (ISO)

ibrutinib (ISO)

ibuprofen (ISO)

IC-87114 (ISO)

idelalisib (ISO)

imidacloprid (EXP)

imipramine (ISO)

imiquimod (ISO)

indirubin-3'-monoxime (ISO)

indole-3-methanol (EXP,ISO)

indometacin (EXP,ISO)

ionomycin (EXP,ISO)

irinotecan (EXP,ISO)

isatin (EXP)

isoliquiritigenin (ISO)

isoniazide (ISO)

isophorone diisocyanate (ISO)

isoprenaline (EXP,ISO)

isotretinoin (EXP)

ivermectin (ISO)

Jujuboside A (ISO)

kaempferol (EXP)

kaempferol 3-O-beta-D-glucoside (ISO)

kainic acid (EXP)

ketoprofen (ISO)

L-arginine (EXP)

L-ascorbic acid (EXP,ISO)

L-methionine (ISO)

lansoprazole (EXP)

lead diacetate (EXP,ISO)

lead(0) (ISO)

lead(II) chloride (ISO)

leflunomide (ISO)

letrozole (EXP)

leukotriene B4 (ISO)

Liensinine (ISO)

linagliptin (EXP)

linalool (EXP)

linoleic acid (ISO)

linuron (ISO)

lipoic acid (EXP)

lipophosphoglycan (ISO)

lipopolysaccharide (EXP,ISO)

lipoteichoic acid (EXP,ISO)

lipoxin A4 (ISO)

lithium atom (ISO)

lithium hydride (ISO)

lithocholic acid (ISO)

losartan (EXP)

lupeol (ISO)

luteolin (EXP,ISO)

Luteolin 7-methyl ether (ISO)

lycopene (ISO)

malvidin (ISO)

mangiferin (EXP)

mechlorethamine (EXP)

melatonin (EXP,ISO)

mercury atom (ISO)

mercury dichloride (EXP,ISO)

mercury(0) (ISO)

mesalamine (EXP)

metam (ISO)

metformin (EXP,ISO)

methadone (EXP)

methamphetamine (EXP,ISO)

methapyrilene (EXP)

methimazole (EXP)

methotrexate (EXP,ISO)

methyl 3,4,5-trihydroxybenzoate (ISO)

methyl isocyanate (ISO)

methyl isothiocyanate (ISO)

methyl methanesulfonate (ISO)

Methyl palmitate (ISO)

methylisothiazolinone (ISO)

methylmercury chloride (EXP)

metronidazole (ISO)

metyrapone (EXP)

microcystin-LR (EXP,ISO)

mifepristone (ISO)

minocycline (EXP,ISO)

misoprostol (ISO)

mitogen (EXP,ISO)

MitoTEMPO (ISO)

MK-2206 (ISO)

mometasone furoate (ISO)

mono(2-ethylhexyl) phthalate (EXP,ISO)

Monobutylphthalate (ISO)

monocrotaline (EXP,ISO)

Monocyte locomotion inhibitory factor (ISO)

monosodium L-glutamate (EXP,ISO)

morin (EXP)

Morroniside (EXP,ISO)

mycophenolic acid (EXP)

mycotoxin (ISO)

N(5)-ethyl-L-glutamine (EXP)

N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine (ISO)

N,N-diethyl-m-toluamide (EXP,ISO)

N,N-dimethylacetamide (ISO)

N-acetyl-L-cysteine (EXP,ISO)

N-methyl-4-phenylpyridinium (ISO)

N-methyl-N-nitrosourea (EXP,ISO)

N-nitrosodiethylamine (EXP,ISO)

N-nitrosodimethylamine (EXP)

N1'-[2-[[5-[(dimethylamino)methyl]-2-furanyl]methylthio]ethyl]-N1-methyl-2-nitroethene-1,1-diamine (EXP,ISO)

nadolol (ISO)

naproxen (EXP)

naringin (EXP,ISO)

neostigmine (EXP)

nickel atom (ISO)

nickel dichloride (EXP,ISO)

nickel sulfate (ISO)

nicorandil (EXP)

nicotinamide (ISO)

nicotine (ISO)

nimesulide (ISO)

nitric oxide (ISO)

nitrogen dioxide (ISO)

nitroprusside (EXP)

Nonylphenol (ISO)

notoginsenoside R1 (ISO)

NS-398 (ISO)

obeticholic acid (ISO)

ochratoxin A (EXP)

olanzapine (ISO)

oleic acid (ISO)

Olmesartan medoxomil (EXP)

omeprazole (EXP,ISO)

Ono-AE1-329 (ISO)

oridonin (EXP)

orlistat (EXP)

oroxylin A (EXP)

oxaliplatin (ISO)

oxidopamine (ISO)

ozone (EXP,ISO)

paclitaxel (EXP,ISO)

paeoniflorin (EXP,ISO)

palmitoyl ethanolamide (ISO)

paracetamol (ISO)

paraquat (EXP,ISO)

parathion (ISO)

paroxetine (ISO)

patchouli alcohol (EXP)

patulin (ISO)

pentachlorophenol (ISO)

pentamidine (ISO)

Pentoxifylline (ISO)

peptidoglycan (ISO)

perfluorodecanoic acid (ISO)

perfluorohexanesulfonic acid (ISO)

perfluorononanoic acid (EXP)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

perindopril (EXP,ISO)

permethrin (EXP)

phenanthrene (EXP)

phenanthridone (ISO)

phenethyl isothiocyanate (ISO)

phenobarbital (EXP)

phenylarsine oxide (ISO)

phloretin (EXP,ISO)

phorbol 13-acetate 12-myristate (EXP,ISO)

phosgene (EXP)

phosphatidylcholine (ISO)

phthalaldehyde (ISO)

phthalic anhydride (ISO)

pinostrobin (EXP)

pioglitazone (EXP,ISO)

pirinixic acid (EXP,ISO)

platycodin D (ISO)

poly(I:C) (EXP,ISO)

polymyxin B2 (ISO)

polyphosphates (ISO)

pomalidomide (ISO)

potassium chloride (EXP)

prednisolone (ISO)

procyanidin B2 (EXP)

procyanidin B3 (ISO)

progesterone (ISO)

propamocarb (ISO)

propionic acid (EXP,ISO)

propofol (ISO)

propranolol (EXP)

prostaglandin E2 (ISO)

prostaglandin F2alpha (ISO)

prostaglandin I2 (EXP)

protein kinase inhibitor (ISO)

protosappanin A (EXP,ISO)

pyocyanine (ISO)

pyrethrins (ISO)

Pyridostigmine bromide (EXP,ISO)

pyrrolidine dithiocarbamate (EXP)

quercetin (EXP,ISO)

ranitidine (EXP,ISO)

raspberry ketone (EXP)

rebaudioside A (EXP)

reserpine (ISO)

resiniferatoxin (EXP)

resiquimod (ISO)

resveratrol (EXP,ISO)

Rhein (ISO)

ribavirin (EXP,ISO)

rifampicin (EXP)

rifaximin (ISO)

rimonabant (ISO)

Ro 41-5253 (ISO)

rolipram (ISO)

rosmarinic acid (ISO)

rotenone (EXP,ISO)

rutin (EXP,ISO)

ruxolitinib (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

S-butyl-DL-homocysteine (S,R)-sulfoximine (EXP,ISO)

S-nitrosoglutathione (ISO)

sarin (EXP)

SB 203580 (ISO)

SCH 23390 (ISO)

scopolamine (ISO)

scopoletin (EXP)

selenium atom (EXP,ISO)

serpentine asbestos (ISO)

sevoflurane (ISO)

silicon dioxide (EXP,ISO)

silver atom (EXP,ISO)

silver(0) (EXP,ISO)

simvastatin (EXP,ISO)

Sinomenine (ISO)

sirolimus (ISO)

sodium arsenate (ISO)

sodium arsenite (EXP,ISO)

sodium aurothiomalate (ISO)

sodium benzoate (EXP)

sodium dichromate (ISO)

Sodium salicylate (ISO)

sodium stibogluconate (ISO)

spironolactone (ISO)

SR 144528 (ISO)

sterigmatocystin (EXP,ISO)

stigmasterol (ISO)

streptozocin (EXP,ISO)

sucrose (ISO)

sulfasalazine (EXP,ISO)

sulforaphane (ISO)

sulfoxaflor (EXP)

sulfur dioxide (EXP)

sumatriptan (EXP)

sunitinib (EXP,ISO)

suramin (ISO)

synephrine (ISO)

syringic acid (ISO)

T-2 toxin (ISO)

tacrine (ISO)

tamibarotene (EXP)

tangeretin (EXP)

tartrazine (EXP)

taurine (ISO)

tauro-beta-muricholic acid (ISO)

taurochenodeoxycholic acid (ISO)

taurocholic acid (ISO)

taurodeoxycholic acid (ISO)

tauroursodeoxycholic acid (ISO)

telmisartan (EXP)

terbufos (ISO)

terbutaline (ISO)

Terfenadine (ISO)

testosterone (EXP)

tetrachloromethane (EXP,ISO)

tetracyclines (ISO)

thalidomide (ISO)

Theaflavin 3,3'-digallate (ISO)

theophylline (ISO)

thiacloprid (EXP)

thiamet G (ISO)

thioacetamide (EXP,ISO)

thymol (EXP)

thymol sulfate(1-) (EXP)

thymoquinone (EXP)

thyroxine (EXP)

titanium dioxide (ISO)

TMC-120A (ISO)

tofacitinib (ISO)

toluene 2,4-diisocyanate (ISO)

trans-caffeic acid (ISO)

trans-rhaponticin (EXP)

triapine (ISO)

tributylstannane (ISO)

trichloroacetaldehyde (ISO)

trichloroacetic acid (ISO)

trichloroethene (EXP,ISO)

triclocarban (ISO)

trimellitic anhydride (ISO)

trimethyltin (ISO)

Triptolide (ISO)

triptonide (ISO)

troglitazone (ISO)

tropan-3alpha-yl 3-hydroxy-2-phenylpropanoate (EXP)

uranium atom (EXP,ISO)

urethane (ISO)

ursodeoxycholic acid (EXP,ISO)

valproic acid (EXP,ISO)

vanadium atom (EXP)

vanadium(0) (EXP)

vancomycin (ISO)

vinclozolin (EXP)

vinorelbine (ISO)

vitamin E (EXP,ISO)

VX nerve agent (ISO)

water (EXP)

WIN 55212-2 (EXP,ISO)

wogonin (EXP)

zearalenone (ISO)

zidovudine (ISO)

zinc acetate (ISO)

zinc atom (EXP,ISO)

zinc dichloride (ISO)

zinc oxide (ISO)

zinc protoporphyrin (EXP)

zinc(0) (EXP,ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

branching involved in labyrinthine layer morphogenesis (ISO)

cellular response to antibiotic (ISO)

cellular response to estradiol stimulus (IEP)

cellular response to hepatocyte growth factor stimulus (ISO)

cellular response to lipopolysaccharide (IEA,ISO)

cellular response to virus (ISO)

defense response to bacterium (ISO)

defense response to protozoan (ISO)

immune response (IBA,IEA,IMP)

interleukin-10-mediated signaling pathway (IBA,IEA,ISO,ISS)

liver regeneration (IEP)

negative regulation of apoptotic process (IMP)

negative regulation of autophagy (IEA,ISO)

negative regulation of B cell proliferation (ISO,ISS)

negative regulation of cell population proliferation (IEA,ISO)

negative regulation of chronic inflammatory response to antigenic stimulus (ISO)

negative regulation of cytokine activity (ISO)

negative regulation of cytokine production (IEA,IMP,ISO)

negative regulation of cytokine production involved in immune response (IEA,ISO,ISS)

negative regulation of endothelial cell apoptotic process (ISO)

negative regulation of heterotypic cell-cell adhesion (IEA,ISO)

negative regulation of inflammatory response (IBA,IEA,ISO,ISS)

negative regulation of interleukin-12 production (ISO)

negative regulation of interleukin-6 production (IEA,ISO,ISS)

negative regulation of membrane protein ectodomain proteolysis (IEA,ISO,ISS)

negative regulation of MHC class II biosynthetic process (IEA,ISO)

negative regulation of myeloid dendritic cell activation (ISO)

negative regulation of neuron apoptotic process (IDA)

negative regulation of nitric oxide biosynthetic process (IDA)

negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway (IEA,ISO)

negative regulation of tumor necrosis factor production (IDA,IEA,ISO)

negative regulation of type II interferon production (ISO)

negative regulation of vascular associated smooth muscle cell proliferation (IEA,ISO)

positive regulation of B cell apoptotic process (ISO,ISS)

positive regulation of cell cycle (IEA,ISO)

positive regulation of cytokine production (IEA,ISO,ISS)

positive regulation of DNA-templated transcription (IEA,ISO)

positive regulation of endothelial cell proliferation (IEA,ISO)

positive regulation of immunoglobulin production (ISO)

positive regulation of macrophage activation (IDA)

positive regulation of MHC class II biosynthetic process (ISO)

positive regulation of miRNA transcription (IEA,ISO)

positive regulation of plasma cell differentiation (ISO)

positive regulation of receptor signaling pathway via JAK-STAT (IBA,IEA,ISO)

positive regulation of sprouting angiogenesis (IEA,ISO)

positive regulation of transcription by RNA polymerase II (IEA,ISO,ISS)

regulation of B cell activation (IEA,ISO)

regulation of complement-dependent cytotoxicity (ISO)

regulation of gene expression (ISO)

regulation of response to wounding (IEA,ISO)

regulation of synapse organization (IDA)

response to activity (IEP)

response to carbon monoxide (IEP)

response to glucocorticoid (IEA,IEP,ISO,ISS)

response to inactivity (IEP)

response to insulin (IEP)

response to lipopolysaccharide (IEP)

response to molecule of bacterial origin (IEA,ISS)

response to xenobiotic stimulus (IEP)

T-helper 1 cell differentiation (IEA,ISO)

Cellular Component

extracellular region (IEA,ISO)

extracellular space (IBA,IDA,IEA,ISO,ISS)

interleukin-10 receptor complex (IEA,ISO)

Molecular Function

cytokine activity (IBA,IEA,ISO)

interleukin-10 receptor binding (IDA,IMP)

protein binding (ISO)

protein dimerization activity (IEA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

allograft rejection pathway (IEA)

asthma pathway (IEA)

autoimmune thyroiditis pathway (IEA)

Chagas disease pathway (IEA)

cytokine mediated signaling pathway (IEA)

Entamoebiasis pathway (IEA)

Interleukin-10 signaling pathway (IMP,ISO)

interleukin-4 signaling pathway (ISO)

Jak-Stat signaling pathway (IEA)

Leishmaniasis pathway (IEA)

malaria pathway (IEA)

sleeping sickness pathway (IEA)

Staphylococcus aureus infection pathway (IEA)

systemic lupus erythematosus pathway (IEA)

