Advanced Search (OLGA)

Gene: Tgfb1 (transforming growth factor, beta 1) Rattus norvegicus

Analyze

Symbol:

Tgfb1

Name:

transforming growth factor, beta 1

RGD ID:

69051

Description:

Enables identical protein binding activity. Involved in several processes, including cellular response to acetaldehyde; negative regulation of transport; and regulation of epithelial cell proliferation. Acts upstream of or within positive regulation of smooth muscle cell differentiation. Located in several cellular components, including cell surface; neuronal cell body; and secretory granule. Used to study chronic obstructive pulmonary disease; familial hyperlipidemia; hypertension; proteinuria; and pulmonary fibrosis. Biomarker of several diseases, including artery disease (multiple); cerebrovascular disease (multiple); gastrointestinal system cancer (multiple); liver disease (multiple); and lung disease (multiple). Human ortholog(s) of this gene implicated in several diseases, including Behcet's disease; aphthous stomatitis; artery disease (multiple); carcinoma (multiple); and lung disease (multiple). Orthologous to human TGFB1 (transforming growth factor beta 1); PARTICIPATES IN altered transforming growth factor-beta Smad dependent signaling pathway; colorectal cancer pathway; glypican signaling pathway; INTERACTS WITH (+)-schisandrin B; (+)-taxifolin; (+)-Tetrandrine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

TGF-beta-1; Tgfb; transforming growth factor beta-1; transforming growth factor beta-1 proprotein; transforming growth factor, beta-1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Allele / Splice:

Tgfb1^em3Mcwi ; Tgfb1^em1Mcwi

Genetic Models:

SS-Tgfb1^em3Mcwi ; SS-Tgfb1^em1Mcwi

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	90,324,312 - 90,340,627 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	90,324,046 - 90,340,899 (+)	Ensembl				GRCr8
mRatBN7.2	1	81,196,532 - 81,212,848 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	81,196,532 - 81,212,847 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	86,588,717 - 86,605,032 (+)	NCBI	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	95,140,207 - 95,156,569 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	88,344,513 - 88,360,828 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0
Dahl_SR_JrHsd	1	88,944,249 - 88,960,564 (+)	NCBI
Lyon_Normotensive	1	94,081,083 - 94,097,398 (+)	NCBI
Lyon_Hypertensive	1	90,624,611 - 90,640,951 (+)	NCBI
F344_StmMcwi	1	89,069,578 - 89,085,893 (+)	NCBI
Rnor_6.0	1	82,480,875 - 82,497,196 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	82,480,195 - 82,497,199 (+)	Ensembl		Rnor_6.0 Ensembl	rn6	Rnor6.0
Rnor_5.0	1	83,742,151 - 83,758,472 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	80,894,705 - 80,911,020 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	75,636,001 - 75,652,315 (+)	NCBI		Celera
RGSC_v3.1	1	80,972,549 - 80,988,992 (+)	NCBI
Cytogenetic Map	1	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Abdominal Pain (ISO)

acromicric dysplasia (ISO)

actinic keratosis (ISO)

acute kidney failure (ISO)

Acute Lung Injury (ISO)

acute myeloid leukemia (ISO)

adenocarcinoma (ISO)

adenoid hypertrophy (IEP)

alcohol use disorder (IEP)

alcoholic liver cirrhosis (IEP,ISO)

allergic conjunctivitis (ISO)

allergic disease (ISO)

allergic rhinitis (IEP)

anemia (ISO)

Anetoderma (ISO)

anogenital venereal wart (ISO)

aortic valve insufficiency (ISO)

aphthous stomatitis (ISO)

aplastic anemia (ISO)

arteriosclerosis (ISO)

asthma (IEP,ISO)

atopic dermatitis (ISO)

atrial fibrillation (ISO)

autoimmune hepatitis (ISO)

autoimmune thrombocytopenic purpura (ISO)

bacterial pneumonia (ISO)

Behcet's disease (ISO)

berylliosis (ISO)

biliary atresia (ISO)

brain disease (ISO)

brain ischemia (IEP)

breast cancer (ISO)

Cachexia (ISO)

calcinosis (ISO)

Calvarial Hyperostosis (ISO)

Camurati-Engelmann disease (ISO)

Camurati-Engelmann disease 1 (ISO)

carcinoma (ISO)

carcinosarcoma (ISO)

Cardiac Fibrosis (IEP,ISO)

Cardiomegaly (IEP)

carotid artery disease (ISO)

Carotid Artery Injuries (IEP)

cervical cancer (ISO)

Chemical and Drug Induced Liver Injury (ISO)

chlamydia (ISO)

cholangiocarcinoma (IEP,ISO)

chorioamnionitis (ISO)

Chronic Experimental Pancreatitis (IEP)

Chronic Hepatitis (ISO)

Chronic Hepatitis B (ISO)

chronic myeloid leukemia (ISO)

chronic obstructive pulmonary disease (IMP,ISO)

cleft palate (ISO)

colon adenocarcinoma (ISO)

colon cancer (IEP)

colon carcinoma (ISO)

colorectal cancer (ISO)

Colorectal Neoplasms (ISO)

Constipation (ISO)

Copper-Overload Cirrhosis (ISO)

coronary artery disease (ISO)

cystic fibrosis (ISO)

degenerative disc disease (ISO)

Delayed Puberty (ISO)

diabetes mellitus (ISO)

Diabetic Nephropathies (IEP,ISO)

diabetic neuropathy (IEP,ISO)

Diaphragmatic Hernia (IEP,ISO)

diarrhea (ISO)

Dilatation, Pathologic (ISO)

distal myopathy (ISO)

dry eye syndrome (ISO)

Duchenne muscular dystrophy (ISO)

duodenal ulcer (ISO)

Dwarfism (ISO)

Ehlers-Danlos syndrome (ISO)

end stage renal disease (IEP,ISO)

endomyocardial fibrosis (ISO)

eosinophilic esophagitis (ISO)

epilepsy (ISO)

esophageal cancer (ISO)

essential thrombocythemia (ISO)

Experimental Arthritis (IEP)

Experimental Autoimmune Encephalomyelitis (IEP)

Experimental Diabetes Mellitus (IEP,ISO)

Experimental Liver Cirrhosis (IEP,ISO)

Experimental Liver Neoplasms (ISO)

Experimental Mammary Neoplasms (ISO)

extrahepatic cholestasis (ISO)

factor VIII deficiency (ISO)

Failure to Thrive (ISO)

familial hyperlipidemia (IDA,IEP)

Fasciculation (ISO)

Femoral Fractures (ISO)

Fibrosis (IMP,ISO)

focal segmental glomerulosclerosis (ISO)

Gallbladder Neoplasms (ISO)

genetic disease (ISO)

gout (ISO)

Graves' disease (ISO)

head and neck squamous cell carcinoma (ISO)

heart disease (ISO)

Heart Injuries (ISO)

Hemorrhagic Shock (IEP)

hepatic encephalopathy (ISO)

Hepatic Insufficiency (ISO)

hepatocellular carcinoma (ISO)

Hepatomegaly (ISO)

Hereditary Hemorrhagic Telangiectasia, Type 1 (ISO)

hereditary spastic paraplegia 11 (ISO)

Hyperoxia (IEP,ISO)

Hyperplasia (ISO)

hypertension (IAGP,IEP,ISO)

hypertrophic cardiomyopathy (ISO)

hyperuricemia (ISO)

IgA glomerulonephritis (ISO)

impotence (IEP)

Infant, Newborn, Diseases (ISO)

Inflammation (ISO)

inflammatory bowel disease (ISO)

INFLAMMATORY BOWEL DISEASE, IMMUNODEFICIENCY, AND ENCEPHALOPATHY (ISO)

insulinoma (ISO)

interstitial lung disease (ISO)

kidney disease (ISO)

Kidney Reperfusion Injury (ISO)

Left Ventricular Hypertrophy (ISO)

liver cirrhosis (ISO)

localized scleroderma (ISO)

lung cancer (ISO)

lung disease (IEP,ISO)

Lung Neoplasms (ISO)

Lymphomatoid Papulosis (ISO)

Macrocephaly (ISO)

melanoma (ISO)

Metabolic Bone Diseases (ISO)

metabolic dysfunction and alcohol associated liver disease (IEP)

metabolic dysfunction-associated steatotic liver disease (ISO)

Metabolic Syndrome (IEP)

middle cerebral artery infarction (IEP,ISO)

multiple myeloma (ISO)

Muscle Hypotonia (ISO)

muscular atrophy (ISO)

muscular disease (ISO)

myelofibrosis (ISO)

myocardial infarction (IEP,ISO)

Myocardial Reperfusion Injury (IEP)

myopathy (ISO)

Nasal Polyps (ISO)

Neoplasm Invasiveness (ISO)

Neoplasm Metastasis (ISO)

Neoplastic Cell Transformation (ISO)

nephrolithiasis (IEP)

nephrosclerosis (ISO)

nephrotic syndrome (ISO)

nephrotoxicity (IEP)

Neuralgia (IEP)

Neurologic Gait Disorders (ISO)

neuropathy (ISO)

obesity (IEP,ISO)

occupational asthma (ISO)

Occupational Diseases (ISO)

oral submucous fibrosis (ISO)

orbital disease (ISO)

osteoarthritis (ISO)

osteochondrodysplasia (ISO)

osteoporosis (IEP,ISO)

ovarian serous cystadenocarcinoma (ISO)

pancreatic cancer (ISO)

pancreatic ductal adenocarcinoma (ISO)

pancreatic ductal carcinoma (ISO)

papilloma (ISO)

Paraquat Lung (ISO)

Peritoneal Fibrosis (IEP,ISO)

Peyronie's disease (ISO)

pleural disease (ISO)

pneumonia (ISO)

Posterior Leukoencephalopathy Syndrome (ISO)

Postmenopausal Osteoporosis (ISO)

primary biliary cholangitis (ISO)

Progressive Diaphyseal Dysplasia 1 (ISO)

prostate cancer (ISO)

Prostatic Neoplasms (ISO)

proteinuria (IMP,ISO)

psoriasis (ISO)

pulmonary emphysema (ISO)

pulmonary fibrosis (IEP,IMP,ISO)

pulmonary hypertension (ISO)

pulmonary sarcoidosis (ISO)

Radiation Pneumonitis (IEP,IMP,ISO)

renal cell carcinoma (ISO)

rhinitis (ISO)

Right Ventricular Hypertrophy (IEP)

sarcoidosis (ISO)

sarcoma (ISO)

scoliosis (ISO)

Sepsis (ISO)

severe acute respiratory syndrome (IEP,ISO)

sickle cell anemia (ISO)

Sjogren's syndrome (ISO,ISS)

Skin Neoplasms (ISO)

Spinal Cord Injuries (IMP)

Spontaneous Abortions (ISO)

Spontaneous Neoplasm Regression (ISO)

squamous cell carcinoma (ISO)

stomach cancer (ISO)

stroke (ISO)

thrombocytopenia (ISO)

Thyroid Carcinoma, Nonmedullary 1 (ISO)

tracheal stenosis (ISO)

traumatic brain injury (IEP)