T cell receptor signaling pathway (IEA)

toxoplasmosis pathway (IEA)

tuberculosis pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Cytokine and CXC chemokine expression patterns in aqueous humor of patients with presumed tuberculous uveitis.	Abu El-Asrar AM, etal., Cytokine. 2012 Aug;59(2):377-81. doi: 10.1016/j.cyto.2012.04.030. Epub 2012 May 12.
2.	Molecular analysis of interleukin-10 gene polymorphisms in patients with Behçet's disease.	Afkari B, etal., Immunol Lett. 2018 Feb;194:56-61. doi: 10.1016/j.imlet.2017.12.008. Epub 2017 Dec 30.
3.	Abrogation of anti-retinal autoimmunity in IL-10 transgenic mice due to reduced T cell priming and inhibition of disease effector mechanisms.	Agarwal RK, etal., J Immunol. 2008 Apr 15;180(8):5423-9.
4.	Down-regulation of IFN-gamma-producing CD56+ T cells after combined low-dose cyclosporine/prednisone treatment in patients with Behcet's uveitis.	Ahn JK, etal., Invest Ophthalmol Vis Sci. 2005 Jul;46(7):2458-64.
5.	Hypermethylation of IL-10 gene is responsible for its low mRNA expression in Behçet's disease.	Alipour S, etal., J Cell Biochem. 2018 Aug;119(8):6614-6622. doi: 10.1002/jcb.26809. Epub 2018 May 2.
6.	Cytokine polymorphisms predict the frequency of otitis media as a complication of rhinovirus and RSV infections in children.	Alper CM, etal., Eur Arch Otorhinolaryngol. 2009 Feb;266(2):199-205. doi: 10.1007/s00405-008-0729-2. Epub 2008 Jun 17.
7.	Anti-inflammatory cytokines in subclinical carotid atherosclerosis.	Ambrosius W, etal., Neurology. 2006 Jun 27;66(12):1946-8.
8.	Genetic variants in inflammation pathway genes and asthma in glioma susceptibility.	Amirian E, etal., Neuro Oncol. 2010 May;12(5):444-52. Epub 2010 Feb 5.
9.	Regulatory B cells prevent and reverse allergic airway inflammation via FoxP3-positive T regulatory cells in a murine model.	Amu S, etal., J Allergy Clin Immunol. 2010 May;125(5):1114-1124.e8. Epub 2010 Mar 20.
10.	Interleukin 10 (IL-10) influences autoimmune response in primary Sjogren's syndrome and is linked to IL-10 gene polymorphism.	Anaya JM, etal., J Rheumatol. 2002 Sep;29(9):1874-6.
11.	Physical Exercise Improves Glycemic and Inflammatory Profile and Attenuates Progression of Periodontitis in Diabetic Rats (HFD/STZ).	Andrade EF, etal., Nutrients. 2018 Nov 7;10(11). pii: nu10111702. doi: 10.3390/nu10111702.
12.	Macrophages inhibit neovascularization in a murine model of age-related macular degeneration.	Apte RS, etal., PLoS Med. 2006 Aug;3(8):e310.
13.	Dysregulated phosphorylation and nuclear translocation of cyclic AMP response element binding protein (CREB) in rat liver after chronic ethanol binge.	Aroor AR, etal., Eur J Pharmacol. 2012 Mar 15;679(1-3):101-8. doi: 10.1016/j.ejphar.2011.12.045. Epub 2012 Jan 15.
14.	TNF-α and IL-10 polymorphisms increase the risk to hepatocellular carcinoma in HCV infected individuals.	Aroucha DC, etal., J Med Virol. 2016 Sep;88(9):1587-95. doi: 10.1002/jmv.24501. Epub 2016 Mar 21.
15.	Cytokine polymorphism in noninfectious uveitis.	Atan D, etal., Invest Ophthalmol Vis Sci. 2010 Aug;51(8):4133-42. doi: 10.1167/iovs.09-4583. Epub 2010 Mar 24.
16.	Punctate inner choroidopathy and multifocal choroiditis with panuveitis share haplotypic associations with IL10 and TNF loci.	Atan D, etal., Invest Ophthalmol Vis Sci. 2011 Jun 1;52(6):3573-81. doi: 10.1167/iovs.10-6743.
17.	Nrf2 promotes alveolar mitochondrial biogenesis and resolution of lung injury in Staphylococcus aureus pneumonia in mice.	Athale J, etal., Free Radic Biol Med. 2012 Oct 15;53(8):1584-94. doi: 10.1016/j.freeradbiomed.2012.08.009. Epub 2012 Aug 23.
18.	Dysregulated Lysine Acetyltransferase 2B Promotes Inflammatory Bowel Disease Pathogenesis Through Transcriptional Repression of Interleukin-10.	Bai AH, etal., J Crohns Colitis. 2016 Jun;10(6):726-34. doi: 10.1093/ecco-jcc/jjw020. Epub 2016 Jan 22.
19.	The IL-6 G-174C polymorphism may be associated with ischaemic stroke in patients without a history of hypertension.	Balding J, etal., Ir J Med Sci. 2004 Oct-Dec;173(4):200-3.
20.	Polymorphisms in the TNF-alpha and IL10 gene promoters and risk of arsenic-induced skin lesions and other nondermatological health effects.	Banerjee N, etal., Toxicol Sci. 2011 May;121(1):132-9. doi: 10.1093/toxsci/kfr046. Epub 2011 Feb 25.
21.	The impact of the IL-1β, IL-1Ra, IL-2, IL-6 and IL-10 gene polymorphisms on the development of Behcet's disease and their association with the phenotype.	Barış S, etal., Med Clin (Barc). 2016 May 6;146(9):379-83. doi: 10.1016/j.medcli.2015.09.017. Epub 2015 Dec 3.
22.	Single nucleotide polymorphism rs1800872 in the promoter region of the IL10 gene is associated with predisposition to chronic hepatitis C in Russian population.	Barkhash AV, etal., Microbes Infect. 2018 Mar;20(3):212-216. doi: 10.1016/j.micinf.2017.11.012. Epub 2017 Dec 14.
23.	Poly (lactide-co-glycolide)-polymethacrylate nanoparticles for intramuscular delivery of plasmid encoding interleukin-10 to prevent autoimmune diabetes in mice.	Basarkar A and Singh J, Pharm Res. 2009 Jan;26(1):72-81. Epub 2008 Sep 9.
24.	Comparison of the nasal release of IL-4, IL-10, IL-17, CCL13/MCP-4, and CCL26/eotaxin-3 in allergic rhinitis during season and after allergen challenge.	Baumann R, etal., Am J Rhinol Allergy. 2013 Jul-Aug;27(4):266-72. doi: 10.2500/ajra.2013.27.3913.
25.	Interleukin-10 is a central regulator of the response to LPS in murine models of endotoxic shock and the Shwartzman reaction but not endotoxin tolerance.	Berg DJ, etal., J Clin Invest. 1995 Nov;96(5):2339-47.
26.	Effects of indomethacin-loaded nanocapsules in experimental models of inflammation in rats.	Bernardi A, etal., Br J Pharmacol. 2009 May 6.
27.	DABIL-2 suppresses autoimmune inflammation in the CNS and inhibits T cell-mediated lysis of glial target cells.	Bhopale MK, etal., Exp Mol Pathol. 2013 Jul 17. pii: S0014-4800(13)00090-7. doi: 10.1016/j.yexmp.2013.07.004.
28.	Murine cytomegalovirus downregulates interleukin-17 in mice with retrovirus-induced immunosuppression that are susceptible to experimental cytomegalovirus retinitis.	Blalock EL, etal., Cytokine. 2013 Mar;61(3):862-75. doi: 10.1016/j.cyto.2013.01.009. Epub 2013 Feb 14.
29.	Interleukin-10 administration decreases survival in murine recipients of major histocompatibility complex disparate donor bone marrow grafts.	Blazar BR, etal., Blood. 1995 Feb 1;85(3):842-51.
30.	Intestinal infection with Trichinella spiralis induces distinct, regional immune responses.	Blum LK, etal., Vet Parasitol. 2013 May 20;194(2-4):101-5. doi: 10.1016/j.vetpar.2013.01.030. Epub 2013 Feb 5.
31.	Cytokines Genotype-Phenotype Correlation in Nonalcoholic Steatohepatitis.	Bocsan IC, etal., Oxid Med Cell Longev. 2017;2017:4297206. doi: 10.1155/2017/4297206. Epub 2017 Aug 9.
32.	Down-modulation of lung immune responses by interleukin-10 and transforming growth factor beta (TGF-beta) and analysis of TGF-beta receptors I and II in active tuberculosis.	Bonecini-Almeida MG, etal., Infect Immun. 2004 May;72(5):2628-34.
33.	Dysregulation in myelination mediated by persistent neuroinflammation: Possible mechanisms in chemotherapy-related cognitive impairment.	Briones TL and Woods J, Brain Behav Immun. 2013 Aug 2. pii: S0889-1591(13)00409-1. doi: 10.1016/j.bbi.2013.07.175.
34.	Telmisartan Prevents Alveolar Bone Loss by Decreasing the Expression of Osteoclasts Markers in Hypertensive Rats With Periodontal Disease.	Brito VGB, etal., Front Pharmacol. 2020 Nov 11;11:579926. doi: 10.3389/fphar.2020.579926. eCollection 2020.
35.	Local administration of an adeno-associated viral vector expressing IL-10 reduces monocyte infiltration and subsequent photoreceptor damage during experimental autoimmune uveitis.	Broderick CA, etal., Mol Ther. 2005 Aug;12(2):369-73.
36.	IL-10 delivery by AAV5 vector attenuates inflammation in mice with Pseudomonas pneumonia.	Buff SM, etal., Gene Ther. 2010 May;17(5):567-76. Epub 2010 Apr 1.
37.	Clinical and immunological correlates of pre-co-seasonal sublingual immunotherapy with birch monomeric allergoid in patients with allergic rhinoconjunctivitis.	Burastero SE, etal., Int J Immunopathol Pharmacol. 2009 Apr-Jun;22(2):343-52.
38.	Altered neuropathic pain behaviour in a rat model of depression is associated with changes in inflammatory gene expression in the amygdala.	Burke NN, etal., Genes Brain Behav. 2013 Aug 19. doi: 10.1111/gbb.12080.
39.	An Analysis of IL-10/IL-10R Genetic Factors Related to Risk of Colon Cancer and Inflammatory Bowel Disease in a Han Chinese Population.	Cai J and Zhang Z, Clin Lab. 2016;62(6):1147-54.
40.	Exercise training improves the IL-10/TNF-α cytokine balance in the gastrocnemius of rats with heart failure.	Calegari L, etal., Braz J Phys Ther. 2018 Mar - Apr;22(2):154-160. doi: 10.1016/j.bjpt.2017.09.004. Epub 2017 Sep 7.
41.	Interleukin-10 deficiency increases atherosclerosis, thrombosis, and low-density lipoproteins in apolipoprotein E knockout mice.	Caligiuri G, etal., Mol Med. 2003 Jan-Feb;9(1-2):10-7.
42.	Mechanisms of dexamethasone to protect flaps from an ischemia-reperfusion injury.	Cao J, etal., Zhongguo Xiu Fu Chong Jian Wai Ke Za Zhi. 2006 Jun;20(6):661-5.
43.	IL10 rs1800896 polymorphism is associated with liver cirrhosis and chronic hepatitis B.	Cao LN, etal., Genet Mol Res. 2016 Feb 22;15(1). pii: gmr7256. doi: 10.4238/gmr.15017256.
44.	Effects of Cissampelos sympodialis Eichl. and its Alkaloid, Warifteine, in an Experimental Model of Respiratory Allergy to Blomia tropicalis.	Cerqueira-Lima AT, etal., Curr Drug Targets. 2010 Jun 28.
45.	[Oxymatrine could promote mesenchymal stem cell therapy in hepatic fibrosis rats: an experimental research].	Chai NL, etal., Zhongguo Zhong Xi Yi Jie He Za Zhi. 2013 Jun;33(6):840-4.
46.	Dual biological functions of an interleukin-1 receptor antagonist-interleukin-10 fusion protein and its suppressive effects on joint inflammation.	Chang DM, etal., Immunology. 2004 Aug;112(4):643-50.
47.	Profound deficit of IL10 at birth in children who develop childhood acute lymphoblastic leukemia.	Chang JS, etal., Cancer Epidemiol Biomarkers Prev. 2011 Aug;20(8):1736-40. doi: 10.1158/1055-9965.EPI-11-0162. Epub 2011 Jun 8.
48.	Multi-therapeutic effects of human adipose-derived mesenchymal stem cells on radiation-induced intestinal injury.	Chang P, etal., Cell Death Dis. 2013 Jun 20;4:e685. doi: 10.1038/cddis.2013.178.
49.	Analysis of cytokine genes polymorphism as markers for inhibitor development in haemophilia A.	Chaves D, etal., Int J Immunogenet. 2010 Apr;37(2):79-82. doi: 10.1111/j.1744-313X.2009.00893.x. Epub 2010 Jan 14.
50.	Mouse Gamma Herpesvirus MHV-68 Induces Severe Gastrointestinal (GI) Dilatation in Interferon Gamma Receptor-Deficient Mice (IFNγR-/-) That Is Blocked by Interleukin-10.	Chen H, etal., Viruses. 2018 Sep 23;10(10). pii: v10100518. doi: 10.3390/v10100518.
51.	Lithium chloride promotes host resistance against Pseudomonas aeruginosa keratitis.	Chen K, etal., Mol Vis. 2013 Jul 19;19:1502-14. Print 2013.
52.	Balance between plasma levels of tumor necrosis factor-alpha and interleukin-10 in rheumatic mitral stenosis.	Chen MC, etal., Cardiology. 2005;104(4):171-5. Epub 2005 Sep 7.
53.	Effect of 5-FU on modulation of disarrangement of immune-associated cytokines in experimental acute pancreatitis.	Chen XL, etal., World J Gastroenterol. 2009 Apr 28;15(16):2032-7.
54.	Comparison of aqueous humor cytokine and chemokine levels in diabetic patients with and without retinopathy.	Cheung CM, etal., Mol Vis. 2012;18:830-7. Epub 2012 Apr 4.
55.	Association between promoter polymorphic haplotypes of interleukin-10 gene and schizophrenia.	Chiavetto LB, etal., Biol Psychiatry. 2002 Mar 15;51(6):480-4.
56.	Rutin suppresses atopic dermatitis and allergic contact dermatitis.	Choi JK and Kim SH, Exp Biol Med (Maywood). 2013 Apr;238(4):410-7. doi: 10.1177/1535370213477975.
57.	Circulating serum levels of cytokines and angiogenic factors in patients with cervical cancer.	Chopra V, etal., Cancer Invest. 1998;16(3):152-9.
58.	Angiogenin, interleukins, and growth-factor levels in serum of patients with ovarian cancer: correlation with angiogenesis.	Chopra V, etal., Cancer J Sci Am. 1996 Sep-Oct;2(5):279-85.
59.	Serum levels of interleukins, growth factors and angiogenin in patients with endometrial cancer.	Chopra V, etal., J Cancer Res Clin Oncol. 1997;123(3):167-72.
60.	Lack of association of genetic polymorphisms in the interleukin-1beta, interleukin-1 receptor antagonist, interleukin-4, and interleukin-10 genes with risk of rheumatic heart disease in Taiwan Chinese.	Chou HT, etal., Int Heart J. 2005 May;46(3):397-406.
61.	Effect of periaqueductal gray melanocortin 4 receptor in pain facilitation and glial activation in rat model of chronic constriction injury.	Chu H, etal., Neurol Res. 2012 Nov;34(9):871-88. doi: 10.1179/1743132812Y.0000000085. Epub 2012 Aug 13.
62.	Interleukin-10 is a protective factor against diet-induced insulin resistance in liver.	Cintra DE, etal., J Hepatol. 2008 Apr;48(4):628-37. Epub 2008 Jan 31.
63.	Interleukin-10 promoter polymorphism and venous thrombosis: a case-control study.	Cochery-Nouvellon E, etal., Thromb Haemost. 2006 Jul;96(1):24-8.
64.	Acute treatment with relaxin protects the kidney against ischaemia/reperfusion injury.	Collino M, etal., J Cell Mol Med. 2013 Sep 20. doi: 10.1111/jcmm.12120.
65.	Interleukin-10 gene polymorphism (-1082G/A) is associated with toxoplasmic retinochoroiditis.	Cordeiro CA, etal., Invest Ophthalmol Vis Sci. 2008 May;49(5):1979-82. doi: 10.1167/iovs.07-1393.
66.	Inhibitory peptide analogs derived from a major uveitogenic epitope protect from antiretinal autoimmunity by inducing type 2 and regulatory T cells.	Cortes LM, etal., J Leukoc Biol. 2008 Aug;84(2):577-85. doi: 10.1189/jlb.0308189. Epub 2008 May 21.
67.	Cytokine gene polymorphisms in psoriasis.	Craven NM, etal., Br J Dermatol. 2001 Apr;144(4):849-53.
68.	Frequency of polymorphisms of signal peptide of TGF-beta1 and -1082G/A SNP at the promoter region of Il-10 gene in patients with carotid stenosis.	Crivello A, etal., Ann N Y Acad Sci. 2006 May;1067:288-93.
69.	Mesenchymal stem cells enhance recovery and repair following ventilator-induced lung injury in the rat.	Curley GF, etal., Thorax. 2012 Jun;67(6):496-501. doi: 10.1136/thoraxjnl-2011-201059. Epub 2011 Nov 21.
70.	Association tests with systemic lupus erythematosus (SLE) of IL10 markers indicate a direct involvement of a CA repeat in the 5' regulatory region.	D' Alfonso S, etal., Genes Immun. 2002 Dec;3(8):454-63.
71.	Carvedilol decrease IL-1beta and TNF-alpha, inhibits MMP-2, MMP-9, COX-2, and RANKL expression, and up-regulates OPG in a rat model of periodontitis.	de Araujo Junior RF, etal., PLoS One. 2013 Jul 3;8(7):e66391. doi: 10.1371/journal.pone.0066391. Print 2013.
72.	IL10 polymorphisms are associated with airflow obstruction in severe alpha1-antitrypsin deficiency.	Demeo DL, etal., Am J Respir Cell Mol Biol. 2008 Jan;38(1):114-20. Epub 2007 Aug 9.
73.	Tumor necrosis factor-alpha and Muc2 mucin play major roles in disease onset and progression in dextran sodium sulphate-induced colitis.	Dharmani P, etal., PLoS One. 2011;6(9):e25058. doi: 10.1371/journal.pone.0025058. Epub 2011 Sep 19.
74.	Impact of genomic risk factors on outcome after hematopoietic stem cell transplantation for patients with chronic myeloid leukemia.	Dickinson AM, etal., Haematologica. 2010 Jun;95(6):922-7. doi: 10.3324/haematol.2009.016220. Epub 2010 Mar 19.
75.	Regulatory T cell activity is partly inhibited in a mouse model of chronic Pseudomonas aeruginosa lung infection.	Ding FM, etal., Exp Lung Res. 2015 Feb;41(1):44-55. doi: 10.3109/01902148.2014.964351. Epub 2014 Nov 14.
76.	Cell division cycle protein 42 regulates the inflammatory response in mice bearing inflammatory bowel disease.	Dong LM, etal., Artif Cells Nanomed Biotechnol. 2019 Dec;47(1):1833-1838. doi: 10.1080/21691401.2019.1596936.
77.	IL-12 can alleviate Th17-mediated allergic lung inflammation through induction of pulmonary IL-10 expression.	Durrant DM and Metzger DW, Mucosal Immunol. 2010 May;3(3):301-11. Epub 2010 Mar 17.
78.	Efficacy and safety of an antiviral Iota-Carrageenan nasal spray: a randomized, double-blind, placebo-controlled exploratory study in volunteers with early symptoms of the common cold.	Eccles R, etal., Respir Res. 2010 Aug 10;11:108.
79.	Bacterial translocation in an experimental intestinal obstruction model. C-reactive protein reliability?	El-Awady SI, etal., Acta Cir Bras. 2009 Mar-Apr;24(2):98-106.
80.	Effect of interleukin-10 gene promoter polymorphisms -1082 G/A and -592 C/A on response to therapy in children and adolescents with chronic hepatitis C virus infection.	El-Karaksy HM, etal., Hum Immunol. 2016 Dec;77(12):1248-1253. doi: 10.1016/j.humimm.2016.09.005. Epub 2016 Sep 19.
81.	Role of interleukin-10 in the pathogenesis of necrotizing enterocolitis.	Emami CN, etal., Am J Surg. 2012 Apr;203(4):428-35. doi: 10.1016/j.amjsurg.2011.08.016.
82.	Association between interleukin-10 gene polymorphisms and severe chronic periodontitis.	Emampanahi M, etal., Oral Dis. 2019 May 4. doi: 10.1111/odi.13114.
83.	Genetic polymorphisms in immunoresponse genes TNFA, IL6, IL10, and TLR4 are associated with recurrent acute otitis media.	Emonts M, etal., Pediatrics. 2007 Oct;120(4):814-23.
84.	Radiofrequency ablation suppresses distant tumour growth in a novel rat model of multifocal hepatocellular carcinoma.	Eros de Bethlenfalva-Hora C, etal., Clin Sci (Lond). 2014 Feb 1;126(3):243-252.
85.	Recombinant human interleukin 10 in the treatment of patients with mild to moderately active Crohn's disease. The Interleukin 10 Inflammatory Bowel Disease Cooperative Study Group.	Fedorak RN, etal., Gastroenterology. 2000 Dec;119(6):1473-82.
86.	Molecular cloning of rat cytokine synthesis inhibitory factor (IL-10) cDNA and expression in spleen and macrophages.	Feng L, etal., Biochem Biophys Res Commun 1993 Apr 30;192(2):452-8.
87.	Serum levels of IL-6, IL-8, and IL-10 are indicators of prognosis in pancreatic cancer.	Feng L, etal., J Int Med Res. 2018 Dec;46(12):5228-5236. doi: 10.1177/0300060518800588. Epub 2018 Oct 10.
88.	Impaired cytokine production by peripheral blood mononuclear cells in type 1 diabetic patients.	Foss NT, etal., Diabetes Metab. 2007 Dec;33(6):439-43. Epub 2007 Nov 7.
89.	Nasal cardiac myosin peptide treatment and OX40 blockade protect mice from acute and chronic virally-induced myocarditis.	Fousteri G, etal., J Autoimmun. 2011 May;36(3-4):210-20. doi: 10.1016/j.jaut.2011.01.006. Epub 2011 Feb 17.
90.	Inflammation Profiling of Critically Ill Coronavirus Disease 2019 Patients.	Fraser DD, etal., Crit Care Explor. 2020 Jun 22;2(6):e0144. doi: 10.1097/CCE.0000000000000144. eCollection 2020 Jun.
91.	Pro-inflammatory cytokines in glaucomatous aqueous and encysted Molteno implant blebs and their relationship to pressure.	Freedman J and Iserovich P, Invest Ophthalmol Vis Sci. 2013 Jul 18;54(7):4851-5. doi: 10.1167/iovs.13-12274.
92.	Neuroprotection by IL-10-producing MOG CD4+ T cells following ischemic stroke.	Frenkel D, etal., J Neurol Sci. 2005 Jun 15;233(1-2):125-32.
93.	Interleukin 10 and transforming growth factor beta contribute to the development of experimentally induced allergic conjunctivitis in mice during the effector phase.	Fukushima A, etal., Br J Ophthalmol. 2006 Dec;90(12):1535-41. Epub 2006 Aug 16.
94.	Serum levels of interleukins 6, 10, and 13 before and after treatment of classic Hodgkin lymphoma.	Gaiolla RD, etal., Arch Pathol Lab Med. 2011 Apr;135(4):483-9. doi: 10.1043/2010-0060-OA.1.
95.	Erosive arthritis and hepatic granuloma formation induced by peptidoglycan polysaccharide in rats is aggravated by prasugrel treatment.	Garcia AE, etal., PLoS One. 2013 Jul 4;8(7):e69093. doi: 10.1371/journal.pone.0069093. Print 2013.
96.	Protective Effect of New Nitrosothiols on the Early Inflammatory Response to Kidney Ischemia/Reperfusion and Transplantation in Rats.	Garcia-Criado FJ, etal., J Interferon Cytokine Res. 2009 Jun 10.
97.	Glutamine decreases inflammation in infant rat endotoxemia.	Garrett-Cox RG, etal., J Pediatr Surg. 2009 Mar;44(3):523-9.
98.	Anti-inflammatory Effect of Triterpenoic Acids of Eriobotrya japonica (Thunb.) Lindl. Leaf on Rat Model of Chronic Bronchitis.	Ge JF, etal., Am J Chin Med. 2009;37(2):309-21.
99.	Systemic perfluorohexane attenuates lung injury induced by lipopolysaccharide in rats: the role of heme oxygenase-1.	Ge ZJ, etal., Pharmacol Rep. 2010 Jan-Feb;62(1):170-7.
100.	Green Tea Modulates Cytokine Expression in the Periodontium and Attenuates Alveolar Bone Resorption in Type 1 Diabetic Rats.	Gennaro G, etal., PLoS One. 2015 Aug 13;10(8):e0134784. doi: 10.1371/journal.pone.0134784. eCollection 2015.
101.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
102.	Dual effect of nitric oxide donor on adjuvant arthritis.	Gomaa AA, etal., Int Immunopharmacol. 2009 Apr;9(4):439-47. Epub 2009 Feb 2.
103.	Relevance of HLA-G, HLA-E and IL-10 expression in lip carcinogenesis.	Gonçalves AS, etal., Hum Immunol. 2016 Sep;77(9):785-90. doi: 10.1016/j.humimm.2015.12.001. Epub 2015 Dec 23.
104.	Adjunctive daptomycin attenuates brain damage and hearing loss more efficiently than rifampin in infant rat pneumococcal meningitis.	Grandgirard D, etal., Antimicrob Agents Chemother. 2012 Aug;56(8):4289-95. doi: 10.1128/AAC.00674-12. Epub 2012 May 29.
105.	Effects of amniotic membrane transplantation on cytokines expression in chemically burned rat corneas.	Gu HW, etal., Int J Ophthalmol. 2011;4(1):33-6. doi: 10.3980/j.issn.2222-3959.2011.01.07. Epub 2011 Feb 18.
106.	Moderate Hypothermia Inhibits Brain Inflammation and Attenuates Stroke-Induced Immunodepression in Rats.	Gu LJ, etal., CNS Neurosci Ther. 2013 Aug 24. doi: 10.1111/cns.12160.
107.	Dissection of mechanisms of a chinese medicinal formula: danhong injection therapy for myocardial ischemia/reperfusion injury in vivo and in vitro.	Guan Y, etal., Evid Based Complement Alternat Med. 2013;2013:972370. doi: 10.1155/2013/972370. Epub 2013 Jun 3.
108.	Tumor necrosis factor suppresses interleukin 10 in peripheral B cells via upregulating Bcl2-like protein 12 in patients with inflammatory bowel disease.	Guo X, etal., Cell Biochem Funct. 2017 Mar;35(2):77-82. doi: 10.1002/cbf.3250. Epub 2017 Jan 24.
109.	Plasma-induced signatures reveal an extracellular milieu possessing an immunoregulatory bias in treatment-naive paediatric inflammatory bowel disease.	Gurram B, etal., Clin Exp Immunol. 2016 Apr;184(1):36-49. doi: 10.1111/cei.12753. Epub 2016 Jan 29.
110.	Interleukin-10 gene -627 allele variants, not interleukin-I beta gene and receptor antagonist gene polymorphisms, are associated with atopic bronchial asthma.	Hang LW, etal., J Clin Lab Anal. 2003;17(5):168-73.
111.	[A study of pulmonary inflammatory reaction induced by N-protein of SARS-CoV in rat models and effects of glucocorticoids on it].	Hao D, etal., Zhonghua Nei Ke Za Zhi. 2005 Dec;44(12):890-3.
112.	Mucosal immunotherapy in an Alzheimer mouse model by recombinant Sendai virus vector carrying Abeta1-43/IL-10 cDNA.	Hara H, etal., Vaccine. 2011 Oct 6;29(43):7474-82. doi: 10.1016/j.vaccine.2011.07.057. Epub 2011 Jul 29.
113.	Elevated serum levels of interleukin 4 (IL-4), IL-10, and IL-13 in patients with systemic sclerosis.	Hasegawa M, etal., J Rheumatol. 1997 Feb;24(2):328-32.
114.	Interleukin-10 to tumor necrosis factor-alpha ratio is a predictive biomarker in nonalcoholic fatty liver disease: interleukin-10 to tumor necrosis factor-alpha ratio in steatohepatitis.	Hashem RM, etal., Eur J Gastroenterol Hepatol. 2008 Oct;20(10):995-1001.
115.	Intrathecal Lentivirus-mediated Transfer of Interleukin-10 Attenuates Chronic Constriction Injury-induced Neuropathic Pain through Modulation of Spinal High-mobility Group Box 1 in Rats.	He Z, etal., Pain Physician. 2013 Sep-Oct;16(5):E615-25.
116.	Association of colonic regulatory T cells with hepatitis C virus pathogenesis and liver pathology.	Hetta HF, etal., J Gastroenterol Hepatol. 2015 Oct;30(10):1543-51. doi: 10.1111/jgh.12936.
117.	Prevention of scattered light-induced asthenopia and fatigue by a polarized filter.	Hiramoto K, etal., Photodermatol Photoimmunol Photomed. 2010 Apr;26(2):89-92. doi: 10.1111/j.1600-0781.2010.00497.x.
118.	Using IL-2R/lymphocytes for predicting the clinical progression of patients with COVID-19.	Hou H, etal., Clin Exp Immunol. 2020 Jul;201(1):76-84. doi: 10.1111/cei.13450. Epub 2020 May 15.
119.	Clinical features of patients infected with 2019 novel coronavirus in Wuhan, China.	Huang C, etal., Lancet. 2020 Feb 15;395(10223):497-506. doi: 10.1016/S0140-6736(20)30183-5. Epub 2020 Jan 24.
120.	Combined intrathymic and intravenous injection of mesenchymal stem cells can prolong the survival of rat cardiac allograft associated with decrease in miR-155 expression.	Huang H, etal., J Surg Res. 2013 Jun 29. pii: S0022-4804(13)00604-5. doi: 10.1016/j.jss.2013.06.015.
121.	Inhibition of microRNA-210 suppresses pro-inflammatory response and reduces acute brain injury of ischemic stroke in mice.	Huang L, etal., Exp Neurol. 2018 Feb;300:41-50. doi: 10.1016/j.expneurol.2017.10.024. Epub 2017 Oct 27.
122.	Role of sulfur dioxide in acute lung injury following limb ischemia/reperfusion in rats.	Huang XL, etal., J Biochem Mol Toxicol. 2013 Aug;27(8):389-97. doi: 10.1002/jbt.21492. Epub 2013 Jun 25.
123.	Hydrodynamics-based transfection of rat interleukin-10 gene attenuates porcine serum-induced liver fibrosis in rats by inhibiting the activation of hepatic stellate cells.	Huang YH, etal., Int J Mol Med. 2014 Sep;34(3):677-86. doi: 10.3892/ijmm.2014.1831. Epub 2014 Jul 2.
124.	Association of inflammatory and anti-inflammatory cytokines with insulin resistance in chronic hepatitis C.	Hung CH, etal., Liver Int. 2009 Feb 28.
125.	Therapeutic effects of acupuncture with MOK, a polyherbal medicine, on PTU-induced hypothyroidism in rats.	Hwang JH, etal., Exp Ther Med. 2018 Jul;16(1):310-320. doi: 10.3892/etm.2018.6190. Epub 2018 May 18.
126.	TNF-alpha, IFN-gamma, IL-10, and IL-4 levels were elevated in a murine model of human sickle cell anemia maintained on a high protein/calorie diet.	Hyacinth HI, etal., Exp Biol Med (Maywood). 2014 Jan;239(1):65-70. doi: 10.1177/1535370213508357. Epub 2013 Nov 26.
127.	Submicroscopic infections with Plasmodium falciparum during pregnancy and their association with circulating cytokine, chemokine, and cellular profiles.	Ibitokou SA, etal., Clin Vaccine Immunol. 2014 Jun;21(6):859-66. doi: 10.1128/CVI.00009-14. Epub 2014 Apr 9.
128.	Carcinoembryonic antigen promotes tumor cell survival in liver through an IL-10-dependent pathway.	Jessup JM, etal., Clin Exp Metastasis. 2004;21(8):709-17.
129.	Role of IL-10 gene polymorphisms in the development of acute pancreatitis.	Jiang BZ, etal., Genet Mol Res. 2016 May 9;15(2). pii: gmr7743. doi: 10.4238/gmr.15027743.
130.	Response of lymphocyte subsets and cytokines to Shenyang prescription in Sprague-Dawley rats with tongue squamous cell carcinomas induced by 4NQO.	Jiang C, etal., BMC Cancer. 2007 Mar 5;7:40.
131.	Paeoniflorin Inhibits Systemic Inflammation and Improves Survival in Experimental Sepsis.	Jiang WL, etal., Basic Clin Pharmacol Toxicol. 2009 Apr 3.
132.	[Relationship between transforming growth factor-β1 and interleukin-10 single nucleotide polymorphism and susceptibility of recurrent aphthous ulcer].	Jing Z, etal., Hua Xi Kou Qiang Yi Xue Za Zhi. 2016 Feb;34(1):27-31.
133.	The relationship between thyroid function, serum monokine induced by interferon gamma and soluble interleukin-2 receptor in thyroid autoimmune diseases.	Jiskra J, etal., Clin Exp Immunol. 2009 May;156(2):211-6. doi: 10.1111/j.1365-2249.2009.03897.x. Epub 2009 Feb 4.
134.	Neutrophil derived microparticles increase mortality and the counter-inflammatory response in a murine model of sepsis.	Johnson BL, etal., Biochim Biophys Acta Mol Basis Dis. 2017 Oct;1863(10 Pt B):2554-2563. doi: 10.1016/j.bbadis.2017.01.012. Epub 2017 Jan 17.
135.	Protective Effect of α-Linolenic Acid on Non-Alcoholic Hepatic Steatosis and Interleukin-6 and -10 in Wistar Rats.	Jordão Candido C, etal., Nutrients. 2019 Dec 18;12(1):9. doi: 10.3390/nu12010009.
136.	Increased IL10 plasmatic levels in Fanconi anemia patients.	Justo GA, etal., Cytokine. 2013 Nov;64(2):486-9. doi: 10.1016/j.cyto.2013.08.004. Epub 2013 Sep 7.
137.	Interleukin-10 gene therapy attenuates pulmonary tissue injury caused by mesenteric ischemia-reperfusion in a mouse model.	Kabay B, etal., Tohoku J Exp Med. 2005 Oct;207(2):133-42.
138.	IL-10 genotype predicts serum levels of adhesion molecules, inflammation and atherosclerosis in hemodialysis patients.	Kahraman S, etal., J Nephrol. 2006 Jan-Feb;19(1):50-6.
139.	IL-10 expression in pyramidal neurons after neuropathogenic coronaviral infection.	Kakizaki M and Watanabe R, Neuropathology. 2017 Oct;37(5):398-406. doi: 10.1111/neup.12386. Epub 2017 May 11.
140.	JTE-607, a novel inflammatory cytokine synthesis inhibitor without immunosuppression, protects from endotoxin shock in mice.	Kakutani M, etal., Inflamm Res. 1999 Aug;48(8):461-8. doi: 10.1007/s000110050487.
141.	Production of the novel mesangial autocrine growth factors GDNF and IL-10 is regulated by the immunomodulator AS101.	Kalechman Y, etal., J Am Soc Nephrol 2003 Mar;14(3):620-30.
142.	Serum levels of tetranectin, intercellular adhesion molecule-1 and interleukin-10 in B-chronic lymphocytic leukemia.	Kamper EF, etal., Clin Biochem. 1999 Nov;32(8):639-45.
143.	Protective effect of carbon monoxide inhalation on lung injury after hemorrhagic shock/resuscitation in rats.	Kanagawa F, etal., J Trauma. 2010 Jul;69(1):185-94.
144.	Multivariate analyses of inflammatory cytokines in eyes with branch retinal vein occlusion: relationships to bevacizumab treatment.	Kaneda S, etal., Invest Ophthalmol Vis Sci. 2011 May 6;52(6):2982-8. doi: 10.1167/iovs.10-6299.
145.	Genetic kininogen deficiency contributes to aortic aneurysm formation but not to atherosclerosis.	Kaschina E, etal., Physiol Genomics 2004 Sep 16;19(1):41-9. Epub 2004 Jul 06.
146.	Significance of changes in TNF-alpha and IL-10 levels in the progression of heart failure subsequent to myocardial infarction.	Kaur K, etal., Am J Physiol Heart Circ Physiol. 2006 Jul;291(1):H106-13. Epub 2006 Feb 3.