Tubulointerstitial Fibrosis (IEP,IMP,ISO)

type 1 diabetes mellitus (ISO)

type 2 diabetes mellitus (IEP,ISO)

uremia (ISO)

ureteral obstruction (ISO)

urethral obstruction (IEP)

urticaria (ISO)

uterine carcinosarcoma (ISO)

uterine corpus endometrial carcinoma (ISO)

uveitis (ISO)

Ventricular Remodeling (ISO)

vitiligo (ISO)

Wallerian Degeneration (IEP)

Wounds and Injuries (IEP,IMP)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-beta-thujone (ISO)

(+)-schisandrin B (EXP,ISO)

(+)-taxifolin (EXP)

(+)-Tetrandrine (EXP)

(-)-acanthoic acid (EXP)

(-)-anisomycin (ISO)

(-)-ephedrine (EXP)

(-)-epigallocatechin 3-gallate (EXP,ISO)

(1->4)-beta-D-glucan (ISO)

(20S)-ginsenoside Rg3 (ISO)

(25R)-cholest-5-ene-3beta,26-diol (ISO)

(aminomethyl)phosphonic acid (ISO)

(R)-amygdalin (ISO)

(R)-camphor (ISO)

(R)-carnitine (EXP)

(R)-linalyl acetate (ISO)

(R)-lipoic acid (EXP,ISO)

(R)-noradrenaline (EXP)

(R,R,R)-alpha-tocopherol (EXP)

(S)-colchicine (EXP)

(S)-naringenin (EXP,ISO)

(S)-nicotine (EXP,ISO)

1,1-bis(2-aminoethyl)-2-hydroxy-3-oxotriazane (ISO)

1,2-dimethylhydrazine (ISO)

1,3,5-trinitrobenzene (ISO)

1,3,7,9-tetramethyluric acid (EXP)

1,8-cineole (ISO)

1-(5-isoquinolinesulfonyl)-2-methylpiperazine (ISO)

1-fluoro-2,4-dinitrobenzene (ISO)

1-Hydroxypyrene (ISO)

1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (ISO)

1-naphthyl isothiocyanate (EXP,ISO)

1-stearoyl-2-arachidonoyl-sn-glycerol (ISO)

14,15-EET (ISO)

15-deoxy-Delta(12,14)-prostaglandin J2 (EXP,ISO)

17alpha-ethynylestradiol (EXP,ISO)

17beta-estradiol (EXP,ISO)

17beta-hydroxy-5alpha-androstan-3-one (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (EXP)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,2'-Methylenebis(4-methyl-6-tert-butylphenol) (ISO)

2,2,2-tetramine (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,6-tribromophenol (ISO)

2,4,6-trinitrobenzenesulfonic acid (ISO)

2,4-D (EXP)

2,5-dihydroxybenzoic acid (ISO)

2,6-di-tert-butyl-4-methylphenol (ISO)

2-(3,4-dimethoxyphenyl)-5-\{[2-(3,4-dimethoxyphenyl)ethyl](methyl)amino\}-2-(propan-2-yl)pentanenitrile (EXP,ISO)

2-acetamidofluorene (EXP)

2-amino-2-deoxy-D-galactopyranose (EXP)

2-amino-2-deoxy-D-glucopyranose (EXP)

2-butoxyethanol (ISO)

2-deoxy-D-glucose (ISO)

2-hydroxypropanoic acid (ISO)

2-methoxy-17beta-estradiol (EXP)

2-trans,6-trans,10-trans-geranylgeranyl diphosphate (ISO)

20-HETE (ISO)

24,25-Dihydroxyvitamin D (ISO)

26-hydroxycholesterol (ISO)

3'-amino-3'-deoxy-N(6),N(6)-dimethyladenosine (EXP)

3,3',4,4',5-pentachlorobiphenyl (ISO)

3,3',4,4'-tetrachlorobiphenyl (ISO)

3,3',5,5'-tetrabromobisphenol A (ISO)

3,3',5-triiodo-L-thyronine (EXP,ISO)

3,4-dihydroxybenzaldehyde (ISO)

3,4-dihydroxybenzoic acid (EXP)

3-(1H-indol-3-yl)propanoic acid (ISO)

3-isobutyl-1-methyl-7H-xanthine (EXP,ISO)

3-phenylprop-2-enal (ISO)

4'-epidoxorubicin (ISO)

4,4'-diisothiocyano-trans-stilbene-2,2'-disulfonic acid (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxy-TEMPO (EXP,ISO)

4-hydroxynon-2-enal (ISO)

4-phenylbutyric acid (ISO)

5'-S-methyl-5'-thioadenosine (ISO)

5-(2-methylpiperazine-1-sulfonyl)isoquinoline (ISO)

5-aminoimidazole-4-carboxamide (EXP)

5-aza-2'-deoxycytidine (EXP,ISO)

5-azacytidine (ISO)

5-fluorouracil (EXP,ISO)

5-Hydroxycapric acid (ISO)

5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (ISO)

6-aminonicotinamide (ISO)

6-chloro-2,3,4,9-tetrahydro-1H-carbazole-1-carboxamide (EXP)

6-propyl-2-thiouracil (EXP)

6alpha-methylprednisolone (EXP)

7,12-dimethyltetraphene (ISO)

7,9-dihydro-1H-purine-2,6,8(3H)-trione (ISO)

7-[3-(3-cyclohexyl-3-hydroxypropyl)-2,5-dioxoimidazolidin-4-yl]heptanoic acid (ISO)

7H-xanthine (ISO)

8-Br-cAMP (ISO)

9-cis-retinoic acid (ISO)

9H-xanthine (ISO)

acetaldehyde (EXP,ISO)

acetamide (EXP)

acetic acid (EXP)

acetylsalicylic acid (EXP,ISO)

aconitic acid (ISO)

acrylamide (EXP,ISO)

acteoside (ISO)

actinomycin D (ISO)

adefovir (EXP)

adenine (EXP,ISO)

adenosine (ISO)

Aeol 10150 (EXP)

afimoxifene (EXP)

aflatoxin B1 (EXP)

AICA ribonucleotide (ISO)

aldehydo-D-glucosamine (EXP)

aldehydo-D-glucose (EXP,ISO)

aldosterone (EXP)

alendronic acid (EXP)

alfacalcidol (ISO)

Alisol B (ISO)

all-trans-retinoic acid (EXP,ISO)

allantoin (ISO)

allethrin (EXP)

allyl alcohol (EXP)

alogliptin (EXP)

alpha-D-galactose (EXP)

alpha-naphthoflavone (EXP,ISO)

aluminium atom (ISO)

aluminium hydroxide (ISO)

aluminium oxide (ISO)

aluminium(0) (ISO)

alvocidib (ISO)

AM-251 (ISO)

ambroxol (EXP)

aminoguanidine (EXP,ISO)

amiodarone (EXP)

amitrole (EXP)

amlodipine (EXP,ISO)

ammonium chloride (EXP)

Ammothamnine (ISO)

amodiaquine (ISO)

amosite asbestos (EXP)

amphibole asbestos (EXP)

amphotericin B (ISO)

anagrelide (ISO)

andrastin A (ISO)

androgen antagonist (EXP)

andrographolide (EXP,ISO)

aniline (EXP)

anthocyanin (EXP,ISO)

anthra[1,9-cd]pyrazol-6(2H)-one (EXP,ISO)

anthracene-1,8,9-triol (ISO)

antimycin A (ISO)

ANTU (EXP)

apocynin (EXP)

arachidonic acid (EXP)

arecoline hydrobromide (EXP)

aristolochic acid A (EXP,ISO)

aristolochic acids (ISO)

arsane (EXP,ISO)

arsenic atom (EXP,ISO)

arsenic trichloride (ISO)

arsenite(3-) (ISO)

arsenous acid (EXP,ISO)

asbestos (EXP,ISO)

atorvastatin calcium (EXP,ISO)

ATP (ISO)

atropine (EXP)

aucubin (ISO)

auraptene (ISO)

aurothioglucose (ISO)

azathioprine (ISO)

Azoxymethane (ISO)

azoxystrobin (ISO)

baicalein (EXP,ISO)

baicalin (EXP,ISO)

bellidifolin (EXP,ISO)

benazepril (EXP,ISO)

bentonite (EXP)

benzalkonium chloride (ISO)

benzene (ISO)

benzo[a]pyrene (EXP,ISO)

Benzoyl peroxide (ISO)

berberine (EXP,ISO)

beta-D-glucosamine (EXP)

beta-naphthoflavone (EXP)

Betanin (EXP)

betulin (EXP)

betulinic acid (EXP,ISO)

bezafibrate (EXP,ISO)

bifenthrin (EXP)

bis(2-chloroethyl) sulfide (EXP,ISO)

bis(2-ethylhexyl) phthalate (EXP,ISO)

Bisibuthiamine (EXP)

bisphenol A (EXP,ISO)

Bisphenol A diglycidyl ether (EXP,ISO)

bisphenol F (ISO)

bleomycin A2 (EXP,ISO)

boric acid (ISO)

bosentan (ISO)

Brevianamide A (ISO)

bromocriptine (EXP)

bucladesine (ISO)

budesonide (ISO)

Bufotalin (ISO)

busulfan (ISO)

buta-1,3-diene (ISO)

Butylbenzyl phthalate (ISO)

Butylparaben (EXP)

butyric acid (ISO)

cadmium atom (EXP,ISO)

cadmium dichloride (EXP,ISO)

cadmium selenide (ISO)

caffeine (EXP)

Calcimycin (ISO)

calciol (EXP,ISO)

calcipotriol (EXP)

calcitriol (EXP,ISO)

calcium atom (EXP,ISO)

calcium carbonate (EXP)

calcium dichloride (ISO)

calcium silicate (ISO)

calcium(0) (EXP,ISO)

calycosin (EXP)

camostat (EXP,ISO)

camphor (ISO)

candesartan (EXP)

Candesartan cilexetil (EXP)

canertinib (ISO)

cannabidiol (ISO)

Cannabidivarin (ISO)

cantharidin (ISO)

capsaicin (EXP,ISO)

captopril (EXP)

carbamazepine (EXP)

Carbaprostacyclin (ISO)

carbofuran (EXP)

carbon atom (EXP,ISO)

carbon disulfide (ISO)

carbon nanotube (ISO)

carfilzomib (ISO)

carmustine (EXP)

carnosine (EXP)

carrageenan (ISO)

carteolol (ISO)

carvacrol (EXP)

carvedilol (EXP,ISO)

cefoxitin (ISO)

celastrol (EXP,ISO)

celecoxib (EXP)

cerium trichloride (ISO)

ceruletide (ISO)

cetrorelix (ISO)

CGS-21680 (ISO)

Chebulagic acid (EXP)

chenodeoxycholic acid (ISO)

chitosan (EXP)

chloroquine (EXP)

chlorothalonil (ISO)

chlorpyrifos (ISO)

cholate (EXP)

cholesterol (EXP,ISO)

choline (ISO)

chromium atom (ISO)

chrysin (ISO)

ciglitazone (ISO)

cilazapril monohydrate (EXP)

cilnidipine (EXP)

cinaciguat (EXP)

Cinobufagin (ISO)

ciprofloxacin (EXP,ISO)

cisatracurium (ISO)

cisplatin (EXP,ISO)

clodronic acid (ISO)

clofibrate (EXP,ISO)

Clofop (EXP)

clopidogrel (ISO)

clotrimazole (EXP)

cobalt atom (EXP,ISO)

cobalt dichloride (EXP,ISO)

coenzyme Q10 (EXP)

colforsin daropate hydrochloride (EXP,ISO)

colistin (EXP,ISO)

columbianadin (EXP)

copper atom (ISO)

copper(0) (ISO)

copper(II) chloride (ISO)

copper(II) sulfate (ISO)

cordycepin (EXP,ISO)

corilagin (EXP)

corticosterone (EXP)

cortisol (EXP,ISO)

coumarin (ISO)

crocidolite asbestos (ISO)

crocin-1 (EXP)

Cryptotanshinone (ISO)

cucurbitacin B (ISO)

cumene hydroperoxide (ISO)

Cuprizon (ISO)

curcumin (EXP,ISO)

cycloheximide (EXP,ISO)

cyclophosphamide (EXP,ISO)

cyclosporin A (EXP,ISO)

cyhalothrin (EXP)

cypermethrin (EXP)

D-glucosamine (EXP)

D-glucose (EXP,ISO)

daidzein (EXP)

dapagliflozin (EXP)

dapsone (ISO)

DAPT (EXP)

daunorubicin (EXP)

DDE (EXP,ISO)

DDT (EXP)

decabromodiphenyl ether (ISO)

deguelin (ISO)

delphinidin (ISO)

Delta(9)-tetrahydrocannabinolic acid (ISO)

deoxycholic acid (EXP)

deoxynivalenol (ISO)

desferrioxamine B (EXP,ISO)

desloratadine (EXP)

dexamethasone (EXP,ISO)

dextran sulfate (EXP,ISO)

Di-n-hexyl phthalate (EXP)

Di-n-octyl phthalate (ISO)

diallyl trisulfide (ISO)

diarsenic trioxide (EXP,ISO)

diazinon (EXP,ISO)

diazoxide (ISO)

dibenziodolium (EXP,ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (EXP,ISO)

dicrotophos (ISO)

Dictamnine (ISO)

Didecyldimethylammonium (ISO)

dieckol (ISO)

dieldrin (EXP)

diethyl phthalate (ISO)

diethylcarbamazine (EXP)

diethylstilbestrol (EXP,ISO)

dihydrolipoic acid (EXP)

Diisodecyl phthalate (ISO)

diisononyl phthalate (ISO)

dimethyl fumarate (EXP)

dimethyl sulfoxide (ISO)

dimethylarsinic acid (EXP,ISO)

Diosbulbin B (ISO)

dioscin (ISO)

dioxygen (EXP,ISO)

dipyridamole (ISO)

disodium cromoglycate (EXP,ISO)

disodium selenite (ISO)

disulfiram (ISO)

dobutamine (EXP)

domperidone (ISO)

dopamine (EXP)

dorsomorphin (ISO)

doxorubicin (EXP,ISO)

Droloxifene (EXP)

ebselen (EXP,ISO)

EC 3.4.15.1 (peptidyl-dipeptidase A) inhibitor (EXP)

edaravone (EXP)

elemental carbon (EXP,ISO)

elemental selenium (EXP,ISO)

ellagic acid (EXP,ISO)

emetine (ISO)

emodin (EXP)

empagliflozin (ISO)

enalapril (EXP)

enalaprilat dihydrate (EXP)

endosulfan (EXP)

enzacamene (EXP)

eplerenone (EXP)

epoxiconazole (EXP)

eprosartan (EXP)

erlotinib hydrochloride (ISO)

esculetin (EXP)

estriol (ISO)

ethanol (EXP,ISO)

ethylparaben (ISO)

eticlopride(1+) (EXP)

EUK-8 (ISO)

Evodiamine (EXP,ISO)

farrerol (EXP)

fasudil (EXP,ISO)

febuxostat (EXP)

fenofibrate (EXP,ISO)

fenoldopam (EXP)

fenoprofen (EXP)

fenthion (ISO)

fentin hydroxide (ISO)

fenvalerate (EXP)

ferbam (ISO)

ferrostatin-1 (ISO)

ferulic acid (EXP)

finasteride (ISO)

fingolimod hydrochloride (ISO)

flavonoids (EXP)

florfenicol (ISO)

flubendazole (ISO)

fluoranthene (ISO)

fluorene (ISO)

flutamide (EXP)

fluvastatin (EXP)

folic acid (ISO)

formaldehyde (ISO)

fosinopril (ISO)

fragrance (ISO)

fructose (EXP,ISO)

fulvestrant (EXP,ISO)

fumonisin B1 (ISO)

furosemide (EXP)

gadodiamide hydrate (EXP,ISO)

gadolinium atom (ISO)

gadolinium trichloride (EXP,ISO)

galactose (EXP)

galangin (EXP,ISO)

gallic acid (EXP)

gamma-hexachlorocyclohexane (EXP)

Ganoderic acid A (ISO)

gemcitabine (ISO)

Geniposide (ISO)

genistein (EXP,ISO)

gentamycin (EXP,ISO)

geraniol (EXP)

ghrelin (ISO)

Ginkgoic acid (ISO)

ginsenoside Rb1 (EXP)

glucagon (ISO)

glucose (EXP,ISO)

glutathione (EXP,ISO)

glyburide (EXP)

glycerol (EXP)

glycyrrhizinic acid (EXP,ISO)

glyphosate (EXP,ISO)

gold atom (ISO)

gold(0) (ISO)

gossypin (EXP)

gossypol (ISO)

graphene oxide (ISO)

guggulsterone (ISO)

GW 501516 (ISO)

gypenoside LXXV (ISO)

heparin (EXP)

heptachlor (EXP,ISO)

hesperetin (EXP)

hesperidin (EXP)

hexachlorobenzene (EXP,ISO)

hexacosan-1-ol (EXP)

hexadecanoic acid (ISO)

Honokiol (EXP,ISO)

HU-308 (EXP,ISO)

hyaluronic acid (ISO)

hydrogen peroxide (EXP,ISO)

hypochlorous acid (ISO)

hypoxanthine (ISO)

ibuprofen (EXP)

icariin (EXP)

icaritin (ISO)

icatibant (EXP)

idelalisib (ISO)

imidacloprid (EXP,ISO)

imiquimod (ISO)

indole-3-methanol (EXP,ISO)

indometacin (EXP)

indoxyl sulfate (EXP,ISO)

iohexol (EXP)

ionomycin (ISO)

irbesartan (EXP,ISO)

iron atom (EXP)

iron dextran (EXP)

iron(0) (EXP)

iron(III) nitrilotriacetate (EXP)

Isoangustone A (ISO)

isoliquiritigenin (ISO)

isoorientin (EXP)

isoprenaline (EXP,ISO)

isorhamnetin (ISO)

isotretinoin (EXP)

ivermectin (EXP,ISO)

kaempferol (ISO)

ketamine (EXP,ISO)

kojic acid (EXP)

KT 5720 (ISO)

L-ascorbic acid (EXP,ISO)

L-cysteine (EXP)

L-methionine (EXP,ISO)

lactacystin (ISO)

lactucin (EXP,ISO)

lamivudine (ISO)

lansoprazole (ISO)

lapatinib (ISO)

Lasiocarpine (ISO)

lead diacetate (EXP,ISO)

lead(0) (ISO)

lead(II) chloride (ISO)

lenalidomide (ISO)

Leptin (EXP)

letrozole (EXP)

leukotriene B4 (ISO)

leukotriene D4 (ISO)

LGK974 (ISO)

lidocaine (EXP)

lignan (ISO)

lignin (ISO)

limonene (EXP)

linagliptin (EXP)

linalool (ISO)

linalyl acetate (ISO)

linderalactone (EXP,ISO)

linoleic acid (ISO)

linsidomine (EXP)

linuron (EXP)

lipoic acid (EXP,ISO)

lipopolysaccharide (EXP,ISO)

lipoxin A4 (EXP)

liquiritigenin (ISO)

lithium chloride (ISO)

lithocholic acid (ISO)

loganin (ISO)

losartan (EXP,ISO)

lovastatin (ISO)

luteolin (ISO)

Luteolin 7-methyl ether (ISO)

LY-2157299 (EXP,ISO)

LY294002 (EXP,ISO)

lycorine (ISO)

malonaldehyde (ISO)

maneb (ISO)

manganese atom (EXP,ISO)

manganese(0) (EXP,ISO)

manganese(II) chloride (EXP,ISO)

manganese(II) sulfate (EXP)

mangiferin (EXP,ISO)

manumycin A (EXP)

masitinib (ISO)

masoprocol (EXP)

mebendazole (ISO)

mechlorethamine (EXP)

melamine (ISO)

melatonin (EXP,ISO)

melittin (ISO)

melphalan (ISO)

mercury diacetate (ISO)

mercury dichloride (EXP,ISO)

mesalamine (EXP)

metformin (EXP,ISO)

methamphetamine (EXP,ISO)

Methanandamide (ISO)

methimazole (EXP)

methotrexate (ISO)

methyl beta-cyclodextrin (ISO)

methyl methanesulfonate (ISO)

methylarsonic acid (ISO)

methylglyoxal (EXP,ISO)

methylisothiazolinone (ISO)

methylmercury chloride (EXP,ISO)

methylseleninic acid (ISO)

methylxanthine (ISO)

metoprolol (EXP)

metronidazole (ISO)

Mezerein (ISO)

mifepristone (ISO)

minocycline (EXP)

mirtazapine (EXP,ISO)

mithramycin (EXP)

mitogen (EXP)

mitomycin C (ISO)

Mitotane (ISO)

MitoTEMPO (ISO)

mono(2-ethylhexyl) phthalate (EXP)

monocrotaline (EXP)

morin (EXP)

morphine (ISO)

Morroniside (EXP,ISO)

mycophenolic acid (EXP)

myricetin (EXP)

myricitrin (ISO)

myriocin (ISO)

N(5)-ethyl-L-glutamine (EXP)

N(gamma)-nitro-L-arginine methyl ester (ISO)

N-[2-(4-bromocinnamylamino)ethyl]isoquinoline-5-sulfonamide (ISO)

N-acetyl-1,4-benzoquinone imine (ISO)

N-acetyl-L-cysteine (EXP,ISO)

N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO)

N-methyl-4-phenylpyridinium (ISO)

N-methyl-N'-nitro-N-nitrosoguanidine (EXP)

N-nitrosodiethylamine (EXP,ISO)

N-nitrosodimethylamine (EXP,ISO)

N-nitrosomorpholine (EXP)

N-oleoyldopamine (ISO)

N-palmitoyl dopamine (ISO)

N-tosyl-L-phenylalanyl chloromethyl ketone (ISO)