147.	Identification of Th2-type suppressor T cells among in vivo expanded ocular T cells in mice with experimental autoimmune uveoretinitis.	Keino H, etal., Clin Exp Immunol. 2001 Apr;124(1):1-8.
148.	Peritoneal exudate cells treated with calcitonin gene-related peptide suppress murine experimental autoimmune uveoretinitis via IL-10.	Kezuka T, etal., J Immunol. 2004 Jul 15;173(2):1454-62.
149.	Pharmacological inhibition of p110δ subunit of PI3K confers protection against experimental leishmaniasis.	Khadem F, etal., J Antimicrob Chemother. 2017 Feb;72(2):467-477. doi: 10.1093/jac/dkw448. Epub 2016 Dec 20.
150.	Gene polymorphisms of interleukin-4, interleukin-10 and transforming growth factor-beta in Graves' disease.	Khalilzadeh O, etal., Clin Exp Med. 2010 Jun;10(2):123-8. doi: 10.1007/s10238-009-0078-5. Epub 2009 Oct 31.
151.	Genetic susceptibility to Graves' ophthalmopathy: The role of polymorphisms in anti-inflammatory cytokine genes.	Khalilzadeh O, etal., Ophthalmic Genet. 2010 Dec;31(4):215-20. doi: 10.3109/13816810.2010.515648.
152.	Intranasally administered antigen 85B gene vaccine in non-replicating human Parainfluenza type 2 virus vector ameliorates mouse atopic dermatitis.	Kitagawa H, etal., PLoS One. 2013 Jul 3;8(7):e66614. doi: 10.1371/journal.pone.0066614. Print 2013.
153.	Topical treatment targeting sphingosine-1-phosphate and sphingosine lyase abrogates experimental allergic rhinitis in a murine model.	Kleinjan A, etal., Allergy. 2013 Feb;68(2):204-12. doi: 10.1111/all.12082. Epub 2012 Dec 18.
154.	Ursodeoxycholic Acid Inhibits Inflammatory Responses and Promotes Functional Recovery After Spinal Cord Injury in Rats.	Ko WK, etal., Mol Neurobiol. 2019 Jan;56(1):267-277. doi: 10.1007/s12035-018-0994-z. Epub 2018 Mar 20.
155.	Effects of intrathecal epigallocatechin gallate, an inhibitor of Toll-like receptor 4, on chronic neuropathic pain in rats.	Kuang X, etal., Eur J Pharmacol. 2012 Feb 15;676(1-3):51-6. doi: 10.1016/j.ejphar.2011.11.037. Epub 2011 Dec 7.
156.	Neutralization of IL-10 Exacerbates Cycloheximide-Induced Hepatocellular Apoptosis and Necrosis.	Kumagai K, etal., Toxicol Pathol. 2009 Apr 24.
157.	Multiple antioxidants improve cardiac complications and inhibit cardiac cell death in streptozotocin-induced diabetic rats.	Kumar S, etal., PLoS One. 2013 Jul 2;8(7):e67009. doi: 10.1371/journal.pone.0067009. Print 2013.
158.	Analysis of Gene Expression in Experimental Pressure Ulcers in the Rat with Special Reference to Inflammatory Cytokines.	Kurose T, etal., PLoS One. 2015 Jul 15;10(7):e0132622. doi: 10.1371/journal.pone.0132622. eCollection 2015.
159.	The effects of natural pollen exposure on inflammatory cytokines and their relationship with nonspecific bronchial hyperresponsiveness in seasonal allergic rhinitis.	Kurt E, etal., Allergy Asthma Proc. 2010 Mar;31(2):126-31.
160.	Low plasma concentrations of interleukin 10 in severe malarial anaemia compared with cerebral and uncomplicated malaria.	Kurtzhals JA, etal., Lancet. 1998 Jun 13;351(9118):1768-72.
161.	Circulating pro- and anti-inflammatory cytokines in Polish women with gestational diabetes.	Kuzmicki M, etal., Horm Metab Res. 2008 Aug;40(8):556-60. Epub 2008 Apr 30.
162.	Aqueous and serum interferon gamma, interleukin (IL) 2, IL-4, and IL-10 in patients with uveitis.	Lacomba MS, etal., Arch Ophthalmol. 2000 Jun;118(6):768-72.
163.	Advantages of promoting interleukin-10 by silence of histone deacetylase 11 in inducing tolerance in orthotopic liver transplantation in rats.	Lai X, etal., Transplant Proc. 2011 Sep;43(7):2728-32. doi: 10.1016/j.transproceed.2011.05.044.
164.	Interleukin-10 controls the onset of irreversible septic shock.	Latifi SQ, etal., Infect Immun. 2002 Aug;70(8):4441-6.
165.	Cytokine involvement in dynorphin-induced allodynia.	Laughlin TM, etal., Pain. 2000 Feb;84(2-3):159-67.
166.	Serum tumor necrosis factor-alpha and interleukin-10 levels as markers to predict outcome of patients with chronic lymphocytic leukemia in different risk groups defined by the IGHV mutation status.	Lech-Maranda E, etal., Arch Immunol Ther Exp (Warsz). 2012 Dec;60(6):477-86. doi: 10.1007/s00005-012-0197-7. Epub 2012 Sep 4.
167.	Expression and regulation of interleukin-10 and interleukin-10 receptor in rat astroglial and microglial cells.	Ledeboer A, etal., Eur J Neurosci 2002 Oct;16(7):1175-85.
168.	Propofol Protects Against Hemorrhagic Shock-Induced Organ Damage in Conscious Spontaneously Hypertensive Rats.	Lee CJ, etal., Biol Res Nurs. 2009 May 5.
169.	Cytokine profile of peripheral blood in type 2 diabetes mellitus patients with diabetic retinopathy.	Lee JH, etal., Ann Clin Lab Sci. 2008 Autumn;38(4):361-7.
170.	Control of inflammation by stromal Hedgehog pathway activation restrains colitis.	Lee JJ, etal., Proc Natl Acad Sci U S A. 2016 Nov 22;113(47):E7545-E7553. doi: 10.1073/pnas.1616447113. Epub 2016 Nov 4.
171.	Analysis of tear cytokines and clinical correlations in Sjogren syndrome dry eye patients and non-Sjogren syndrome dry eye patients.	Lee SY, etal., Am J Ophthalmol. 2013 Aug;156(2):247-253.e1. doi: 10.1016/j.ajo.2013.04.003. Epub 2013 Jun 7.
172.	Cardiac mast cells mediate left ventricular fibrosis in the hypertensive rat heart.	Levick SP, etal., Hypertension. 2009 Jun;53(6):1041-7. Epub 2009 Apr 27.
173.	Expression profiles of regulatory and helper T-cell-associated genes in nasal polyposis.	Li CW, etal., Allergy. 2012 Jun;67(6):732-40. doi: 10.1111/j.1398-9995.2012.02811.x. Epub 2012 Mar 30.
174.	Effects of early administration of a novel anticholinergic drug on acute respiratory distress syndrome induced by sepsis.	Li H, etal., Med Sci Monit. 2011 Nov;17(11):BR319-325.
175.	Alterations of T helper lymphocyte subpopulations in sepsis, severe sepsis, and septic shock: a prospective observational study.	Li J, etal., Inflammation. 2015;38(3):995-1002. doi: 10.1007/s10753-014-0063-3.
176.	Endotoxin tolerance attenuates liver ischemia/reperfusion injury by down-regulation of interleukin-1 receptor-associated kinase 4 in kupffer cells.	Li J, etal., Transplant Proc. 2011 Sep;43(7):2531-5. doi: 10.1016/j.transproceed.2011.05.045.
177.	Investigation on the association between IL-10 C819T gene polymorphisms and susceptibility to gastric cancer.	Li L, etal., Genet Mol Res. 2016 Dec 19;15(4). pii: gmr-15-04-gmr.15047915. doi: 10.4238/gmr15047915.
178.	Cardiovascular disease potentially contributes to the progression and poor prognosis of COVID-19.	Li M, etal., Nutr Metab Cardiovasc Dis. 2020 Jun 25;30(7):1061-1067. doi: 10.1016/j.numecd.2020.04.013. Epub 2020 Apr 18.
179.	Zhongguo Zhong xi yi jie he za zhi Zhongguo Zhongxiyi jiehe zazhi = Chinese journal of integrated traditional and Western medicine / Zhongguo Zhong xi yi jie he xue hui, Zhongguo Zhong yi yan jiu yuan zhu ban	Li M, etal., Zhongguo Zhong Xi Yi Jie He Za Zhi. 2008 Nov;28(11):1018-21.
180.	Live and heat-killed Lactobacillus rhamnosus GG: effects on proinflammatory and anti-inflammatory cytokines/chemokines in gastrostomy-fed infant rats.	Li N, etal., Pediatr Res. 2009 Aug;66(2):203-7.
181.	Time-dependent inflammatory factor production and NFkappaB activation in a rodent model of intermittent hypoxia.	Li S, etal., Swiss Med Wkly. 2011 Nov 30;141:w13309. doi: 10.4414/smw.2011.13309.
182.	Antigen-specific tolerance induced by IL-10 gene modified immature dendritic cells in experimental autoimmune myocarditis in rats.	Li WM, etal., Chin Med J (Engl). 2006 Oct 5;119(19):1646-52.
183.	[Effects of electroacupuncture and manual acupuncture interventions on contents of serum inflammatory cytokines in rats with chronic adjuvant arthritis].	Li WX, etal., Zhen Ci Yan Jiu. 2012 Aug;37(4):271-6.
184.	Common genetic variants in candidate genes and risk of familial lymphoid malignancies.	Liang XS, etal., Br J Haematol. 2009 Aug;146(4):418-23. doi: 10.1111/j.1365-2141.2009.07790.x. Epub 2009 Jul 1.
185.	Autologous transplantation of adipose-derived stromal cells ameliorates ventilator-induced lung injury in rats.	Liang ZD, etal., J Transl Med. 2013 Jul 26;11(1):179.
186.	Female sex hormones mediate the allergic lung reaction by regulating the release of inflammatory mediators and the expression of lung E-selectin in rats.	Ligeiro de Oliveira AP, etal., Respir Res. 2010 Aug 24;11(1):115.
187.	Neuronal synapse formation induced by microglia and interleukin 10.	Lim SH, etal., PLoS One. 2013 Nov 22;8(11):e81218. doi: 10.1371/journal.pone.0081218. eCollection 2013.
188.	Ultra-low dose naloxone restores the antinocicepitve effect of morphine in PTX-treated rats: association of IL-10 upregulation in the spinal cord.	Lin YS, etal., Life Sci. 2012 Sep 4;91(5-6):213-20. doi: 10.1016/j.lfs.2012.07.005. Epub 2012 Jul 20.
189.	Opposite effects of interleukin 10 common gene polymorphisms in cardiovascular diseases and in successful ageing: genetic background of male centenarians is protective against coronary heart disease.	Lio D, etal., J Med Genet. 2004 Oct;41(10):790-4.
190.	Anti-mouse CD52 Treatment Ameliorates Colitis through Suppressing Th1/17 Mediated Inflammation and Promoting Tregs Differentiation in IL-10 Deficient Mice.	Liu J, etal., Biol Pharm Bull. 2018 Sep 1;41(9):1423-1429. doi: 10.1248/bpb.b18-00261. Epub 2018 Jun 13.
191.	Higher serum levels of interleukin 10 occur at onset of acute otitis media caused by Streptococcus pneumoniae compared to Haemophilus influenzae and Moraxella catarrhalis.	Liu K, etal., Laryngoscope. 2013 Jun;123(6):1500-5. doi: 10.1002/lary.23973. Epub 2013 Feb 12.
192.	An association of interleukin-10 gene polymorphisms with Graves' disease in two Chinese populations.	Liu N, etal., Endocrine. 2011 Aug;40(1):90-4. doi: 10.1007/s12020-011-9444-7. Epub 2011 Mar 18.
193.	Suppression of complete Freund's adjuvant-induced adjuvant arthritis by cobratoxin.	Liu YL, etal., Acta Pharmacol Sin. 2009 Feb;30(2):219-27. doi: 10.1038/aps.2008.20. Epub 2009 Jan 26.
194.	Differential expression of cytokine genes and inducible nitric oxide synthase induced by opacity phenotype variants of Streptococcus pneumoniae during acute otitis media in the rat.	Long JP, etal., Infect Immun. 2003 Oct;71(10):5531-40.
195.	The temperature-sensitive mutants of Toxoplasma gondii and ocular toxoplasmosis.	Lu F, etal., Vaccine. 2009 Jan 22;27(4):573-80. doi: 10.1016/j.vaccine.2008.10.090. Epub 2008 Nov 19.
196.	[Effect of electroacupuncture stimulation of "Feishu" (BL 13) on lung index, serum and lung IL-10 and TNF-alpha levels in mice with viral pneumonia].	Luo W, etal., Zhen Ci Yan Jiu. 2014 Aug;39(4):293-7.
197.	The interaction of oxidative stress response with cytokines in the thyrotoxic rat: is there a link?	Makay B, etal., Mediators Inflamm. 2009;2009:391682. Epub 2009 Mar 30.
198.	Expression of IL4 (VNTR intron 3) and IL10 (-627) genes polymorphisms in childhood immune thrombocytopenic purpura.	Makhlouf MM and Abd Elhamid SM, Lab Med. 2014 Summer;45(3):211-9. doi: 10.1309/LMB0QC5T1RXTTRZQ.
199.	Cytokine production from sputum cells and blood leukocytes in asthmatics according to disease severity.	Manise M, etal., Allergy. 2010 Jul;65(7):889-96. Epub 2010 Jan 28.
200.	Factors associated with inflammatory cytokine patterns in community-acquired pneumonia.	Martinez R, etal., Eur Respir J. 2010 Jul 1.
201.	Insulin regulates cytokines and intercellular adhesion molecule-1 gene expression through nuclear factor-kappaB activation in LPS-induced acute lung injury in rats.	Martins JO, etal., Shock. 2009 Apr;31(4):404-9.
202.	Low-dose lipopolysaccharide pretreatment suppresses choroidal neovascularization via IL-10 induction.	Matsumura N, etal., PLoS One. 2012;7(7):e39890. doi: 10.1371/journal.pone.0039890. Epub 2012 Jul 3.
203.	Knockout of Mkp-1 exacerbates colitis in Il-10-deficient mice.	Matta R, etal., Am J Physiol Gastrointest Liver Physiol. 2012 Jun 1;302(11):G1322-35. doi: 10.1152/ajpgi.00018.2012. Epub 2012 Mar 29.
204.	A study of association between regulatory polymorphism in the IL-10 gene promoter region and acute viral hepatitis, and acute liver failure.	Maurya G, etal., Indian J Gastroenterol. 2018 Jul;37(4):293-298. doi: 10.1007/s12664-018-0858-5. Epub 2018 Aug 15.
205.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
206.	Cytokine gene polymorphisms associating with severe acute graft-versus-host disease in HLA-identical sibling transplants.	Middleton PG, etal., Blood. 1998 Nov 15;92(10):3943-8.
207.	Repeated intrathecal injections of plasmid DNA encoding interleukin-10 produce prolonged reversal of neuropathic pain.	Milligan ED, etal., Pain. 2006 Dec 15;126(1-3):294-308. Epub 2006 Sep 1.
208.	Regulatory function of CpG-activated B cells in late-phase experimental allergic conjunctivitis.	Miyazaki D, etal., Invest Ophthalmol Vis Sci. 2009 Apr;50(4):1626-35. doi: 10.1167/iovs.08-2701. Epub 2008 Dec 5.
209.	Involvement of CD40-CD40L signaling in postischemic lung injury.	Moore TM, etal., Am J Physiol Lung Cell Mol Physiol. 2002 Dec;283(6):L1255-62. Epub 2002 Aug 9.
210.	Interleukin-10 gene expression in adult T-cell leukemia.	Mori N, etal., Blood. 1996 Aug 1;88(3):1035-45.
211.	Polymorphisms in candidate genes and risk of scarring trachoma in a Chlamydia trachomatis--endemic population.	Mozzato-Chamay N, etal., J Infect Dis. 2000 Nov;182(5):1545-8. Epub 2000 Oct 9.
212.	Predictive value of interleukin-10 promoter genotypes and haplotypes in determining the susceptibility to nephropathy in type 2 diabetes patients.	Mtiraoui N, etal., Diabetes Metab Res Rev. 2009 Jan;25(1):57-63.
213.	Epidermal Growth Factor Receptor-Responsive Indoleamine 2,3-Dioxygenase Confers Immune Homeostasis During Shigella flexneri Infection.	Mukherjee T, etal., J Infect Dis. 2019 May 5;219(11):1841-1851. doi: 10.1093/infdis/jiz009.
214.	Assessing immunological surgical stress markers in patients undergoing digestive surgery for pancreatic, hepatic and gastric tumors.	Munteanu A, etal., J BUON. 2018 Nov-Dec;23(6):1655.
215.	Serum Th1 and Th2 profile cytokine level changes in patients with Graves' ophthalmopathy treated with corticosteroids.	Mysliwiec J, etal., Horm Metab Res. 2001 Dec;33(12):739-43.
216.	The activity of N-acetyl-beta-D-glucosaminidase and tumor necrosis factor-alpha at early stage of diabetic retinopathy development in type 1 diabetes mellitus children.	Mysliwiec M, etal., Clin Biochem. 2006 Aug;39(8):851-6. Epub 2006 Apr 5.
217.	Increased Th17 functions are accompanied by Tregs activities in lupoid leishmaniasis.	Nabavi NS, etal., Parasite Immunol. 2018 Jan;40(1). doi: 10.1111/pim.12507. Epub 2017 Dec 17.
218.	Rhinovirus infection of allergen-sensitized and -challenged mice induces eotaxin release from functionally polarized macrophages.	Nagarkar DR, etal., J Immunol. 2010 Aug 15;185(4):2525-35. Epub 2010 Jul 19.
219.	Regulatory role of IL-10 in experimental obliterative bronchiolitis in rats.	Naidu B, etal., Exp Mol Pathol 2002 Dec;73(3):164-70.
220.	High expression of IL-22 suppresses antigen-induced immune responses and eosinophilic airway inflammation via an IL-10-associated mechanism.	Nakagome K, etal., J Immunol. 2011 Nov 15;187(10):5077-89. doi: 10.4049/jimmunol.1001560. Epub 2011 Oct 12.