N-Vinyl-2-pyrrolidone (EXP)

naproxen (EXP)

naringin (EXP,ISO)

nemorubicin (ISO)

neoechinulin A (ISO)

nerolidol (EXP)

nickel atom (ISO)

nickel dichloride (EXP,ISO)

nickel subsulfide (EXP)

nickel sulfate (ISO)

niclosamide (EXP,ISO)

nicotinamide (EXP,ISO)

nicotine (EXP,ISO)

nicotinic acid (EXP,ISO)

nifedipine (EXP)

nifuroxazide (EXP)

nilotinib (EXP)

nitrates (EXP,ISO)

nitric oxide (EXP)

nitrofen (EXP)

nitrogen dioxide (EXP)

NMN zwitterion (ISO)

Nonylphenol (EXP)

NS-398 (EXP)

obeticholic acid (EXP,ISO)

ochratoxin A (EXP,ISO)

octreotide (EXP)

okadaic acid (ISO)

olaparib (ISO)

oleanolic acid (ISO)

oleic acid (ISO)

olmesartan (EXP)

Olmesartan medoxomil (EXP)

olodaterol (ISO)

omeprazole (ISO)

Ophiopogonin D (ISO)

oridonin (EXP,ISO)

orlistat (ISO)

osthole (ISO)

ouabain (ISO)

oxalic acid (ISO)

Oxotremorine (ISO)

oxybenzone (ISO)

ozone (EXP,ISO)

Pachymic acid (EXP)

paeoniflorin (EXP,ISO)

Paeonol (EXP)

palbociclib (ISO)

Palmitic acid(d3) (ISO)

pantoprazole (ISO)

paracetamol (EXP,ISO)

paraoxon (ISO)

paraquat (EXP,ISO)

parathion (ISO)

paricalcitol (EXP)

patulin (EXP)

PCB138 (EXP)

PD 168393 (EXP)

Pentoxifylline (EXP)

perfluorobutanesulfonic acid (EXP)

perfluorohexanesulfonic acid (ISO)

perfluorooctane-1-sulfonic acid (EXP,ISO)

perfluorooctanoic acid (EXP,ISO)

perindopril (EXP,ISO)

permethrin (EXP)

peroxides (EXP)

phenanthrene (EXP)

phenobarbital (EXP)

phenylarsine oxide (ISO)

phenylephrine (EXP,ISO)

phenylmercury acetate (ISO)

phenytoin (ISO)

phloroglucinol (ISO)

Phomenone (ISO)

phorbol 13-acetate 12-myristate (ISO)

phosphatidylcholine (EXP)

Phyllanthin (ISO)

pioglitazone (EXP,ISO)

Piracetam (EXP)

pirfenidone (EXP,ISO)

pirinixic acid (EXP,ISO)

platycodin D (EXP,ISO)

plumbagin (EXP)

poly(ethylene) (ISO)

poly(I:C) (ISO)

poly(methyl methacrylate) macromolecule (ISO)

Potassium 2,6-dihydroxytriazinecarboxylate (ISO)

potassium chromate (ISO)

potassium iodide (EXP)

prazosin (EXP)

prednisolone (EXP,ISO)

prednisone (ISO)

pregabalin (EXP)

proanthocyanidin (EXP)

probenecid (EXP,ISO)

probucol (ISO)

prochloraz (EXP)

procymidone (EXP)

progesterone (EXP,ISO)

propane-1,2-diol (ISO)

propiconazole (EXP)

prostaglandin D2 (ISO)

prostaglandin E2 (EXP,ISO)

prostaglandin F2alpha (EXP)

protoporphyrinogen (ISO)

puerarin (EXP,ISO)

pyrethrins (EXP)

pyridoxamine (EXP)

pyrrolidine dithiocarbamate (EXP,ISO)

pyrvinium (EXP)

quartz (ISO)

quercetin (EXP,ISO)

quinapril hydrochloride (EXP)

rac-lactic acid (ISO)

raloxifene (ISO)

ramipril (EXP,ISO)

raspberry ketone (EXP)

reactive oxygen species (EXP,ISO)

rebaudioside A (EXP)

resveratrol (EXP,ISO)

Rhein (EXP)

rifaximin (ISO)

rimonabant (EXP)

rivaroxaban (EXP)

Ro 31-8220 (ISO)

robinin (EXP)

roflumilast (ISO)

rolipram (ISO)

rosmarinic acid (EXP,ISO)

rosuvastatin calcium (EXP,ISO)

rotenone (EXP,ISO)

rutin (EXP,ISO)

S-adenosyl-L-methioninate (ISO)

S-adenosyl-L-methionine (ISO)

S-allylcysteine (EXP)

sabinene (ISO)

Salidroside (EXP)

Salinomycin (ISO)

salubrinal (EXP)

Salvianolic acid A (ISO)

salvianolic acid B (EXP,ISO)

sanguinarine (ISO)

saroglitazar (ISO)

sarpogrelate (ISO)

SB 203580 (EXP,ISO)

SB 431542 (EXP,ISO)

SCH772984 (ISO)

selenium atom (EXP,ISO)

senecionine (ISO)

serotonin (ISO)

serpentine asbestos (EXP,ISO)

sevoflurane (EXP,ISO)

sildenafil citrate (EXP,ISO)

silibinin (EXP)

silicon atom (ISO)

silicon dioxide (EXP,ISO)

simvastatin (EXP,ISO)

Sinomenine (ISO)

sirolimus (EXP,ISO)

sodium acetate trihydrate (ISO)

sodium arsenate (ISO)

sodium arsenite (EXP,ISO)

sodium benzoate (EXP,ISO)

sodium chloride (EXP,ISO)

sodium cholate (EXP)

sodium fluoride (EXP,ISO)

sodium hydrogencarbonate (EXP)

sodium nitrite (EXP)

sodium propionate (ISO)

sodium stibogluconate (ISO)

sodium tungstate (ISO)

solasodine (ISO)

sorafenib (ISO)

sparsentan (ISO)

spathulenol (ISO)

spironolactone (EXP)

SR 144528 (ISO)

stattic (ISO)

sterigmatocystin (EXP)

streptozocin (EXP,ISO)

styrene (ISO)

succimer (ISO)

sucrose (EXP)

sulfates (ISO)

sulforaphane (ISO)

sulfur dioxide (EXP)

sulindac (ISO)

sumatriptan (EXP)

sunitinib (EXP)

superoxide (EXP,ISO)

tacrolimus hydrate (EXP,ISO)

tadalafil (EXP)

tamibarotene (ISO)

tamoxifen (EXP,ISO)

Tanshinone I (ISO)

taraxasterol (ISO)

tartrazine (EXP)

taurine (EXP,ISO)

taurochenodeoxycholic acid (EXP)

tauroursodeoxycholic acid (EXP)

telmisartan (EXP,ISO)

teprenone (ISO)

teriflunomide (EXP)

tert-butyl hydroperoxide (ISO)

testosterone (ISO)

testosterone enanthate (EXP)

tetrachloromethane (EXP,ISO)

tetramethylpyrazine (ISO)

Tetramethylthiourea (EXP)

tetraphene (ISO)

tetrathiomolybdate(2-) (ISO)

thalidomide (EXP,ISO)

thapsigargin (EXP,ISO)

theobromine (EXP)

theophylline (ISO)

thimerosal (ISO)

thioacetamide (EXP,ISO)

Thiotepa (ISO)

thiram (ISO)

thymol (EXP,ISO)

thymol sulfate(1-) (EXP,ISO)

thymoquinone (ISO)

thyroxine (ISO)

tipifarnib (EXP)

Tiron (ISO)

titanium atom (ISO)

titanium dioxide (ISO)

TMC-120A (ISO)

tofacitinib (ISO)

tolfenamic acid (ISO)

toluene (EXP)

toluene 2,4-diisocyanate (ISO)

torasemide (EXP)

tranilast (EXP)

trans-piceid (EXP)

triadimefon (EXP)

triamcinolone acetonide (ISO)

tributylstannane (ISO)

trichloroethene (EXP,ISO)

trichostatin A (ISO)

triclosan (ISO)

trimellitic anhydride (ISO)

trimethyltin (ISO)

triphenyl phosphate (ISO)

troglitazone (EXP,ISO)

tropan-3alpha-yl 3-hydroxy-2-phenylpropanoate (EXP)

tropisetron (EXP)

Tubeimoside II (ISO)

tungsten (ISO)

tunicamycin (EXP)

tyrphostin AG 1478 (EXP,ISO)

udenafil (EXP)

umbelliferone (EXP)

uranium atom (EXP)

urethane (ISO)

ursodeoxycholic acid (EXP)

ursolic acid (EXP,ISO)

valproic acid (EXP,ISO)

valsartan (EXP,ISO)

vancomycin (ISO)

vemurafenib (ISO)

verapamil (EXP,ISO)

vericiguat (ISO)

vildagliptin (ISO)

vinclozolin (EXP)

vincristine (ISO)

vinorelbine (ISO)

Vinpocetine (EXP)

vitamin D (EXP,ISO)

vitamin E (EXP,ISO)

vorinostat (EXP,ISO)

WIN 55212-2 (ISO)

wortmannin (EXP)

Y-27632 (EXP,ISO)

zinc atom (EXP,ISO)

zinc oxide (ISO)

zinc protoporphyrin (EXP)

zinc pyrithione (ISO)

zinc(0) (EXP,ISO)

zingerone (EXP)

ziram (ISO)

zoledronic acid (EXP,ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains (IEA,ISO)

animal organ morphogenesis (IEA)

animal organ regeneration (IMP)

aortic valve morphogenesis (IEA,ISO)

apoptotic process (ISO)

ATP biosynthetic process (IEA,ISO,ISS)

branch elongation involved in mammary gland duct branching (ISO)

canonical NF-kappaB signal transduction (IDA)

canonical Wnt signaling pathway (ISO)

cell activation (ISO)

cell differentiation (IBA)

cell morphogenesis (ISO)

cell population proliferation (ISO)

cell-cell junction organization (IEA,ISO,ISS)

cellular response to acetaldehyde (IEP)

cellular response to dexamethasone stimulus (IDA)

cellular response to glucose stimulus (IEP)

cellular response to growth factor stimulus (ISO)

cellular response to hypoxia (IEA,ISO)

cellular response to insulin-like growth factor stimulus (IEP)

cellular response to ionizing radiation (IEA,IEP,ISO)

cellular response to low-density lipoprotein particle stimulus (IEA,ISO)

cellular response to mechanical stimulus (IEP)

cellular response to platelet-derived growth factor stimulus (IEP)

cellular response to transforming growth factor beta stimulus (IEA,ISO,ISS)

cellular response to virus (IEA,ISO)

chondrocyte differentiation (IEA,ISO,ISS)

columnar/cuboidal epithelial cell maturation (ISO)

connective tissue development (ISO)

defense response (IEA)

defense response to fungus (IDA)

digestive tract development (IEA,IEP)

embryonic liver development (IEA,ISO)

endoderm development (ISO)

epithelial to mesenchymal transition (IDA,IEA,ISO)

extracellular matrix assembly (IEA,ISO,ISS)

extrinsic apoptotic signaling pathway (ISO,ISS)

face morphogenesis (IEA,ISO)

female pregnancy (IEA,IEP)

frontal suture morphogenesis (IEA,IEP)

gene expression (ISO)

heart development (IBA,IEA,ISO)

heart valve morphogenesis (IEA,ISO)

hematopoietic progenitor cell differentiation (IEA,ISO,ISS)

hyaluronan catabolic process (IEA,ISO,ISS)

inflammatory response (ISO)

inner ear development (IEA,IEP)

intracellular calcium ion homeostasis (ISO)

lens fiber cell differentiation (ISO)

liver regeneration (IEP)

lung alveolus development (ISO)

lung development (TAS)

lymph node development (ISO)

mammary gland branching involved in thelarche (ISO)

mammary gland development (ISO)

membrane protein intracellular domain proteolysis (IEA,ISO,ISS)

mononuclear cell proliferation (ISO)

morphogenesis of a branching structure (IDA,IEA)

muscle cell cellular homeostasis (ISO)

myelination (IMP)

myeloid dendritic cell differentiation (ISO)

negative regulation of biomineral tissue development (IEA,ISO)

negative regulation of blood vessel endothelial cell migration (IEA,ISO,ISS)

negative regulation of cell cycle (IEA,ISO,ISS)

negative regulation of cell differentiation (IEA,ISO)

negative regulation of cell growth (IEA,ISO,ISS)

negative regulation of cell population proliferation (IEA,ISO,ISS)

negative regulation of cell-cell adhesion mediated by cadherin (IEA,ISO,ISS)

negative regulation of DNA-templated transcription (IEA,ISO,ISS)

negative regulation of epithelial cell proliferation (IDA,IEA,ISO)

negative regulation of fat cell differentiation (IEA,ISO,ISS)

negative regulation of gene expression (IEA,ISO,ISS)

negative regulation of hyaluronan biosynthetic process (IEA,ISO,ISS)

negative regulation of interleukin-17 production (IEA,ISO)

negative regulation of macrophage cytokine production (IEA,ISO,ISS)

negative regulation of miRNA transcription (ISO)

negative regulation of MyD88-dependent toll-like receptor signaling pathway (IEA,ISO)

negative regulation of myoblast differentiation (IEA,ISO,ISS)

negative regulation of natural killer cell mediated cytotoxicity directed against tumor cell target (IEA,ISO)

negative regulation of neuroblast proliferation (IDA)

negative regulation of ossification (ISO)

negative regulation of phagocytosis (IDA)

negative regulation of protein localization to plasma membrane (IEA,ISO)

negative regulation of release of sequestered calcium ion into cytosol (IDA)

negative regulation of skeletal muscle tissue development (IEA,ISO,ISS)

negative regulation of T cell activation (ISO)

negative regulation of T cell proliferation (ISO)

negative regulation of transcription by RNA polymerase II (ISO)

neural tube closure (IEA,ISO)

neural tube development (IEA,ISO)

neuron apoptotic process (ISO)

Notch signaling pathway (ISO)

odontoblast differentiation (IEA,ISO,ISS)

odontogenesis of dentin-containing tooth (IEP)

oligodendrocyte development (IEA,ISO)

osteoclast differentiation (ISO)

phosphate-containing compound metabolic process (IEA,ISO,ISS)

phospholipid homeostasis (ISO)

positive regulation of apoptotic process (IDA,IMP)

positive regulation of blood vessel endothelial cell migration (IEA,ISO,ISS)

positive regulation of branching involved in ureteric bud morphogenesis (IMP)

positive regulation of canonical NF-kappaB signal transduction (IEA,ISO)

positive regulation of canonical Wnt signaling pathway (IEA,ISO)

positive regulation of cardiac muscle cell differentiation (IEA,ISO)

positive regulation of cell division (IEA)

positive regulation of cell migration (IEA,ISO,ISS)

positive regulation of cell population proliferation (IEA,ISO,ISS)

positive regulation of chemokine (C-X-C motif) ligand 2 production (IEA,ISO)

positive regulation of chemotaxis (IEA,ISO,ISS)

positive regulation of collagen biosynthetic process (IEA,IMP,ISO,ISS)

positive regulation of DNA-templated transcription (IEA,ISO)

positive regulation of endothelial cell apoptotic process (IEA,ISO)

positive regulation of epidermal growth factor receptor signaling pathway (ISO,ISS)

positive regulation of epithelial cell proliferation (IDA)

positive regulation of epithelial to mesenchymal transition (IEA,ISO,ISS)

positive regulation of ERK1 and ERK2 cascade (IEA,ISO,ISS)

positive regulation of exit from mitosis (IDA)

positive regulation of extracellular matrix assembly (ISO)

positive regulation of fibroblast migration (IEA,ISO,ISS)

positive regulation of fibroblast proliferation (ISO)

positive regulation of gene expression (IEA,ISO,ISS)

positive regulation of inflammatory response (IEA,ISO)

positive regulation of interleukin-17 production (IEA,ISO,ISS)

positive regulation of interleukin-6 production (IEA,ISO)

positive regulation of isotype switching to IgA isotypes (ISO,ISS)

positive regulation of MAPK cascade (IEA,ISO)

positive regulation of mesenchymal stem cell proliferation (IEA,ISO)

positive regulation of microglia differentiation (IEA,ISO,ISS)

positive regulation of miRNA transcription (ISO)

positive regulation of mononuclear cell migration (IMP)

positive regulation of odontogenesis (ISO)

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction (IEA,ISO)

positive regulation of primary miRNA processing (IEA,ISO)

positive regulation of protein import into nucleus (IEA,ISO,ISS)

positive regulation of protein localization to nucleus (IEA,ISO)

positive regulation of protein metabolic process (IEA,ISO,ISS)

positive regulation of protein secretion (IEA,ISO,ISS)

positive regulation of protein-containing complex assembly (IEA,ISO,ISS)

positive regulation of receptor signaling pathway via STAT (IEA,ISO)

positive regulation of regulatory T cell differentiation (IEA,ISO)

positive regulation of SMAD protein signal transduction (IEA,ISO,ISS)

positive regulation of smooth muscle cell differentiation (IDA)

positive regulation of smooth muscle cell proliferation (IEA,ISO)

positive regulation of superoxide anion generation (IEA,ISO,ISS)

positive regulation of transcription by RNA polymerase II (IEA,ISO,ISS)

positive regulation of tumor necrosis factor production (IEA,ISO)

positive regulation of vascular permeability (IEA,ISO)

positive regulation of vasculature development (IEA,ISO)

primordial germ cell migration (ISO)

protein export from nucleus (IEA,ISO)

protein phosphorylation (ISO)

receptor catabolic process (IEA,ISO,ISS)

regulation of actin cytoskeleton organization (ISO)

regulation of animal organ morphogenesis (IEA)

regulation of branching involved in mammary gland duct morphogenesis (ISO)

regulation of cartilage development (ISO)

regulation of cell cycle (ISO)

regulation of cell growth (IEA,TAS)

regulation of cell population proliferation (IBA,IEA,ISO,TAS)

regulation of epithelial to mesenchymal transition involved in endocardial cushion formation (ISO)

regulation of gene expression (ISO)

regulation of interleukin-23 production (IEA,ISO)

regulation of metal ion transport (IEA)

regulation of miRNA transcription (ISO)

regulation of morphogenesis of a branching structure (IEA)

regulation of morphogenesis of an epithelium (IEA)

regulation of protein import into nucleus (ISO)

regulation of regulatory T cell differentiation (ISO)

regulation of sodium ion transport (ISO)

regulation of striated muscle tissue development (ISO)

regulatory T cell differentiation (IEA,ISO)

respiratory system development (IEA)

response to cholesterol (IEA,ISO,ISS)

response to estradiol (IEA,IEP,ISO,ISS)

response to ethanol (IEP)

response to gamma radiation (IEP)

response to glucose (IEP)

response to hypoxia (IEP)

response to immobilization stress (IEP)

response to laminar fluid shear stress (IEA,IEP)

response to progesterone (IEA,ISO,ISS)

response to salt (IEP)

response to vitamin D (IEP)

response to wounding (IEA,ISO,ISS)

response to xenobiotic stimulus (IEP)

retina vasculature development in camera-type eye (ISO)

salivary gland morphogenesis (IEA,ISO,ISS)

sprouting angiogenesis (ISO)

surfactant homeostasis (ISO)

T cell activation (ISO)

T cell differentiation (ISO)

T cell homeostasis (ISO)

tolerance induction to self antigen (ISO)

transforming growth factor beta receptor signaling pathway (IBA,IEA,IEP,ISO,ISS)

tube development (IEA)

ureteric bud development (IEA,ISO)

vasculogenesis (IEA,ISO)

ventricular cardiac muscle tissue morphogenesis (IEA,ISO)

Cellular Component

axon (IDA)

blood microparticle (ISS)

cell surface (IDA,IEA,ISO,ISS)

cytoplasm (IEA,ISO)

extracellular matrix (IDA,IEA,ISO)

extracellular region (IBA,IDA,IEA,ISO,ISS)

microvillus (IEA,ISO,ISS)

neuronal cell body (IDA)

nucleus (IEA,ISO,ISS)

secretory granule (IDA,IEA)

transforming growth factor beta complex (ISO)

transforming growth factor beta ligand-receptor complex (ISO)

Molecular Function

cytokine activity (IBA,IEA,ISO)

enzyme binding (IEA,ISO)

growth factor activity (IEA,ISO)

identical protein binding (IEA,IPI,ISO)

protein serine/threonine kinase activator activity (IEA,ISO)

protein-containing complex binding (IDA)

transforming growth factor beta receptor binding (IEA,ISO,TAS)

type I transforming growth factor beta receptor binding (IEA,ISO,ISS)

type II transforming growth factor beta receptor binding (IEA,ISO,ISS)

type III transforming growth factor beta receptor binding (IEA,ISO,ISS)

Molecular Pathway Annotations Click to see Annotation Detail View

altered transforming growth factor-beta Smad dependent signaling pathway (ISO)

cell cycle pathway, mitotic (IEA)

ceramide signaling pathway (IEA)

Chagas disease pathway (IEA)

chronic myeloid leukemia pathway (IEA)

colorectal cancer pathway (IEA,ISO)

cytokine mediated signaling pathway (IEA)

dilated cardiomyopathy pathway (IEA)

endocytosis pathway (IEA)

Entamoebiasis pathway (IEA)

glypican signaling pathway (ISO)

hypertrophic cardiomyopathy pathway (IEA)

interleukin-27 signaling pathway (ISO)