221.	Increased expression of HBZ and Foxp3 mRNA in bronchoalveolar lavage cells taken from human T-lymphotropic virus type 1-associated lung disorder patients.	Nakayama Y, etal., Intern Med. 2013;52(23):2599-609. doi: 10.2169/internalmedicine.52.0845.
222.	Risk of trachomatous scarring and trichiasis in Gambians varies with SNP haplotypes at the interferon-gamma and interleukin-10 loci.	Natividad A, etal., Genes Immun. 2005 Jun;6(4):332-40.
223.	Susceptibility to sequelae of human ocular chlamydial infection associated with allelic variation in IL10 cis-regulation.	Natividad A, etal., Hum Mol Genet. 2008 Jan 15;17(2):323-9. Epub 2007 Oct 18.
224.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
225.	Early prediction of sepsis-induced disseminated intravascular coagulation with interleukin-10, interleukin-6, and RANTES in preterm infants.	Ng PC, etal., Clin Chem. 2006 Jun;52(6):1181-9. Epub 2006 Apr 13.
226.	No apparent association between periocular and ocular microcolonization and the degree of inflammation in patients with atopic keratoconjunctivitis.	Nivenius E, etal., Clin Exp Allergy. 2004 May;34(5):725-30.
227.	Conjunctival provocation with airborne allergen in patients with atopic keratoconjunctivitis.	Nivenius E, etal., Clin Exp Allergy. 2012 Jan;42(1):58-65. doi: 10.1111/j.1365-2222.2011.03858.x. Epub 2011 Sep 20.
228.	Cytokine gene polymorphism and graft-versus-host disease: a survey in Iranian bone marrow transplanted patients.	Noori-Daloii MR, etal., Mol Biol Rep. 2013 Aug;40(8):4861-7. doi: 10.1007/s11033-013-2585-4. Epub 2013 May 6.
229.	Aerobic exercise improves the inflammatory profile correlated with cardiac remodeling and function in chronic heart failure rats.	Nunes RB, etal., Clinics (Sao Paulo). 2013 Jun;68(6):876-82. doi: 10.6061/clinics/2013(06)24.
230.	Gestational stress leads to depressive-like behavioural and immunological changes in the rat.	O'mahony SM, etal., Neuroimmunomodulation. 2006;13(2):82-8. Epub 2006 Oct 10.
231.	Lipid-mediated transbronchial human interleukin-10 gene transfer decreases acute inflammation associated with allograft rejection in a rat model of lung transplantation.	Oishi H, etal., Transplant Proc. 2007 Jan-Feb;39(1):283-5.
232.	Deficiency of Phosphatidylinositol 3-Kinase δ Signaling Leads to Diminished Numbers of Regulatory T Cells and Increased Neutrophil Activity Resulting in Mortality Due to Endotoxic Shock.	Okeke EB, etal., J Immunol. 2017 Aug 1;199(3):1086-1095. doi: 10.4049/jimmunol.1600954. Epub 2017 Jun 28.
233.	Protective actions of melatonin against heart damage during chronic Chagas disease.	Oliveira LG, etal., Acta Trop. 2013 Sep 19. pii: S0001-706X(13)00249-0. doi: 10.1016/j.actatropica.2013.09.014.
234.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
235.	Association of tumor necrosis factor alpha, interleukin 6, and interleukin 10 promoter polymorphism with proliferative diabetic retinopathy in type 2 diabetic subjects.	Paine SK, etal., Retina. 2012 Jun;32(6):1197-203. doi: 10.1097/IAE.0b013e31822f55f3.
236.	Severity of non-alcoholic fatty liver disease is associated with high systemic levels of tumor necrosis factor alpha and low serum interleukin 10 in morbidly obese patients.	Paredes-Turrubiarte G, etal., Clin Exp Med. 2016 May;16(2):193-202. doi: 10.1007/s10238-015-0347-4. Epub 2015 Apr 18.
237.	Dietary Consumption of Black Raspberries or Their Anthocyanin Constituents Alters Innate Immune Cell Trafficking in Esophageal Cancer.	Peiffer DS, etal., Cancer Immunol Res. 2016 Jan;4(1):72-82. doi: 10.1158/2326-6066.CIR-15-0091. Epub 2015 Nov 24.
238.	Mesenchymal stromal cells infusions improve refractory chronic graft versus host disease through an increase of CD5+ regulatory B cells producing interleukin 10.	Peng Y, etal., Leukemia. 2015 Mar;29(3):636-46. doi: 10.1038/leu.2014.225. Epub 2014 Jul 18.
239.	Interleukin-10 and related cytokines and receptors.	Pestka S, etal., Annu Rev Immunol. 2004;22:929-79.
240.	Interleukin (IL)-10 inhibits RANTES-, tumour necrosis factor (TNF)- and nerve growth factor (NGF)-induced mast cell migratory response but is not a mast cell chemoattractant.	Pietrzak A, etal., Immunol Lett. 2009 Mar 24;123(1):46-51. Epub 2009 Feb 14.
241.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
242.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
243.	Systemic immune dysfunction in pancreatic cancer patients.	Poch B, etal., Langenbecks Arch Surg. 2007 May;392(3):353-8. Epub 2007 Jan 19.
244.	The IL-10-1082 (rs1800896) G allele is associated with a decreased risk of developing premature coronary artery disease and some IL-10 polymorphisms were associated with clinical and metabolic parameters. The GEA study.	Posadas-Sánchez R, etal., Cytokine. 2018 Jun;106:12-18. doi: 10.1016/j.cyto.2018.02.028. Epub 2018 Mar 9.
245.	Interleukin-10 conjugated electrospun polycaprolactone (PCL) nanofibre scaffolds for promoting alternatively activated (M2) macrophages around the peripheral nerve in vivo.	Potas JR, etal., J Immunol Methods. 2015 May;420:38-49. doi: 10.1016/j.jim.2015.03.013. Epub 2015 Mar 31.
246.	Interleukin-10 promoter microsatellite polymorphisms influence the immune response to heparin and the risk of heparin-induced thrombocytopenia.	Pouplard C, etal., Thromb Res. 2012 Apr;129(4):465-9. doi: 10.1016/j.thromres.2011.09.033. Epub 2012 Jan 10.
247.	Concentrations of antiganglioside M1 antibodies, neuron-specific enolase, and interleukin 10 as potential markers of autonomic nervous system impairment in celiac disease.	Przybylska-Feluś M, etal., Pol Arch Med Wewn. 2016 Aug 22;126(10):763-771. doi: 10.20452/pamw.3512. Epub 2016 Aug 22.
248.	Role of microglia in inflammation-mediated degeneration of dopaminergic neurons: neuroprotective effect of interleukin 10.	Qian L, etal., J Neural Transm Suppl. 2006;(70):367-71.
249.	Galectin-1 reduces the severity of herpes simplex virus-induced ocular immunopathological lesions.	Rajasagi NK, etal., J Immunol. 2012 May 1;188(9):4631-43. doi: 10.4049/jimmunol.1103063. Epub 2012 Mar 30.
250.	Deferoxamine modulates cytokines and growth factors to accelerate cutaneous wound healing in diabetic rats.	Ram M, etal., Eur J Pharmacol. 2015 Oct 5;764:9-21. doi: 10.1016/j.ejphar.2015.06.029. Epub 2015 Jun 19.
251.	IL-10 -1082 SNP and IL-10 in primary CNS and vitreoretinal lymphomas.	Ramkumar HL, etal., Graefes Arch Clin Exp Ophthalmol. 2012 Oct;250(10):1541-8. doi: 10.1007/s00417-012-2037-1. Epub 2012 May 25.
252.	Tumour necrosis factor, interleukin-6 and interleukin-10 are possibly involved in Plasmodium vivax-associated thrombocytopaenia in southern Pakistani population.	Raza A, etal., Malar J. 2014 Aug 16;13:323. doi: 10.1186/1475-2875-13-323.
253.	Application quantitative proteomics approach to identify differentially expressed proteins associated with cardiac protection mediated by cycloastragenol in acute myocardial infarction rats.	Ren YS, etal., J Proteomics. 2020 Jun 30;222:103691. doi: 10.1016/j.jprot.2020.103691. Epub 2020 Feb 14.
254.	Investigation of functional IL-10 gene polymorphism and IL-10 levels in acute graft-versus-host disease.	Resende RG, etal., J Clin Immunol. 2010 May;30(3):465-73. doi: 10.1007/s10875-010-9377-6. Epub 2010 Mar 2.
255.	Characterization of the immunological features of tuberculous pericardial effusions in HIV positive and HIV negative patients in contrast with non-tuberculous effusions.	Reuter H, etal., Tuberculosis (Edinb). 2006 Mar;86(2):125-33. Epub 2005 Dec 19.
256.	Tyrosine phosphorylation of vitreous inflammatory and angiogenic peptides and proteins in diabetic retinopathy.	Reverter JL, etal., Invest Ophthalmol Vis Sci. 2009 Mar;50(3):1378-82. Epub 2008 Oct 31.
257.	GOA pipeline	RGD automated data pipeline
258.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
259.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
260.	Exhaustive exercise causes an anti-inflammatory effect in skeletal muscle and a pro-inflammatory effect in adipose tissue in rats.	Rosa Neto JC, etal., Eur J Appl Physiol. 2009 May 8.
261.	An IL-10 dominant polarization of monocytes is a feature of Indian Visceral Leishmaniasis.	Roy S, etal., Parasite Immunol. 2018 Jul;40(7):e12535. doi: 10.1111/pim.12535. Epub 2018 May 30.
262.	Biology of interleukin-10.	Sabat R, etal., Cytokine Growth Factor Rev. 2010 Oct;21(5):331-44. doi: 10.1016/j.cytogfr.2010.09.002. Epub 2010 Nov 5.
263.	Single-nucleotide polymorphism of Toll-like receptor 4 and interleukin-10 in response to interferon-based therapy in Egyptian chronic hepatitis C patients.	Sadik NA, etal., Arch Virol. 2015 Sep;160(9):2181-95. doi: 10.1007/s00705-015-2493-0. Epub 2015 Jun 23.
264.	Cytokine profiles in acute myeloid leukemia patients at diagnosis: survival is inversely correlated with IL-6 and directly correlated with IL-10 levels.	Sanchez-Correa B, etal., Cytokine. 2013 Mar;61(3):885-91. doi: 10.1016/j.cyto.2012.12.023. Epub 2013 Jan 26.
265.	Plasma levels of soluble interleukin 2 receptor, soluble CD30, interleukin 10 and B cell activator of the tumour necrosis factor family during follow-up in vasculitis associated with proteinase 3-antineutrophil cytoplasmic antibodies: associations with disease activity and relapse.	Sanders JS, etal., Ann Rheum Dis. 2006 Nov;65(11):1484-9. Epub 2006 Feb 27.
266.	Naturally-occurring regulatory T cells are increased in inflamed portal tracts with cholangiopathy in primary biliary cirrhosis.	Sasaki M, etal., J Clin Pathol. 2007 Oct;60(10):1102-7. doi: 10.1136/jcp.2006.044776. Epub 2006 Dec 8.
267.	Protective effect of Lactobacillus plantarum 21, a probiotic on trinitrobenzenesulfonic acid-induced ulcerative colitis in rats.	Satish Kumar CS, etal., Int Immunopharmacol. 2015 Apr;25(2):504-10. doi: 10.1016/j.intimp.2015.02.026. Epub 2015 Feb 27.
268.	Simultaneous analyses of vitreous levels of 27 cytokines in eyes with retinopathy of prematurity.	Sato T, etal., Ophthalmology. 2009 Nov;116(11):2165-9. doi: 10.1016/j.ophtha.2009.04.026. Epub 2009 Aug 22.
269.	Promoter haplotypes of interleukin-10 gene and sporadic Alzheimer's disease.	Scassellati C, etal., Neurosci Lett 2004 Feb 12;356(2):119-22.
270.	Reduced airway inflammation in CD26/DPP4-deficient F344 rats is associated with altered recruitment patterns of regulatory T cells and expression of pulmonary surfactant proteins.	Schmiedl A, etal., Clin Exp Allergy. 2010 Dec;40(12):1794-808. doi: 10.1111/j.1365-2222.2010.03547.x.
271.	Interleukin-10 is an independent biomarker of severe traumatic brain injury prognosis.	Schneider Soares FM, etal., Neuroimmunomodulation. 2012;19(6):377-85. doi: 10.1159/000342141. Epub 2012 Oct 12.
272.	Genetic determined downregulation of both type 1 and type 2 cytokine pathways might be protective against pancreatic cancer.	Scola L, etal., Ann N Y Acad Sci. 2009 Feb;1155:284-8.
273.	Correlation of measurable serum markers of inflammation with lung levels following bilateral femur fracture in a rat model.	Sears BW, etal., J Inflamm Res. 2010 Aug 1;2010(3):105-114.
274.	Association of interferon-gamma, interleukin-10, and tumor necrosis factor-alpha gene polymorphisms with occurrence and severity of Eales' disease.	Sen A, etal., Invest Ophthalmol Vis Sci. 2011 Jan 5;52(1):171-8. doi: 10.1167/iovs.10-5885.
275.	Genetic variants in IL-6 and IL-10 genes and susceptibility to hepatocellular carcinoma in HCV infected patients.	Sghaier I, etal., Cytokine. 2017 Jan;89:62-67. doi: 10.1016/j.cyto.2016.10.004. Epub 2016 Oct 27.
276.	AAV2-mediated subretinal gene transfer of mIL-27p28 attenuates experimental autoimmune uveoretinitis in mice.	Shao J, etal., PLoS One. 2012;7(5):e37773. doi: 10.1371/journal.pone.0037773. Epub 2012 May 22.
277.	Peripheral blood and tissue T regulatory cells in chronic rhinosinusitis.	Sharma S, etal., Am J Rhinol Allergy. 2012 Sep-Oct;26(5):371-9. doi: 10.2500/ajra.2012.26.3800.
278.	Mechanistic investigation of immunosuppression in patients with condyloma acuminata.	Shi YJ, etal., Mol Med Rep. 2013 Aug;8(2):480-6. doi: 10.3892/mmr.2013.1511. Epub 2013 Jun 6.
279.	CD4(+) CD25(+) regulatory T cells ameliorate Behcet's disease-like symptoms in a mouse model.	Shim J, etal., Cytotherapy. 2011 Aug;13(7):835-47. doi: 10.3109/14653249.2011.571245. Epub 2011 Apr 21.
280.	Maternal thyroid dysfunction affects placental profile of inflammatory mediators and the intrauterine trophoblast migration kinetics.	Silva JF, etal., Reproduction. 2014 Jun;147(6):803-16. doi: 10.1530/REP-13-0374. Epub 2014 Feb 17.
281.	Genetic polymorphism of interleukin-10 (-A592C) among oral cancer with squamous cell carcinoma.	Singh PK, etal., Arch Oral Biol. 2017 May;77:18-22. doi: 10.1016/j.archoralbio.2016.12.011. Epub 2017 Jan 7.
282.	Genetic variants of immune-related genes IL17F and IL10 are associated with functional dyspepsia: A case-control study.	Singh R, etal., Indian J Gastroenterol. 2017 Sep;36(5):343-352. doi: 10.1007/s12664-017-0788-7. Epub 2017 Sep 30.
283.	Association of IL-10 and IL-10Rbeta gene polymorphisms with graft-versus-host disease after haematopoietic stem cell transplantation from an HLA-identical sibling donor.	Sivula J, etal., BMC Immunol. 2009 May 4;10:24. doi: 10.1186/1471-2172-10-24.
284.	Role of secreted conjunctival mucosal cytokine and chemokine proteins in different stages of trachomatous disease.	Skwor TA, etal., PLoS Negl Trop Dis. 2008 Jul 16;2(7):e264. doi: 10.1371/journal.pntd.0000264.
285.	Production of interleukin-10 by human bronchogenic carcinoma.	Smith DR, etal., Am J Pathol. 1994 Jul;145(1):18-25.
286.	Elevated levels of inflammatory cytokines predict survival in idiopathic and familial pulmonary arterial hypertension.	Soon E, etal., Circulation. 2010 Aug 31;122(9):920-7. Epub 2010 Aug 16.
287.	Interleukin 10-induced thrombocytopenia in normal healthy adult volunteers: evidence for decreased platelet production.	Sosman JA, etal., Br J Haematol. 2000 Oct;111(1):104-11.
288.	Aging affects AO rat splenic conventional dendritic cell subset composition, cytokine synthesis and T-helper polarizing capacity.	Stojic-Vukanic Z, etal., Biogerontology. 2013 Aug;14(4):443-59. doi: 10.1007/s10522-013-9444-5. Epub 2013 Jul 20.
289.	Inflammation in the middle ear of children with recurrent or chronic otitis media is associated with bacterial load.	Stol K, etal., Pediatr Infect Dis J. 2012 Nov;31(11):1128-34. doi: 10.1097/INF.0b013e3182611d6b.
290.	The role of IL-5, IL-6 and IL-10 in primary and vaccine-primed immune responses to infection with Friend retrovirus (Murine leukaemia virus).	Strestik BD, etal., J Gen Virol. 2001 Jun;82(Pt 6):1349-54.
291.	Interleukin-10 expression is positively correlated with oxidized LDL deposition and inversely with T-lymphocyte infiltration in atherosclerotic intimas of human coronary arteries.	Sumiyoshi S, etal., Pathol Res Pract. 2006;202(3):141-50. Epub 2006 Feb 7.
292.	Bone marrow-derived mononuclear cell therapy alleviates left ventricular remodeling and improves heart function in rat-dilated cardiomyopathy.	Sun CK, etal., Crit Care Med. 2009 Apr;37(4):1197-205.
293.	A detrimental effect of interleukin-10 on protective pulmonary humoral immunity during primary influenza A virus infection.	Sun K, etal., J Virol. 2010 May;84(10):5007-14. Epub 2010 Mar 3.