Leishmaniasis pathway (IEA)

malaria pathway (IEA)

mitogen activated protein kinase signaling pathway (IEA)

pancreatic cancer pathway (IEA)

renal cell carcinoma pathway (IEA)

rheumatoid arthritis pathway (IEA)

syndecan signaling pathway (ISO)

toxoplasmosis pathway (IEA)

transforming growth factor-beta Smad dependent signaling pathway (ISO)

transforming growth factor-beta superfamily mediated signaling pathway (IEA)

tuberculosis pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Transforming growth factor-beta1 is up-regulated by podocytes in response to excess intraglomerular passage of proteins: a central pathway in progressive glomerulosclerosis.	Abbate M, etal., Am J Pathol 2002 Dec;161(6):2179-93.
2.	The angiotensin type 1 receptor antagonist, eprosartan, attenuates the progression of renal disease in spontaneously hypertensive stroke-prone rats with accelerated hypertension.	Abrahamsen CT, etal., J Pharmacol Exp Ther. 2002 Apr;301(1):21-8. doi: 10.1124/jpet.301.1.21.
3.	Tgf-beta1, Tgf-beta2, Tgf-beta3 and Msx2 expression is elevated during frontonasal suture morphogenesis and during active postnatal facial growth.	Adab K, etal., Orthod Craniofac Res. 2002 Nov;5(4):227-37.
4.	Astaxanthin modulates osteopontin and transforming growth factor beta1 expression levels in a rat model of nephrolithiasis: a comparison with citrate administration.	Alex M, etal., BJU Int. 2014 Sep;114(3):458-66. doi: 10.1111/bju.12537. Epub 2014 Feb 19.
5.	Reduced transforming growth factor-beta1 production by mononuclear cells from patients with active chronic idiopathic thrombocytopenic purpura.	Andersson PO, etal., Br J Haematol. 2002 Mar;116(4):862-7.
6.	Transforming growth factor-beta induces cellular injury in experimental diabetic neuropathy.	Anjaneyulu M, etal., Exp Neurol. 2008 Jun;211(2):469-79. Epub 2008 Mar 2.
7.	Small molecular inhibitor of transforming growth factor-beta protects against development of radiation-induced lung injury.	Anscher MS, etal., Int J Radiat Oncol Biol Phys. 2008 Jul 1;71(3):829-37. Epub 2008 Apr 12.
8.	Cyclooxygenase-2 is required for activated pancreatic stellate cells to respond to proinflammatory cytokines.	Aoki H, etal., Am J Physiol Cell Physiol. 2007 Jan;292(1):C259-68. Epub 2006 Jul 12.
9.	Atopic dermatitis is associated with a low-producer transforming growth factor beta(1) cytokine genotype.	Arkwright PD, etal., J Allergy Clin Immunol. 2001 Aug;108(2):281-4.
10.	Transforming growth factor beta 1 can induce estrogen-independent tumorigenicity of human breast cancer cells in athymic mice.	Arteaga CL, etal., Cell Growth Differ. 1993 Mar;4(3):193-201.
11.	The effect of antibodies to TGF-beta1 and TGF-beta2 at a site of sciatic nerve repair.	Atkins S, etal., J Peripher Nerv Syst. 2006 Dec;11(4):286-93.
12.	[TGF-Beta1-915G/C and TNF-alpha-308G/A polymorphisms in children with asthma]	Aytekin C, etal., Tuberk Toraks. 2009;57(1):62-7.
13.	Mechanical load induced by glass microspheres releases angiogenic factors from neonatal rat ventricular myocytes cultures and causes arrhythmias.	Barac DY, etal., J Cell Mol Med. 2008 Oct;12(5B):2037-51. doi: 10.1111/j.1582-4934.2008.00193.x.
14.	The genetic association database.	Becker KG, etal., Nat Genet. 2004 May;36(5):431-2.
15.	Differential expression of transforming growth factors-beta1, -beta2 and -beta3 in human colon carcinoma.	Bellone G, etal., Eur J Cancer. 2001 Jan;37(2):224-33.
16.	Growth hormone treatment prevents osteoporosis in uremic rats.	Berger I, etal., Histol Histopathol. 2007 Nov;22(11):1231-9.
17.	Abatacept as a therapeutic option in the treatment of encapsulated peritoneal sclerosis: an experimental rat model.	Bircan L, etal., Int Urol Nephrol. 2017 May;49(5):909-916. doi: 10.1007/s11255-017-1535-9. Epub 2017 Feb 11.
18.	Expression of Genes Involved in Cellular Adhesion and Extracellular Matrix Remodeling Correlates with Poor Survival of Patients with Renal Cancer.	Boguslawska J, etal., J Urol. 2016 Jun;195(6):1892-902. doi: 10.1016/j.juro.2015.11.050. Epub 2015 Nov 26.
19.	Interaction between a novel TGFB1 haplotype and CFTR genotype is associated with improved lung function in cystic fibrosis.	Bremer LA, etal., Hum Mol Genet. 2008 Jul 15;17(14):2228-37. Epub 2008 Apr 17.
20.	TGF-beta signaling promotes survival and repair in rat alveolar epithelial type 2 cells during recovery after hyperoxic injury.	Buckley S, etal., Am J Physiol Lung Cell Mol Physiol. 2008 Apr;294(4):L739-48. Epub 2008 Feb 1.
21.	Effect of radiation and repeated sub-culturing on the transforming growth factor-beta1 signaling pathway in FRTL-5 cells.	Burrell CG, etal., In Vivo. 2015 Jan-Feb;29(1):5-15.
22.	Enhanced growth of colorectal aberrant crypt foci in fasted/refed rats involves changes in TGFbeta1 and p21CIP expressions.	Caderni G, etal., Carcinogenesis 2002 Feb;23(2):323-7.
23.	Effects of calorie restriction on transforming growth factor beta 1 and proinflammatory cytokines in murine Sjogren's syndrome.	Chandrasekar B, etal., Clin Immunol Immunopathol. 1995 Sep;76(3 Pt 1):291-6.
24.	Pyrrolidine dithiocarbamate attenuates paraquat-induced lung injury in rats.	Chang X, etal., J Biomed Biotechnol. 2009;2009:619487. Epub 2009 Jul 21.
25.	Acetaldehyde stimulates the activation of latent transforming growth factor-beta1 and induces expression of the type II receptor of the cytokine in rat cultured hepatic stellate cells.	Chen A Biochem J 2002 Dec 15;368(Pt 3):683-93.
26.	Heterozygous knockout of transforming growth factor-ß1 protects Dahl S rats against high salt-induced renal injury.	Chen CC, etal., Physiol Genomics. 2013 Feb 4;45(3):110-8. doi: 10.1152/physiolgenomics.00119.2012. Epub 2012 Dec 18.
27.	Flexibilide obtained from cultured soft coral has anti-neuroinflammatory and analgesic effects through the upregulation of spinal transforming growth factor-beta1 in neuropathic rats.	Chen NF, etal., Mar Drugs. 2014 Jun 27;12(7):3792-817. doi: 10.3390/md12073792.
28.	ISO-1, a macrophage migration inhibitory factor antagonist, inhibits airway remodeling in a murine model of chronic asthma.	Chen PF, etal., Mol Med. 2010 Sep-Oct;16(9-10):400-8. Epub 2010 May 14.
29.	[Acupoint application of herbal paste relieves symptoms and naso-mucosal inflammatory response by down-regulating serum TGF-β1 in allergic rhinitis rats].	Chen S, etal., Zhen Ci Yan Jiu. 2019 Jun 25;44(6):430-3. doi: 10.13702/j.1000-0607.180369.
30.	Risk of aggressive breast cancer in women of Han nationality carrying TGFB1 rs1982073 C allele and FGFR2 rs1219648 G allele in North China.	Chen XH, etal., Breast Cancer Res Treat. 2011 Jan;125(2):575-82. doi: 10.1007/s10549-010-1032-7. Epub 2010 Jul 17.
31.	[Hyperlipidemia induced by high fat diet ingestion activates TGF-beta/Smad signaling pathway in the kidney of diabetic rats]	Chen ZX, etal., Zhong Nan Da Xue Xue Bao Yi Xue Ban. 2008 Oct;33(10):906-12.
32.	Induction of c-jun and TGF-beta 1 in Fischer 344 rats during amiodarone-induced pulmonary fibrosis.	Chung WH, etal., Am J Physiol Lung Cell Mol Physiol 2001 Nov;281(5):L1180-8.
33.	Hepatic fibrosis, glomerulosclerosis, and a lipodystrophy-like syndrome in PEPCK-TGF-beta1 transgenic mice.	Clouthier DE, etal., J Clin Invest 1997 Dec 1;100(11):2697-713.
34.	TGFB1 and TGFBR1 polymorphisms and breast cancer risk in the Nurses' Health Study.	Cox DG, etal., BMC Cancer. 2007 Sep 11;7:175.
35.	Influence of nephron mass in development of chronic renal failure after prolonged warm renal ischemia.	Cruzado JM, etal., Am J Physiol Renal Physiol. 2000 Aug;279(2):F259-69.
36.	Lack of transforming growth factor-beta 1 expression in benign skin tumors of p53null mice is prognostic for a high risk of malignant conversion.	Cui W, etal., Cancer Res. 1994 Nov 15;54(22):5831-6.
37.	Differential expression of cytokines in the rat heart in response to sustained volume overload.	Dai RP, etal., Eur J Heart Fail. 2004 Oct;6(6):693-703.
38.	New associations: INFG and TGFB1 genes and the inhibitor development in severe haemophilia A.	de Alencar JB, etal., Haemophilia. 2015 Jul;21(4):e312-6. doi: 10.1111/hae.12685. Epub 2015 Apr 30.
39.	Ontogenic expression of TGFbeta 1, 2, and 3 and its receptors in the rat gastric mucosa.	de Andrade Sa ER, etal., Dev Dyn. 2003 Jul;227(3):450-7.
40.	Impact of mitomycin C on the mRNA expression signatures of immunological biomarkers in eosinophilic nasal polyposis.	de Castro MC, etal., Am J Rhinol Allergy. 2013 Jan;27(1):e32-41. doi: 10.2500/ajra.2013.27.3868.
41.	Effect of Avocado/Soybean Unsaponifiables (ASU) on Osseointegration in Rats with Experimental Arthritis.	de Paula LGF, etal., Int J Oral Maxillofac Implants. 2018 May/Jun;33(3):603-612. doi: 10.11607/jomi.6124.
42.	Astrocyte-derived transforming growth factor-{beta} mediates the neuroprotective effects of 17{beta}-estradiol: involvement of nonclassical genomic signaling pathways.	Dhandapani KM, etal., Endocrinology. 2005 Jun;146(6):2749-59. Epub 2005 Mar 3.
43.	Role for TGF-beta1, FGF-2 and PDGF-AA in a myelination of CNS aggregate cultures enriched with macrophages.	Diemel LT, etal., J Neurosci Res. 2003 Dec 15;74(6):858-67.
44.	Attenuating effects of heat shock against TGF-beta1-induced apoptosis in cultured rat hepatocytes.	Diez-Fernandez C, etal., Free Radic Biol Med 2002 Sep 15;33(6):835-46.
45.	Regulatory T cell activity is partly inhibited in a mouse model of chronic Pseudomonas aeruginosa lung infection.	Ding FM, etal., Exp Lung Res. 2015 Feb;41(1):44-55. doi: 10.3109/01902148.2014.964351. Epub 2014 Nov 14.
46.	Immunoregulatory cytokines gene polymorphisms in Egyptian patients affected with acquired aplastic anemia.	El Mahgoub IR, etal., Ann Hematol. 2014 Jun;93(6):923-9. doi: 10.1007/s00277-013-1992-x. Epub 2013 Dec 21.
47.	Antifibrotic effect of diethylcarbamazine combined with hesperidin against ethanol induced liver fibrosis in rats.	El-Sisi AEE, etal., Biomed Pharmacother. 2017 May;89:1196-1206. doi: 10.1016/j.biopha.2017.03.013. Epub 2017 Mar 14.
48.	Evaluation of aromatase inhibitor on radiation induced pulmonary fibrosis via TGF- β/Smad 3 and TGF- β/PDGF pathways in rats.	Elkiki SM, etal., Toxicol Mech Methods. 2021 Sep;31(7):538-545. doi: 10.1080/15376516.2021.1934765. Epub 2021 Jun 21.
49.	Sodium valproate, a histone deacetylase inhibitor, with praziquantel ameliorates Schistosoma mansoni-induced liver fibrosis in mice.	Elsakkar MG, etal., Life Sci. 2016 Oct 1;162:95-101. doi: 10.1016/j.lfs.2016.08.010. Epub 2016 Aug 12.
50.	Association between TGFβ1 polymorphisms and chronic hepatitis B infection in an Iranian population.	Eskandari E, etal., Rev Soc Bras Med Trop. 2017 May-Jun;50(3):301-308. doi: 10.1590/0037-8682-0266-2016.
51.	Transforming growth factor beta1 release by human adipose tissue is enhanced in obesity.	Fain JN, etal., Metabolism. 2005 Nov;54(11):1546-51.
52.	LPS-conditioned dendritic cells confer endotoxin tolerance contingent on tryptophan catabolism.	Fallarino F, etal., Immunobiology. 2015 Feb;220(2):315-21. doi: 10.1016/j.imbio.2014.09.017. Epub 2014 Sep 28.
53.	Transforming growth factor-beta regulates tubular epithelial-myofibroblast transdifferentiation in vitro.	Fan JM, etal., Kidney Int. 1999 Oct;56(4):1455-67.
54.	Metformin mitigates carbon tetrachloride-induced TGF-β1/Smad3 signaling and liver fibrosis in mice.	Fan K, etal., Biomed Pharmacother. 2017 Jun;90:421-426. doi: 10.1016/j.biopha.2017.03.079. Epub 2017 Apr 5.
55.	Association of MBL2, TGF-beta1 and CD14 gene polymorphisms with lung disease severity in cystic fibrosis.	Faria EJ, etal., J Bras Pneumol. 2009 Apr;35(4):334-42.
56.	Localization of transforming growth factors, TGFbeta1 and TGFbeta3, in hypothalamic magnocellular neurones and the neurohypophysis.	Fevre-Montange M, etal., J Neuroendocrinol. 2004 Jul;16(7):571-6.
57.	Microarray analysis of mechanical shear effects on flexor tendon cells.	Fong KD, etal., Plast Reconstr Surg. 2005 Oct;116(5):1393-404; discussion 1405-6.
58.	Enhanced expression of transforming growth factor beta isoforms in pancreatic cancer correlates with decreased survival.	Friess H, etal., Gastroenterology. 1993 Dec;105(6):1846-56. doi: 10.1016/0016-5085(93)91084-u.
59.	Zhong xi yi jie he xue bao = Journal of Chinese integrative medicine	Fu Q, etal., Zhong Xi Yi Jie He Xue Bao. 2006 Jul;4(4):408-12.
60.	Interleukin 10 and transforming growth factor beta contribute to the development of experimentally induced allergic conjunctivitis in mice during the effector phase.	Fukushima A, etal., Br J Ophthalmol. 2006 Dec;90(12):1535-41. Epub 2006 Aug 16.
61.	[Expression and pathological implication of transforming growth factor-beta1 mRNA and endothelin-1 mRNA in intraacinar pulmonary arterioles of congenital heart disease accompanied with pulmonary hypertension]	Gao BH, etal., Zhonghua Bing Li Xue Za Zhi. 2005 Mar;34(3):159-62.
62.	Early administration of propofol protects against endotoxin-induced acute lung injury in rats by inhibiting the TGF-beta1-Smad2 dependent pathway.	Gao J, etal., Inflamm Res. 2010 Jul;59(7):491-500. Epub 2009 Nov 27.
63.	[Expression of transforming growth factor beta 1 in keratinocytes of oral submucous fibrosis tissue].	Gao Y, etal., Zhonghua Kou Qiang Yi Xue Za Zhi. 1997 Jul;32(4):239-41.
64.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
65.	GLUT-1 overexpression: Link between hemodynamic and metabolic factors in glomerular injury?	Gnudi L, etal., Hypertension. 2003 Jul;42(1):19-24. Epub 2003 May 27.
66.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
67.	Role of transforming growth factor-beta superfamily signaling pathways in human disease.	Gordon KJ and Blobe GC, Biochim Biophys Acta. 2008 Apr;1782(4):197-228. Epub 2008 Feb 11.
68.	Circulating transforming growth factor-beta-1 and breast cancer prognosis: results from the Shanghai Breast Cancer Study.	Grau AM, etal., Breast Cancer Res Treat. 2008 Nov;112(2):335-41. Epub 2007 Dec 13.
69.	TGFB1 T29C polymorphism and breast cancer risk: a meta-analysis based on 10,417 cases and 11,455 controls.	Gu D, etal., Breast Cancer Res Treat. 2010 Oct;123(3):857-61. doi: 10.1007/s10549-010-0766-6. Epub 2010 Feb 16.
70.	[Expression of vascular endothelial growth factor and transforming growth factor-beta 1 in nasal polyps].	Guo J, etal., Zhonghua Er Bi Yan Hou Ke Za Zhi. 2001 Apr;36(2):83-6.
71.	[The expression of transforming growth factor beta1 and its I, II receptors in the development of rat embryo and embryonic lung]	Guo Q, etal., Xi Bao Yu Fen Zi Mian Yi Xue Za Zhi. 2007 Apr;23(4):317-9.
72.	[The effect of cigarette smoke on the expression of transforming growth factor-beta1 mRNA and collagen type III in airways of asthmatic rats]	Guo ZH, etal., Zhonghua Jie He He Hu Xi Za Zhi. 2008 Jan;31(1):42-5.
73.	Does Telmisartan prevent hepatic fibrosis in rats with alloxan-induced diabetes?	Halici Z, etal., Eur J Pharmacol. 2009 Apr 27.
74.	Transforming growth factor-beta (TGF-beta) and tissue transglutaminase expression in the small intestine in children with coeliac disease.	Hansson T, etal., Scand J Immunol. 2002 Nov;56(5):530-7.
75.	[A study of pulmonary inflammatory reaction induced by N-protein of SARS-CoV in rat models and effects of glucocorticoids on it].	Hao D, etal., Zhonghua Nei Ke Za Zhi. 2005 Dec;44(12):890-3.
76.	Osthole Alleviates Bleomycin-Induced Pulmonary Fibrosis via Modulating Angiotensin-Converting Enzyme 2/Angiotensin-(1-7) Axis and Decreasing Inflammation Responses in Rats.	Hao Y and Liu Y, Biol Pharm Bull. 2016;39(4):457-65. doi: 10.1248/bpb.b15-00358. Epub 2016 Jan 28.
77.	Transforming growth factor-beta(1) in bronchoalveolar lavage fluid from children with cystic fibrosis.	Harris WT, etal., Pediatr Pulmonol. 2009 Nov;44(11):1057-64.
78.	Dynamic expression patterns of transforming growth factor-beta(2) and transforming growth factor-beta receptors in experimental glomerulonephritis.	Hartner A, etal., J Mol Med. 2003 Jan;81(1):32-42. Epub 2002 Dec 14.
79.	Diabetic kidney lesions of GIPRdn transgenic mice: podocyte hypertrophy and thickening of the GBM precede glomerular hypertrophy and glomerulosclerosis.	Herbach N, etal., Am J Physiol Renal Physiol. 2009 Apr;296(4):F819-29. Epub 2009 Feb 11.
80.	Immunocytochemical localization and serologic detection of transforming growth factor beta 1. Association with type I procollagen and inflammatory cell markers in diffuse and limited systemic sclerosis, morphea, and Raynaud's phenomenon.	Higley H, etal., Arthritis Rheum. 1994 Feb;37(2):278-88.
81.	Alcohol alters insulin-like growth factor-1-induced transforming growth factor beta1 synthesis in the medial basal hypothalamus of the prepubertal female rat.	Hiney JK, etal., Alcohol Clin Exp Res. 2014 Oct;38(10):2572-8. doi: 10.1111/acer.12534. Epub 2014 Oct 21.
82.	Urinary transforming growth factor-beta(1), collagen IV and the effect of insulin in children at diagnosis of diabetes mellitus.	Holmquist P and Torffvit O, Scand J Urol Nephrol. 2009;43(2):142-7.
83.	Upregulation of interleukin-1beta/transforming growth factor-beta1 and hypoxia relate to molecular mechanisms underlying immobilization-induced muscle contracture.	Honda Y, etal., Muscle Nerve. 2015 Sep;52(3):419-27. doi: 10.1002/mus.24558. Epub 2015 Jun 30.
84.	Smad3 mediates transforming growth factor-beta-induced alpha-smooth muscle actin expression.	Hu B, etal., Am J Respir Cell Mol Biol 2003 Sep;29(3 Pt 1):397-404. Epub 2003 Apr 17.
85.	[Effect of coicis semen oil on renal interstitial fibrosis in rats with unilateral urethral obstruction].	Hu Y, etal., Zhongguo Zhong Yao Za Zhi. 2013 Jun;38(12):1982-6.
86.	Transforming growth factor beta 1 (TGF beta 1) is an autocrine positive regulator of colon carcinoma U9 cells in vivo as shown by transfection of a TGF beta 1 antisense expression plasmid.	Huang F, etal., Cell Growth Differ. 1995 Dec;6(12):1635-42.
87.	TGF-beta1-induced Fascin1 promotes cell invasion and metastasis of human 786-0 renal carcinoma cells.	Huang W, etal., Acta Histochem. 2016 Mar;118(2):144-51. doi: 10.1016/j.acthis.2015.12.005. Epub 2015 Dec 31.
88.	Amniotic fluid transforming growth factor-beta1 and the risk for the development of neonatal bronchopulmonary dysplasia.	Ichiba H, etal., Neonatology. 2009;96(3):156-61. Epub 2009 Mar 31.
89.	The association of transforming growth factor beta 1 gene polymorphisms with the emphysema phenotype of COPD in Japanese.	Ito M, etal., Intern Med. 2008;47(15):1387-94. Epub 2008 Aug 1.
90.	Vitamin A and retinoic acid act synergistically to increase lung retinyl esters during normoxia and reduce hyperoxic lung injury in newborn mice.	James ML, etal., Pediatr Res. 2010 Jun;67(6):591-7.