294.	Effect of atorvastatin on expression of IL-10 and TNF-alpha mRNA in myocardial ischemia-reperfusion injury in rats.	Sun YM, etal., Biochem Biophys Res Commun. 2009 May 1;382(2):336-40. Epub 2009 Mar 9.
295.	Bupi Hewei decoction ameliorates 5-fluorouracil-induced intestinal dysbiosis in rats through T helper 17/T regulatory cell signaling pathway.	Sun Z, etal., J Tradit Chin Med. 2020 Feb;40(1):38-48.
296.	Therapeutic effects of human mesenchymal stem cells in Wistar-Kyoto rats with anti-glomerular basement membrane glomerulonephritis.	Suzuki T, etal., PLoS One. 2013 Jun 24;8(6):e67475. doi: 10.1371/journal.pone.0067475. Print 2013.
297.	Bilateral vagotomy attenuates the severity of secretagogue-induced acute pancreatitis in the rat.	Szklarczyk J, etal., Adv Med Sci. 2014 Sep;59(2):172-7. doi: 10.1016/j.advms.2014.02.003. Epub 2014 Jun 9.
298.	Polymorphisms of interleukin 4 receptor gene and interleukin 10 gene are not associated with Graves' disease in the UK.	Tait KF, etal., Autoimmunity. 2004 May;37(3):189-94.
299.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
300.	Association of interleukin-(IL)10 haplotypes and serum IL-10 levels in the progression of childhood immune thrombocytopenic purpura.	Tesse R, etal., Gene. 2012 Aug 15;505(1):53-6. doi: 10.1016/j.gene.2012.05.050. Epub 2012 Jun 4.
301.	Analysis of IL-6, IL-10 and NF-κB Gene Polymorphisms in Aggressive and Chronic Periodontitis.	Toker H, etal., Cent Eur J Public Health. 2017 Jun;25(2):157-162. doi: 10.21101/cejph.a4656.
302.	Peripheral inflammatory activation after hippocampus irradiation in the rat.	Tokes T, etal., Int J Radiat Biol. 2014 Jan;90(1):1-6. doi: 10.3109/09553002.2013.836617. Epub 2013 Sep 13.
303.	Differential expression of cytokine genes and iNOS induced by nonviable nontypeable Haemophilus influenzae or its LOS mutants during acute otitis media in the rat.	Tong HH, etal., Int J Pediatr Otorhinolaryngol. 2008 Aug;72(8):1183-91. Epub 2008 Jun 3.
304.	Interleukin-10 is an essential modulator of mucoid metaplasia in a mouse otitis media model.	Tsuchiya K, etal., Ann Otol Rhinol Laryngol. 2008 Aug;117(8):630-6.
305.	Music exposure induced prolongation of cardiac allograft survival and generated regulatory CD4(+) cells in mice.	Uchiyama M, etal., Transplant Proc. 2012 May;44(4):1076-9. doi: 10.1016/j.transproceed.2012.02.008.
306.	Interleukin-10 induction after combined resection of liver and pancreas.	Uchiyama T, etal., Hepatogastroenterology. 2001 Nov-Dec;48(42):1705-10.
307.	Interleukin 10 deficiency attenuates induction of anti-TSH receptor antibodies and hyperthyroidism in a mouse Graves' model.	Ueki I, etal., J Endocrinol. 2011 Jun;209(3):353-7. doi: 10.1530/JOE-11-0129. Epub 2011 Apr 7.
308.	Osteopontin levels are elevated in patients with eosinophilic pneumonia.	Ueno T, etal., Respirology. 2010 Aug 26.
309.	Clarithromycin and telithromycin increases interleukin-10 expression in the rat endometriosis model.	Umezawa M, etal., Cytokine. 2011 Sep;55(3):339-42. doi: 10.1016/j.cyto.2011.05.014. Epub 2011 Jun 12.
310.	Dominance of high-producing interleukin 6 and low-producing interleukin 10 and interferon gamma alleles in glucose-6-phosphate dehydrogenase-deficient trauma patients.	Upperman JS, etal., Shock. 2005 Mar;23(3):197-201.
311.	Relationship between circulating interleukin-10 (IL-10) with interleukin-6 (IL-6) type cytokines (IL-6, interleukin-11 (IL-11), oncostatin M (OSM)) and soluble interleukin-6 (IL-6) receptor (sIL-6R) in patients with multiple myeloma.	Urbanska-Rys H, etal., Eur Cytokine Netw. 2000 Sep;11(3):443-51.
312.	Intraocular and serum cytokine profiles in patients with intermediate uveitis.	Valentincic NV, etal., Mol Vis. 2011;17:2003-10. Epub 2011 Jul 20.
313.	The combined polymorphisms of interleukin-6-174GG genotype and interleukin-10 ATA haplotype are associated with a poor quality of life in patients with chronic hepatitis C.	Vieira DA, etal., Qual Life Res. 2019 Jun;28(6):1531-1542. doi: 10.1007/s11136-019-02129-5. Epub 2019 Feb 7.
314.	Correlation between inflammatory mediators in the nasopharyngeal secretion and in the serum of children with lower respiratory tract infection caused by respiratory syncytial virus and disease severity.	Vieira RA, etal., J Bras Pneumol. 2010 Feb;36(1):59-66.
315.	Is IL-10-819C/T gene polymorphism modulating the risk of gallbladder disease in north Indian population?	Vishnoi M, etal., J Gastrointest Cancer. 2007;38(1):46-51.
316.	PACAP Attenuates NMDA-Induced Retinal Damage in Association with Modulation of the Microglia/Macrophage Status into an Acquired Deactivation Subtype.	Wada Y, etal., J Mol Neurosci. 2013 Oct;51(2):493-502. doi: 10.1007/s12031-013-0017-5. Epub 2013 May 30.
317.	Low-dose splenic radiation inhibits liver tumor development of rats through functional changes in CD4+CD25+Treg cells.	Wang B, etal., Int J Biochem Cell Biol. 2014 Oct;55:98-108. doi: 10.1016/j.biocel.2014.08.014. Epub 2014 Aug 25.
318.	The Inflammation Induced by Lipopolysaccharide can be Mitigated by Short-chain Fatty Acid, Butyrate, through Upregulation of IL-10 in Septic Shock.	Wang F, etal., Scand J Immunol. 2017 Apr;85(4):258-263. doi: 10.1111/sji.12515.
319.	YB-1 orchestrates onset and resolution of renal inflammation via IL10 gene regulation.	Wang J, etal., J Cell Mol Med. 2017 Dec;21(12):3494-3505. doi: 10.1111/jcmm.13260. Epub 2017 Jun 30.
320.	Long Noncoding RNA H19 Promotes Neuroinflammation in Ischemic Stroke by Driving Histone Deacetylase 1-Dependent M1 Microglial Polarization.	Wang J, etal., Stroke. 2017 Aug;48(8):2211-2221. doi: 10.1161/STROKEAHA.117.017387. Epub 2017 Jun 19.
321.	IL-10 enhances CTL-mediated tumor rejection by inhibiting highly suppressive CD4 T cells and promoting CTL persistence in a murine model of plasmacytoma.	Wang L, etal., Oncoimmunology. 2015 May 13;4(7):e1014232. eCollection 2015 Jul.
322.	Intraperitoneal injection (IP), Intravenous injection (IV) or anal injection (AI)? Best way for mesenchymal stem cells transplantation for colitis.	Wang M, etal., Sci Rep. 2016 Aug 4;6:30696. doi: 10.1038/srep30696.
323.	Influences of intestinal ligation on bacterial translocation and inflammatory response in rats with hemorrhagic shock: implications for damage control surgery.	Wang P, etal., J Invest Surg. 2008 Sep-Oct;21(5):244-54.
324.	Treatment and prevention of experimental autoimmune myocarditis with CD28 superagonists.	Wang S, etal., Cardiology. 2010;115(2):107-13. doi: 10.1159/000256660. Epub 2009 Nov 10.
325.	[Changes of IL-2, IL-8, IL-10 and TNF-alpha levels in sera of patients with acute graft-versus-host disease].	Wang SH, etal., Zhongguo Shi Yan Xue Ye Xue Za Zhi. 2006 Aug;14(4):755-8.
326.	(-)-Epigallocatechin-3-Gallate Ameliorates Atherosclerosis and Modulates Hepatic Lipid Metabolic Gene Expression in Apolipoprotein E Knockout Mice: Involvement of TTC39B.	Wang W, etal., Front Pharmacol. 2018 Mar 9;9:195. doi: 10.3389/fphar.2018.00195. eCollection 2018.
327.	[The association between single-nucleotide polymorphisms in IL6, IL10 genes and the susceptibility to primary hepatic carcinoma in Shunde District of Foshan City].	Wang XL, etal., Zhonghua Yu Fang Yi Xue Za Zhi. 2017 Aug 6;51(8):698-702. doi: 10.3760/cma.j.issn.0253-9624.2017.08.008.
328.	Protective effect of glucose-insulin-potassium (GIK) on intestinal tissues after severe burn in experimental rats.	Wang Z, etal., Burns. 2012 Sep;38(6):846-54. doi: 10.1016/j.burns.2011.12.015. Epub 2012 Feb 15.
329.	Endogenous regulation of the acute inflammatory response.	Ward PA and Lentsch AB, Mol Cell Biochem 2002 May-Jun;234-235(1-2):225-8.
330.	Dynamic changes in clinical features and cytokine/chemokine responses in SARS patients treated with interferon alfacon-1 plus corticosteroids.	Ward SE, etal., Antivir Ther. 2005;10(2):263-75.
331.	Activation and differentiation of autoreactive B-1 cells by interleukin 10 induce autoimmune hemolytic anemia in Fas-deficient antierythrocyte immunoglobulin transgenic mice.	Watanabe N, etal., J Exp Med. 2002 Jul 1;196(1):141-6.
332.	Galantamine anti-colitic effect: Role of alpha-7 nicotinic acetylcholine receptor in modulating Jak/STAT3, NF-κB/HMGB1/RAGE and p-AKT/Bcl-2 pathways.	Wazea SA, etal., Sci Rep. 2018 Mar 23;8(1):5110. doi: 10.1038/s41598-018-23359-6.
333.	Haplotype-tagging interleukin-10 promoter polymorphism is associated with reduced risk of retinal artery occlusion.	Weger M, etal., Mol Vis. 2007 Apr 4;13:549-52.
334.	The antinociceptive efficacy of HWTX-I epidurally administered in rheumatoid arthritis rats.	Wen Tao Z, etal., Int J Sports Med. 2011 Nov;32(11):869-74. doi: 10.1055/s-0031-1280775. Epub 2011 Nov 3.
335.	Rapid onset of ulcerative typhlocolitis in B6.129P2-IL10tm1Cgn (IL-10-/-) mice infected with Helicobacter trogontum is associated with decreased colonization by altered Schaedler's flora.	Whary MT, etal., Infect Immun. 2006 Dec;74(12):6615-23. Epub 2006 Sep 18.
336.	Attenuation of lipopolysaccharide-induced acute lung injury by treatment with IL-10.	Wu CL, etal., Respirology. 2009 Apr 5.
337.	Expression of interleukin-10 splicing variants is a positive prognostic feature in relapsed childhood acute lymphoblastic leukemia.	Wu S, etal., J Clin Oncol. 2005 May 1;23(13):3038-42.
338.	IL-10 promotes malignant pleural effusion in mice by regulating TH 1- and TH 17-cell differentiation and migration.	Wu XZ, etal., Eur J Immunol. 2019 Apr;49(4):653-665. doi: 10.1002/eji.201847685. Epub 2019 Feb 12.
339.	Dietary GD3 Ganglioside Reduces the Incidence and Severity of Necrotizing Enterocolitis (NEC) by Sustaining Regulatory Immune Responses.	Xu J, etal., J Pediatr Gastroenterol Nutr. 2013 Jun 18.
340.	Role of KCa3.1 Channels in Macrophage Polarization and Its Relevance in Atherosclerotic Plaque Instability.	Xu R, etal., Arterioscler Thromb Vasc Biol. 2017 Feb;37(2):226-236. doi: 10.1161/ATVBAHA.116.308461. Epub 2016 Dec 29.
341.	Combined treatment with bone marrow mesenchymal stem cells and methylprednisolone in paraquat-induced acute lung injury.	Yang H, etal., BMC Emerg Med. 2013;13 Suppl 1:S5. doi: 10.1186/1471-227X-13-S1-S5. Epub 2013 Jul 4.
342.	Therapeutic effect of Ginkgo biloba polysaccharide in rats with focal cerebral ischemia/reperfusion (I/R) injury.	Yang Y, etal., Carbohydr Polym. 2013 Nov 6;98(2):1383-8. doi: 10.1016/j.carbpol.2013.07.045. Epub 2013 Jul 29.
343.	Activation of the Notch signaling pathway disturbs the CD4+/CD8+, Th17/Treg balance in rats with experimental autoimmune uveitis.	Yin X, etal., Inflamm Res. 2019 Sep;68(9):761-774. doi: 10.1007/s00011-019-01260-w. Epub 2019 Jun 17.
344.	Role of IL-10 in regulating proinflammatory cytokine release by Kupffer cells following trauma-hemorrhage.	Yokoyama Y, etal., Am J Physiol Gastrointest Liver Physiol. 2004 Jun;286(6):G942-6. Epub 2004 Jan 8.
345.	Local Induction of B Cell Interleukin-10 Competency Alleviates Inflammation and Bone Loss in Ligature-Induced Experimental Periodontitis in Mice.	Yu P, etal., Infect Immun. 2016 Dec 29;85(1). pii: IAI.00645-16. doi: 10.1128/IAI.00645-16. Print 2017 Jan.
346.	Marrow mesenchymal stem cells reduce methicillin-resistant Staphylococcus aureus infection in rat models.	Yuan Y, etal., Cytotherapy. 2013 Aug 30. pii: S1465-3249(13)00583-5. doi: 10.1016/j.jcyt.2013.06.002.
347.	Influence of single nucleotide polymorphisms of cytokine genes on anti-HBs antibody production after hepatitis B vaccination in a Japanese young adult population.	Yukimasa N, etal., J Med Invest. 2016;63(3-4):256-61. doi: 10.2152/jmi.63.256.
348.	Cytokine profile in gingival crevicular fluid and plasma of patients with aggressive periodontitis.	Zein Elabdeen HR, etal., Acta Odontol Scand. 2017 Nov;75(8):616-622. doi: 10.1080/00016357.2017.1372623. Epub 2017 Sep 3.
349.	Splenectomy protects experimental rats from cerebral damage after stroke due to anti-inflammatory effects.	Zhang BJ, etal., Chin Med J (Engl). 2013 Jun;126(12):2354-60.
350.	Exosome-mediated targeted delivery of miR-210 for angiogenic therapy after cerebral ischemia in mice.	Zhang H, etal., J Nanobiotechnology. 2019 Feb 19;17(1):29. doi: 10.1186/s12951-019-0461-7.
351.	Study on the T-helper cell 1/2 cytokine profile in blister fluid of patients with herpes zoster and its clinical significance.	Zhang M, etal., J Dermatol. 2011 Dec;38(12):1158-62. doi: 10.1111/j.1346-8138.2011.01289.x. Epub 2011 Sep 29.
352.	Anti-inflammatory and immunomodulatory mechanisms of mesenchymal stem cell transplantation in experimental traumatic brain injury.	Zhang R, etal., J Neuroinflammation. 2013 Aug 23;10(1):106. doi: 10.1186/1742-2094-10-106.
353.	Mesenchymal stem cells ameliorate experimental autoimmune uveoretinitis by comprehensive modulation of systemic autoimmunity.	Zhang X, etal., Invest Ophthalmol Vis Sci. 2011 May 16;52(6):3143-52. doi: 10.1167/iovs.10-6334.
354.	Total Glucosides of Peony Attenuates 2,4,6-Trinitrobenzene Sulfonic Acid/Ethanol-Induced Colitis in Rats Through Adjustment of Th1/Th2 Cytokines Polarization.	Zhang Y, etal., Cell Biochem Biophys. 2013 Jun 15.
355.	IL-10-592 polymorphism is associated with IL-10 expression and severity of enterovirus 71 infection in chinese children.	Zhao N, etal., J Clin Virol. 2017 Oct;95:42-46. doi: 10.1016/j.jcv.2017.08.005. Epub 2017 Aug 19.
356.	[A study of the role of heme oxygenase-1 expression in ventilator induced lung injury and its mechanism in rats.]	Zhao WJ and Hu WW, Zhongguo Wei Zhong Bing Ji Jiu Yi Xue. 2010 Jul;22(7):410-3.
357.	Genetic variations in inflammation-related genes and their influence on the susceptibility of pediatric acute lung injury in a Chinese population.	Zhao X, etal., Gene. 2019 Mar 1;687:16-22. doi: 10.1016/j.gene.2018.11.009. Epub 2018 Nov 6.
358.	[The comparison of CD4(+) CD25(+) Treg, IL-10 and TGF-beta from lymph and blood in bronchial asthmatic rat and the effect of dexamethasone on it]	Zhao ZX, etal., Xi Bao Yu Fen Zi Mian Yi Xue Za Zhi. 2010 Mar;26(3):238-41.
359.	Interleukin-10 gene promoter polymorphisms in multiple myeloma.	Zheng C, etal., Int J Cancer. 2001 May 20;95(3):184-8.
360.	IL-10 mediated by herpes simplex virus vector reduces neuropathic pain induced by HIV gp120 combined with ddC in rats.	Zheng W, etal., Mol Pain. 2014 Jul 30;10:49. doi: 10.1186/1744-8069-10-49.
361.	Experimental autoimmune hearing loss is exacerbated in IL-10-deficient mice and reversed by IL-10 gene transfer.	Zhou B, etal., Gene Ther. 2012 Feb;19(2):228-35. doi: 10.1038/gt.2011.88. Epub 2011 Jun 23.
362.	Novel genetic association of Wegener's granulomatosis with the interleukin 10 gene.	Zhou Y, etal., J Rheumatol. 2002 Feb;29(2):317-20.
363.	Effects of Pseudomonas aeruginosa mannose-sensitive hemagglutinin (PA-MSHA) pretreatment on septic rats.	Zhu H, etal., Int Immunopharmacol. 2013 Sep 18. pii: S1567-5769(13)00351-2. doi: 10.1016/j.intimp.2013.09.006.
364.	Interleukin-10 inhibits neuroinflammation-mediated apoptosis of ventral mesencephalic neurons via JAK-STAT3 pathway.	Zhu Y, etal., Int Immunopharmacol. 2017 Sep;50:353-360. doi: 10.1016/j.intimp.2017.07.017. Epub 2017 Jul 25.

Additional References at PubMed

PMID:1280414	PMID:1847510	PMID:1940799	PMID:7749983	PMID:8228801	PMID:8312229	PMID:8499633	PMID:9184696	PMID:9463379	PMID:9847016	PMID:10443688	PMID:10545106
PMID:10899905	PMID:10940872	PMID:10975994	PMID:11027433	PMID:11244051	PMID:11777537	PMID:11900340	PMID:11943322	PMID:12020953	PMID:12452830	PMID:12547408	PMID:12692173
PMID:12707357	PMID:12842419	PMID:15086467	PMID:15147725	PMID:15187136	PMID:15220916	PMID:15240714	PMID:15251379	PMID:15309723	PMID:15385469	PMID:15793858	PMID:16002150
PMID:16034134	PMID:16086233	PMID:16275384	PMID:16460340	PMID:16522370	PMID:16606666	PMID:16670641	PMID:16949315	PMID:16982608	PMID:17105443	PMID:17137799	PMID:17174526
PMID:17278885	PMID:17336456	PMID:17449476	PMID:17505796	PMID:17517520	PMID:17679732	PMID:17875732	PMID:18223607	PMID:18270204	PMID:18305394	PMID:18323732	PMID:18383040
PMID:18403456	PMID:18407603	PMID:18471351	PMID:18533891	PMID:18665051	PMID:18841529	PMID:19047410	PMID:19097804	PMID:19139201	PMID:19567204	PMID:19575707	PMID:19716366
PMID:19901158	PMID:19948415	PMID:20045008	PMID:20193756	PMID:20420568	PMID:20625799	PMID:21072211	PMID:21081156	PMID:21129280	PMID:21323571	PMID:21498587	PMID:21564091
PMID:21609717	PMID:21763399	PMID:21857966	PMID:21887889	PMID:22152812	PMID:22326966	PMID:22593113	PMID:22796213	PMID:23071313	PMID:23111552	PMID:23141143	PMID:23143062
PMID:23178472	PMID:23185784	PMID:23388469	PMID:23426971	PMID:23765634	PMID:23892723	PMID:24114903	PMID:24463741	PMID:24527865	PMID:24656930	PMID:24706318	PMID:24865534
PMID:25009084	PMID:25066760	PMID:25081109	PMID:25096025	PMID:25182413	PMID:25329858	PMID:25471580	PMID:25504316	PMID:25598450	PMID:25617163	PMID:25702530	PMID:25780042
PMID:26059905	PMID:26235810	PMID:26475712	PMID:26492380	PMID:26591203	PMID:26808574	PMID:26849241	PMID:26866372	PMID:26962683	PMID:27016017	PMID:27317647	PMID:27363620
PMID:27456198	PMID:27567557	PMID:27703278	PMID:28063948	PMID:28092075	PMID:28132924	PMID:28135825	PMID:28258441	PMID:28319508	PMID:28322445	PMID:28368329	PMID:28387444
PMID:28686630	PMID:28925732	PMID:29197741	PMID:29568872	PMID:29924982	PMID:30227622	PMID:30229836	PMID:30243650	PMID:30316971	PMID:30511618	PMID:30539780	PMID:30541949
PMID:31067702	PMID:31162801	PMID:31415765	PMID:31434608	PMID:31915015	PMID:32004977	PMID:32303238	PMID:33028080	PMID:33540122	PMID:33902989	PMID:34343596	PMID:35196893
PMID:36555251	PMID:36737628	PMID:37062956	PMID:38048666	PMID:38169599	PMID:38194074

Genomics

Comparative Map Data

Il10
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	45,024,921 - 45,029,586 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	13	45,025,087 - 45,029,580 (+)	Ensembl				GRCr8
mRatBN7.2	13	42,472,625 - 42,477,308 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	42,472,839 - 42,477,313 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	13	45,079,495 - 45,083,368 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	46,367,625 - 46,371,502 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	43,631,889 - 43,635,783 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	47,738,933 - 47,743,392 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	47,739,526 - 47,743,392 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	13	52,824,594 - 52,828,560 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	13	43,953,900 - 43,957,766 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	13	42,821,569 - 42,825,416 (+)	NCBI		Celera
RGSC_v3.1	13	43,967,906 - 43,972,374 (+)	NCBI
Cytogenetic Map	13	q13	NCBI

IL10
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	206,767,602 - 206,772,494 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	206,767,602 - 206,774,541 (-)	Ensembl			hg38	GRCh38
GRCh37	1	206,940,947 - 206,945,839 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	205,007,571 - 205,012,462 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	1	203,329,342 - 203,334,234	NCBI
Celera	1	180,192,396 - 180,197,294 (-)	NCBI		Celera
Cytogenetic Map	1	q32.1	NCBI
HuRef	1	177,639,274 - 177,644,165 (-)	NCBI		HuRef
CHM1_1	1	208,213,574 - 208,218,465 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	206,031,803 - 206,036,695 (-)	NCBI		T2T-CHM13v2.0

Il10
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	130,947,459 - 130,952,707 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	130,947,582 - 130,952,711 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	1	131,019,845 - 131,024,970 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	131,019,845 - 131,024,974 (+)	Ensembl			mm10	GRCm38
MGSCv37	1	132,916,422 - 132,921,547 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	1	132,847,393 - 132,852,516 (+)	NCBI		MGSCv36	mm8
Celera	1	133,642,456 - 133,647,581 (+)	NCBI		Celera
Cytogenetic Map	1	E4	NCBI
cM Map	1	56.89	NCBI

Il10
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955406	42,307,664 - 42,312,779 (-)	Ensembl
ChiLan1.0	NW_004955406	42,307,789 - 42,312,255 (-)	NCBI	ChiLan1.0	ChiLan1.0

IL10
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	42,602,021 - 42,609,622 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	42,567,540 - 42,575,040 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	182,369,234 - 182,374,207 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	186,648,289 - 186,653,155 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	186,648,289 - 186,653,371 (-)	Ensembl			panPan2	panpan1.1

IL10
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	7	5,933,285 - 5,937,057 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	7	5,933,285 - 5,937,057 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	7	5,497,391 - 5,501,163 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	7	5,622,589 - 5,626,365 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	7	5,622,079 - 5,626,428 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	7	5,557,139 - 5,560,910 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	7	5,658,009 - 5,661,775 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	7	5,697,728 - 5,701,500 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Il10
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	68,594,566 - 68,598,867 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936557	5,834,874 - 5,838,502 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936557	5,834,874 - 5,838,502 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

IL10
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	9	67,400,728 - 67,405,378 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	9	67,400,727 - 67,405,941 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	9	73,757,707 - 73,762,925 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

IL10
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	25	22,590,389 - 22,595,877 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	25	22,590,962 - 22,594,836 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666055	23,288,754 - 23,293,715 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Il10
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624807	4,687,176 - 4,691,732 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624807	4,687,249 - 4,691,658 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Il10
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	10	4,795,370 - 4,799,859 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Il10
29 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	377
Count of miRNA genes:	195
Interacting mature miRNAs:	245
Transcripts:	ENSRNOT00000006246
Prediction methods:	Microtar, Miranda, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
10755495	Bp387	Blood pressure QTL 387	3.78		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	37216241	90057603	Rat
9589141	Insul28	Insulin level QTL 28	10.82	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	13	11866254	56866254	Rat
1354655	Bp241	Blood pressure QTL 241	3.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	38975045	103588154	Rat
70220	Bp55	Blood pressure QTL 55	5.75		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	13	39924693	84924693	Rat
61391	Bp5	Blood pressure QTL 5	5.6		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	13	24853925	69853925	Rat
4889861	Pur29	Proteinuria QTL 29	13.8	0.005	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	13	39968211	83286298	Rat
1300163	Cardf1	Cardiac cell morphology QTL 1	4.18		aorta morphology trait (VT:0000272)	artery lesion measurement (CMO:0000975)	13	12448421	47969993	Rat
2317040	Aia21	Adjuvant induced arthritis QTL 21	2.75		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	13	12384320	57384320	Rat
631645	Bp121	Blood pressure QTL 121	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	17468282	62468282	Rat
2317046	Aia8	Adjuvant induced arthritis QTL 8	3.9700000286102295		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	13	12384320	57384320	Rat
619615	Bp80	Blood pressure QTL 80		0.0354	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	7421791	87286911	Rat
2303032	Bp328	Blood pressure QTL 328			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	43736327	47969993	Rat
61339	Bp24	Blood pressure QTL 24		0.05	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	6002008	47359539	Rat
1331784	Bp222	Blood pressure QTL 222	2.944		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	24335432	55601132	Rat
61340	Bp25	Blood pressure QTL 25	4.2	0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	37087983	82087983	Rat
1581573	Uae36	Urinary albumin excretion QTL 36			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	13	6002008	88706694	Rat
1549897	Stresp12	Stress response QTL 12	3.35		stress-related behavior trait (VT:0010451)	number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960)	13	40983585	85983585	Rat
2302275	Gluco37	Glucose level QTL 37	3.8		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	13	12448421	48744906	Rat
7207885	Glom27	Glomerulus QTL 27	3.9		kidney glomerulus integrity trait (VT:0010546)	kidney crescentic glomeruli count to kidney normal glomeruli count ratio (CMO:0002139)	13	21120177	109350286	Rat
1558644	Cm45	Cardiac mass QTL 45	3.6	0.002	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	13	26244808	71244808	Rat
70181	BpQTLcluster11	Blood pressure QTL cluster 11	6.922		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	13	33794096	78794096	Rat
61349	Bp31	Blood pressure QTL 31	5.75		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	13	39924693	84924693	Rat
2303563	Bw89	Body weight QTL 89	6		body mass (VT:0001259)	body weight (CMO:0000012)	13	34834947	79834947	Rat
1354621	Rf47	Renal function QTL 47	3.7		kidney renin amount (VT:0010559)	kidney renin level (CMO:0002166)	13	11081740	103588154	Rat
2301962	Cm72	Cardiac mass QTL 72	4.12		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	13	33794096	60914504	Rat
1581554	Pur11	Proteinuria QTL 11			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	13	6002008	88706694	Rat
12879471	Bp398	Blood pressure QTL 398			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	3088755	48088755	Rat
12879477	Bp401	Blood pressure QTL 401			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	39814726	84814726	Rat
1331750	Bp220	Blood pressure QTL 220	2.98		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	13	39968211	84968211	Rat
6893338	Cm76	Cardiac mass QTL 76	0	0.99	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	13	26244808	71244808	Rat
11530006	Niddm72	Non-insulin dependent diabetes mellitus QTL 72		0.001	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	13	38286298	83286298	Rat
1354666	Bp244	Blood pressure QTL 244	4.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	1	103588154	Rat
9589164	Gluco66	Glucose level QTL 66	6.67	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	13	17711336	62711336	Rat
7411662	Foco29	Food consumption QTL 29	20.8	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	13	11866254	56866254	Rat

Markers in Region

Il10

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	13	42,472,894 - 42,474,370 (+)	MAPPER	mRatBN7.2
Rnor_6.0	13	47,739,541 - 47,741,015	NCBI	Rnor6.0
Rnor_5.0	13	52,824,709 - 52,826,183	UniSTS	Rnor5.0
Celera	13	42,821,584 - 42,823,038	UniSTS
Cytogenetic Map	13	q13	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	4	26	63	79	81	52	87	52	6	262	135	6	50	57	61	29	8	8

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_012854	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006249712	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008769426	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473958	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000013	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	L02926	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	LR761032	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X60675	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000006246 ⟹ ENSRNOP00000006246

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	13	45,025,087 - 45,029,580 (+)	Ensembl
mRatBN7.2 Ensembl	13	42,472,839 - 42,477,313 (+)	Ensembl
Rnor_6.0 Ensembl	13	47,739,526 - 47,743,392 (+)	Ensembl

RefSeq Acc Id:

NM_012854 ⟹ NP_036986

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	45,025,154 - 45,029,020 (+)	NCBI
mRatBN7.2	13	42,472,880 - 42,476,748 (+)	NCBI
Rnor_6.0	13	47,739,526 - 47,743,392 (+)	NCBI
Rnor_5.0	13	52,824,594 - 52,828,560 (+)	NCBI
RGSC_v3.4	13	43,953,900 - 43,957,766 (+)	RGD
Celera	13	42,821,569 - 42,825,416 (+)	RGD

Sequence:

show sequence

CATGCCTGGCTCAGCACTGCTATGTTGCCTGCTCTTACTGGCTGGAGTGAAGACCAGCAAAGGC
CATTCCATCCGGGGTGACAATAACTGCACCCACTTCCCAGTCAGCCAGACCCACATGCTCCGAG
AGCTGAGGGCTGCCTTCAGTCAAGTGAAGACTTTCTTTCAAAAGAAGGACCAGCTGGACAACAT
ACTGCTGACAGATTCCTTACTGCAGGACTTTAAGGGTTACTTGGGTTGCCAAGCCTTGTCAGAA
ATGATCAAGTTTTACCTGGTAGAAGTGATGCCCCAGGCAGAGAACCATGGCCCAGAAATCAAGG
AGCATTTGAATTCCCTGGGAGAGAAGCTGAAGACCCTCTGGATACAGCTGCGACGCTGTCATCG
ATTTCTCCCCTGTGAGAATAAAAGCAAGGCAGTGGAGCAGGTGAAGAATGATTTTAATAAGCTC
CAAGACAAAGGTGTCTACAAGGCCATGAATGAGTTTGACATCTTCATCAACTGCATAGAAGCCT
ACGTGACACTCAAAATGAAAAATTGAACCACCCGGCATCTACTGGACTGCAGGACATAAATAGA
GCTTCTAAATCTGATCCAGAGATCTTAGCTAACGGGAGCAACTCCTTGGAAAACCTCGTTTGTA
CCTCTCTCCAAAATATTTATTACCTCTGATACCTCAGTTCCC

hide sequence

RefSeq Acc Id:

XM_006249712 ⟹ XP_006249774

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	45,024,933 - 45,029,586 (+)	NCBI
mRatBN7.2	13	42,472,628 - 42,477,308 (+)	NCBI
Rnor_6.0	13	47,738,933 - 47,742,783 (+)	NCBI
Rnor_5.0	13	52,824,594 - 52,828,560 (+)	NCBI

Sequence:

show sequence

ACACACAATGGAAGAATCAAAGAGAGTGAGTTTTGAGGGTAATCAGCCCTCTCCTGTTTCCTTT
GGGTAACTGAGTGCTAAGGTGACCTCCTGGTCAGCAAGAAATAGCGGACATTCAACCCAGGTTG
AGTGGAGGAAATAATTATTTCTCAATCCTAATGTGCTCTGGAATAGCCCATTTATGCACGTCAT
TGTGACTTACGAGTGCGTGAATGGAACCCACAGTTGTAGATTCTCTGTACATAGAACAGCTGTC
TGCCTCAGGAAATACAACTTTTAGTATTGAGAAGCTAAAAAGAAAAAAAATTAAAAGAGAGATA
GCGCTTACTAAAAATAGCCGTAATGCAGAAGTTCATTCTTACCAGTTCTCTTGTGCTTACAATG
CAAAAAAAAGAAAAAAGAAAAAAAAATTAAGCTCAAAAAAGTGCATGGTCTAGAAGAGGGAGGA
GCCTTTGCCAGGAAGTTTGTAAATTGAGAGGCCCTGCTGCACCTTCGGTATAAAAGGGGGACAC
CGGGCAGGAGATCTACACATTAGGGACTTGCTCTTATACTACCATAGCCACAACGCAGCCTTGC
AGAAAACAGAGCTTCAGCATGCCTGGCTCAGCACTGCTATGTTGCCTGCTCTTACTGGCTGGAG
TGAAGACCAGCAAAGGCCATTCCATCCGGGGTGACAATAACTGCACCCACTTCCCAGTCAGCCA
GACCCACATGCTCCGAGAGCTGAGGGCTGCCTTCAGTCAAGTGAAGACTTTCTTTCAAAAGAAG
GACCAGCTGGACAACATACTGCTGACAGATTCCTTACTGCAGGACTTTAAGGGTTACTTGGGTT
GCCAAGCCTTGTCAGAAATGATCAAGTTTTACCTGGTAGAAGTGATGCCCCAGGCAGAGAACCA
TGGCCCAGAAATCAAGGAGCATTTGAATTCCCTGGGAGAGAAGCTGAAGACCCTCTGGATACAG
CTGCGACGCTGTCATCGATTTCTCCCCTGTGAGAATAAAAGCAAGGCAGTGGAGCAGGTGAAGA
ATGATTTTAATAAGGTAAGCCTGGGCCATGGCAAAGAGAACGCGTGGAACGTGACCTCCGTCCG
TCCACTCGCAAGGGCAGAAAGAGGGCCCGACCTATTCCGACCGAACCTGGAGTGTGGGAACCAG
CAAATGGTGTGACCTCCTCTGCCAGTTAGAAAGCCACCACCTCAGTCACATTTGTTTTCTGCAA
AGCGTCTCTGGCAGTTTCTAAATGACTGCTCCACTTTTGCAGGCTTTTGGCTTAGACTGACCAG
ACAGCCTATAAGCGCAGAGCGCTAGGTGCTGGGGAGAGCGCCGTAGGAAACAGAAAGTACAGAA
AGTACCTTGTTGGGAAACAGGCAGAACCCACAAGTACAGAAAGCAGACATGCATGAGTGCACGC
AGGTACATCTTGGGGCTCAGCCTGGATGCTCCTCGGAACCAGAAGGAGCAGGAAGCAGAATTCT
TAGGGGTCCCAGGGCACTCTCCACCTGGCAAACAAAATGAGGTTTCATACTTCCTTCTGCCTGT
GAACCTATTCAACCCTAGTTCCCAGAAGCCATGTGGCCCACATCTTCTTTGTGGGCTAGGCAGA
GCTCCAACATCAGTGGGCATGGATTCCATGACAGCAGGCCAGAGCAGCGGGGTGAAGACTGCCT
ACACACGCAAAACATTAAAAAAAAAATGTTTTT

hide sequence

RefSeq Acc Id:

XM_008769426 ⟹ XP_008767648

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	45,024,921 - 45,029,586 (+)	NCBI
mRatBN7.2	13	42,472,625 - 42,477,308 (+)	NCBI
Rnor_6.0	13	47,738,933 - 47,741,583 (+)	NCBI

Sequence:

show sequence

ACACACAATGGAAGAATCAAAGAGAGTGAGTTTTGAGGGTAATCAGCCCTCTCCTGTTTCCTTT
GGGTAACTGAGTGCTAAGGTGACCTCCTGGTCAGCAAGAAATAGCGGACATTCAACCCAGGTTG
AGTGGAGGAAATAATTATTTCTCAATCCTAATGTGCTCTGGAATAGCCCATTTATGCACGTCAT
TGTGACTTACGAGTGCGTGAATGGAACCCACAGTTGTAGATTCTCTGTACATAGAACAGCTGTC
TGCCTCAGGAAATACAACTTTTAGTATTGAGAAGCTAAAAAGAAAAAAAATTAAAAGAGAGATA
GCGCTTACTAAAAATAGCCGTAATGCAGAAGTTCATTCTTACCAGTTCTCTTGTGCTTACAATG
CAAAAAAAAGAAAAAAGAAAAAAAAATTAAGCTCAAAAAAGTGCATGGTCTAGAAGAGGGAGGA
GCCTTTGCCAGGAAGTTTGTAAATTGAGAGGCCCTGCTGCACCTTCGGTATAAAAGGGGGACAC
CGGGCAGGAGATCTACACATTAGGGACTTGCTCTTATACTACCATAGCCACAACGCAGCCTTGC
AGAAAACAGAGCTTCAGCATGCCTGGCTCAGCACTGCTATGTTGCCTGCTCTTACTGGCTGGAG
TGAAGACCAGCAAAGGCCATTCCATCCGGGGTGACAATAACTGCACCCACTTCCCAGTCAGCCA
GACCCACATGCTCCGAGAGCTGAGGGCTGCCTTCAGTCAAGTGAAGACTTTCTTTCAAAAGAAG
GACCAGCTGGACAACATACTGCTGACAGATTCCTTACTGCAGGACTTTAAGGGTTACTTGGGTT
GCCAAGCCTTGTCAGAAATGATCAAGTTTTACCTGGTAGAAGTGATGCCCCAGGCAGAGAACCA
TGGCCCAGAAATCAAGGAGCATTTGAATTCCCTGGGAGAGAAGCTGAAGACCCTCTGGATACAG
CTGCGACGCTGTGTGAGTAGCAGACCAGTTCTTTCCCCTGTAGCCACCCAACAAACACTGTCTC
CTACAATCCAGCCAGGCCATGCGCATCCAGACACACACAGACTAGACAGAGGACTAGGTAAATC
TAGAGGGACACCCGGAGTCAGATCTCTTGCTTGTCTGTCTCTGGGCGAGAGTGGGGGTGGCTTT
GAGGCGATCACACGTGAAGATTTGCGTATAGCCTTCCTGTTATTTGTGAGTCATTGTGGGTCAT
TAGCTACTCCCCTCTCTTCAAGGGAAGGCTAGGGCTTCAGTCATAGTTCCCTCGTGTTGGGGCT
GCCAGCCAAGGCTCCCCAAGCAGAGGAAAACATTGGTCTCTGTATCTCCTCTTTTGGAAAGCAA
AGTCAGTGCCACACACCTGGGCTGATAGAAATCTCCCCGGTATTTCAGAAGGGCCAGAAGACTA
CTGTCTCTAAGCCAGTATCTATGAATAGCATATCCAGGACATCTATGTCTCTGACTGAAGTGAT
TCCTTCGCTGCTGTTGTTTCTT

hide sequence

Protein Sequences


Protein RefSeqs	NP_036986	(Get FASTA)	NCBI Sequence Viewer
	XP_006249774	(Get FASTA)	NCBI Sequence Viewer
	XP_008767648	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA41425	(Get FASTA)	NCBI Sequence Viewer
	CAA43090	(Get FASTA)	NCBI Sequence Viewer
	CAB0000201	(Get FASTA)	NCBI Sequence Viewer
	EDM09836	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000006246
	ENSRNOP00000006246.2
GenBank Protein	P29456	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_036986 ⟸ NM_012854
- Peptide Label:	precursor
- UniProtKB:	Q63263 (UniProtKB/Swiss-Prot), P29456 (UniProtKB/Swiss-Prot), A0A7R8C3K4 (UniProtKB/TrEMBL)
- Sequence:	show sequence MPGSALLCCLLLLAGVKTSKGHSIRGDNNCTHFPVSQTHMLRELRAAFSQVKTFFQKKDQLDNI LLTDSLLQDFKGYLGCQALSEMIKFYLVEVMPQAENHGPEIKEHLNSLGEKLKTLWIQLRRCHR FLPCENKSKAVEQVKNDFNKLQDKGVYKAMNEFDIFINCIEAYVTLKMKN hide sequence

RefSeq Acc Id:	XP_006249774 ⟸ XM_006249712
- Peptide Label:	isoform X2
- Sequence:	show sequence MPGSALLCCLLLLAGVKTSKGHSIRGDNNCTHFPVSQTHMLRELRAAFSQVKTFFQKKDQLDNI LLTDSLLQDFKGYLGCQALSEMIKFYLVEVMPQAENHGPEIKEHLNSLGEKLKTLWIQLRRCHR FLPCENKSKAVEQVKNDFNKVSLGHGKENAWNVTSVRPLARAERGPDLFRPNLECGNQQMV hide sequence

RefSeq Acc Id:

XP_008767648 ⟸ XM_008769426

- Peptide Label:

isoform X1

- Sequence:

show sequence

MPGSALLCCLLLLAGVKTSKGHSIRGDNNCTHFPVSQTHMLRELRAAFSQVKTFFQKKDQLDNI
LLTDSLLQDFKGYLGCQALSEMIKFYLVEVMPQAENHGPEIKEHLNSLGEKLKTLWIQLRRCVS
SRPVLSPVATQQTLSPTIQPGHAHPDTHRLDRGLGKSRGTPGVRSLACLSLGESGGGFEAITRE
DLRIAFLLFVSHCGSLATPLSSREG

hide sequence

Ensembl Acc Id:

ENSRNOP00000006246 ⟸ ENSRNOT00000006246

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P29456-F1-model_v2	AlphaFold	P29456	1-178	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13698790

Promoter ID:

EPDNEW_R9315

Type:

single initiation site

Name:

Il10_1

Description:

interleukin 10

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	13	47,739,459 - 47,739,519	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:2886	AgrOrtholog
BioCyc Gene	G2FUF-18358	BioCyc
Ensembl Genes	ENSRNOG00000004647	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000006246	ENTREZGENE
	ENSRNOT00000006246.6	UniProtKB/Swiss-Prot
Gene3D-CATH	1.20.1250.10	UniProtKB/Swiss-Prot
InterPro	4_helix_cytokine-like_core	UniProtKB/Swiss-Prot
	IL-10	UniProtKB/Swiss-Prot
	IL-10/19/20/22/24/26_fam	UniProtKB/Swiss-Prot
	IL-10_CS	UniProtKB/Swiss-Prot
KEGG Report	rno:25325	UniProtKB/Swiss-Prot
NCBI Gene	25325	ENTREZGENE
PANTHER	INTERLEUKIN-10	UniProtKB/Swiss-Prot
	INTERLEUKIN-19-RELATED	UniProtKB/Swiss-Prot
Pfam	IL10	UniProtKB/Swiss-Prot
PharmGKB	IL10	RGD
PhenoGen	Il10	PhenoGen
PRINTS	INTRLEUKIN10	UniProtKB/Swiss-Prot
PROSITE	INTERLEUKIN_10	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000004647	RatGTEx
SMART	IL10	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF47266	UniProtKB/Swiss-Prot
TIGR	TC224831
UniProt	A0A7R8C3K4	ENTREZGENE, UniProtKB/TrEMBL
	IL10_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q63263	ENTREZGENE
UniProt Secondary	Q63263	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2002-06-10	Il10	Interleukin 10			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_expression	expressed in spleen and macrophages	729048
gene_process	may have a role in inflammation	729048

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)