91.	Mammalian transforming growth factor-betas: Smad signaling and physio-pathological roles.	Javelaud D and Mauviel A, Int J Biochem Cell Biol. 2004 Jul;36(7):1161-5.
92.	Zhonghua jie he he hu xi za zhi = Zhonghua jiehe he huxi zazhi = Chinese journal of tuberculosis and respiratory diseases	Ji YX, etal., Zhonghua Jie He He Hu Xi Za Zhi. 2008 Apr;31(4):264-7.
93.	Hypoxia induces transforming growth factor-beta1 gene expression in the pulmonary artery of rats via hypoxia-inducible factor-1alpha.	Jiang Y, etal., Acta Biochim Biophys Sin (Shanghai). 2007 Jan;39(1):73-80.
94.	High-expression of transforming growth factor beta1 and phosphorylation of extracellular signal-regulated protein kinase in vascular smooth muscle cells from aorta and renal arterioles of spontaneous hypertension rats.	Jing L, etal., Clin Exp Hypertens. 2007 Feb;29(2):107-17.
95.	[Relationship between transforming growth factor-β1 and interleukin-10 single nucleotide polymorphism and susceptibility of recurrent aphthous ulcer].	Jing Z, etal., Hua Xi Kou Qiang Yi Xue Za Zhi. 2016 Feb;34(1):27-31.
96.	TGF-beta 1 variants in chronic beryllium disease and sarcoidosis.	Jonth AC, etal., J Immunol. 2007 Sep 15;179(6):4255-62.
97.	Transforming growth factor-beta 1, 2, 3 and receptor type I and II in diabetic foot ulcers.	Jude EB, etal., Diabet Med. 2002 Jun;19(6):440-7.
98.	Global methylation analysis identifies prognostically important epigenetically inactivated tumor suppressor genes in multiple myeloma.	Kaiser MF, etal., Blood. 2013 Jul 11;122(2):219-26. doi: 10.1182/blood-2013-03-487884. Epub 2013 May 22.
99.	Effect of transforming growth factor-beta1 on acute lung injury caused by paraquat.	Kan B, etal., Mol Med Rep. 2014 Apr;9(4):1232-6. doi: 10.3892/mmr.2014.1938. Epub 2014 Feb 7.
100.	Pax-8 is essential for regulation of the thyroglobulin gene by transforming growth factor-beta1.	Kang HC, etal., Endocrinology 2001 Jan;142(1):267-75.
101.	Transforming growth factor beta 1 and its latent form binding protein-1 associate with elastic fibres in human dermis: accumulation in actinic damage and absence in anetoderma.	Karonen T, etal., Br J Dermatol. 1997 Jul;137(1):51-8.
102.	TGF-beta1, released by myofibroblasts, differentially regulates transcription and function of sodium and potassium channels in adult rat ventricular myocytes.	Kaur K, etal., PLoS One. 2013;8(2):e55391. doi: 10.1371/journal.pone.0055391. Epub 2013 Feb 5.
103.	X-linked inhibitor of apoptosis (XIAP) inhibits c-Jun N-terminal kinase 1 (JNK1) activation by transforming growth factor beta1 (TGF-beta1) through ubiquitin-mediated proteosomal degradation of the TGF-beta1-activated kinase 1 (TAK1).	Kaur S, etal., J Biol Chem. 2005 Nov 18;280(46):38599-608. Epub 2005 Sep 12.
104.	Divergent expression of liver transforming growth factor superfamily cytokines after successful portoenterostomy in biliary atresia.	Kerola A, etal., Surgery. 2019 May;165(5):905-911. doi: 10.1016/j.surg.2018.12.003. Epub 2019 Jan 25.
105.	Circulatory levels of T-cell cytokines (interleukin -2, IL-4, IL-17, and transforming growth factor-beta) in patients with vitiligo.	Khan R, etal., J Am Acad Dermatol. 2012 Mar;66(3):510-1. doi: 10.1016/j.jaad.2011.07.018.
106.	Regulatory T cells and TGF-ß1 in clinically localized renal cell carcinoma: Comparison with age-matched healthy controls.	Kim CS, etal., Urol Oncol. 2015 Mar;33(3):113.e19-25. doi: 10.1016/j.urolonc.2014.11.004. Epub 2014 Dec 11.
107.	Expression of TGFbeta family in the developing internal ear of rat embryos.	Kim HJ, etal., J Korean Med Sci. 2006 Feb;21(1):136-42.
108.	Middle East Respiratory Syndrome-Coronavirus Infection into Established hDPP4-Transgenic Mice Accelerates Lung Damage Via Activation of the Pro-Inflammatory Response and Pulmonary Fibrosis.	Kim J, etal., J Microbiol Biotechnol. 2020 Mar 28;30(3):427-438. doi: 10.4014/jmb.1910.10055.
109.	The TGF-beta1 dynamics during radiation therapy and its correlation to symptomatic radiation pneumonitis in lung cancer patients.	Kim JY, etal., Radiat Oncol. 2009 Nov 27;4:59.
110.	Combined effect of IL-10 and TGF-beta1 promoter polymorphisms as a risk factor for aspirin-intolerant asthma and rhinosinusitis.	Kim SH, etal., Allergy. 2009 Aug;64(8):1221-5. Epub 2009 Feb 16.
111.	Expression of mitogen-activated protein kinase pathways during postnatal development of rat heart.	Kim SO, etal., J Cell Biochem 1998 Nov 1;71(2):286-301.
112.	The effects of treatment with antibodies to transforming growth factor beta1 and beta2 following spinal cord damage in the adult rat.	King VR, etal., Neuroscience. 2004;126(1):173-83.
113.	Domain-specific mutations in TGFB1 result in Camurati-Engelmann disease.	Kinoshita A, etal., Nat Genet. 2000 Sep;26(1):19-20.
114.	Association of transforming growth factor-beta1 gene polymorphisms with myocardial infarction in patients with angiographically proven coronary heart disease.	Koch W, etal., Arterioscler Thromb Vasc Biol. 2006 May;26(5):1114-9. Epub 2006 Mar 16.
115.	Elevated plasma transforming growth factor-beta 1 levels in breast cancer patients decrease after surgical removal of the tumor.	Kong FM, etal., Ann Surg. 1995 Aug;222(2):155-62.
116.	TGF-{beta}1 activates two distinct type I receptors in neurons: implications for neuronal NF-{kappa}B signaling.	Konig HG, etal., J Cell Biol. 2005 Mar 28;168(7):1077-86. Epub 2005 Mar 21.
117.	Effects of TGF-betas and a specific antagonist on apoptosis of immature rat male germ cells in vitro.	Konrad L, etal., Apoptosis. 2006 May;11(5):739-48.
118.	Tumor necrosis factor--alpha and transforming growth factor--beta1 polymorphisms in bronchial asthma.	Kumar A, etal., Indian J Med Sci. 2008 Aug;62(8):323-30.
119.	Blockade of cysteine-rich protein 61 attenuates renal inflammation and fibrosis after ischemic kidney injury.	Lai CF, etal., Am J Physiol Renal Physiol. 2014 Sep 1;307(5):F581-92. doi: 10.1152/ajprenal.00670.2013. Epub 2014 Jun 11.
120.	Oral methylthioadenosine administration attenuates fibrosis and chronic liver disease progression in Mdr2-/- mice.	Latasa MU, etal., PLoS One. 2010 Dec 29;5(12):e15690. doi: 10.1371/journal.pone.0015690.
121.	BMP-2-induced Runx2 expression is mediated by Dlx5, and TGF-beta 1 opposes the BMP-2-induced osteoblast differentiation by suppression of Dlx5 expression.	Lee MH, etal., J Biol Chem 2003 Sep 5;278(36):34387-94. Epub 2003 Jun 18.
122.	Role of the spleen in liver regeneration in relation to transforming growth factor-beta1 and hepatocyte growth factor.	Lee SC, etal., J Surg Res. 2015 Jun 15;196(2):270-7. doi: 10.1016/j.jss.2015.02.025. Epub 2015 Feb 19.
123.	Reduced endothelial secretion and plasma levels of transforming growth factor-beta1 in patients with hereditary hemorrhagic telangiectasia type 1.	Letarte M, etal., Cardiovasc Res. 2005 Oct 1;68(1):155-64.
124.	Both high intratumoral microvessel density determined using CD105 antibody and elevated plasma levels of CD105 in colorectal cancer patients correlate with poor prognosis.	Li C, etal., Br J Cancer. 2003 May 6;88(9):1424-31.
125.	A comparative study of neovascularisation in atherosclerotic plaques using CD31, CD105 and TGF beta 1.	Li C, etal., Pathobiology. 2006;73(4):192-7.
126.	Customized platelet-rich plasma with transforming growth factor beta1 neutralization antibody to reduce fibrosis in skeletal muscle.	Li H, etal., Biomaterials. 2016 May;87:147-56. doi: 10.1016/j.biomaterials.2016.02.017. Epub 2016 Feb 17.
127.	Immunolocalization of connective tissue growth factor, transforming growth factor-beta1 and phosphorylated-SMAD2/3 during the postnatal tooth development and formation of junctional epithelium.	Li S and Pan Y, Ann Anat. 2018 Mar;216:52-59. doi: 10.1016/j.aanat.2017.10.005. Epub 2017 Nov 22.
128.	Immunohistochemical localization of connective tissue growth factor, transforming growth factor-beta1 and phosphorylated-smad2/3 in the developing periodontium of rats.	Li S, etal., J Periodontal Res. 2014 Oct;49(5):624-33. doi: 10.1111/jre.12143. Epub 2013 Nov 13.
129.	Urocortin ameliorates diabetic nephropathy in obese db/db mice.	Li X, etal., Br J Pharmacol. 2008 Jul;154(5):1025-34. Epub 2008 Apr 21.
130.	Huang-Lian-Jie-Du-Tang inhibits myocardial remodeling in a rat model of metabolic syndrome.	Li X, etal., J Ethnopharmacol. 2008 Sep 26;119(2):259-65. Epub 2008 Jul 25.
131.	[Significance of regulatory B cells in nosogenesis of immune thrombocytopenia].	Li X, etal., Zhongguo Shi Yan Xue Ye Xue Za Zhi. 2014 Apr;22(2):403-6. doi: 10.7534/j.issn.1009-2137.2014.02.025.
132.	The G/G genotype of transforming growth factor beta 1 (TGF-beta1) single nucleotide (+915G/C) polymorphism coincident with other host and environmental factors is associated with irreversible bronchoconstriction in asthmatics.	Liebhart J, etal., Int J Immunogenet. 2008 Dec;35(6):417-22.
133.	Serum transforming growth factor-beta1 levels and pancreatic cancer risk: a nested case-control study (Japan).	Lin Y, etal., Cancer Causes Control. 2006 Oct;17(8):1077-82.
134.	A rat model of adenoid hypertrophy constructed by using ovalbumin and lipopolysaccharides to induce allergy, chronic inflammation, and chronic intermittent hypoxia.	Liu A, etal., Animal Model Exp Med. 2025 Feb;8(2):353-362. doi: 10.1002/ame2.12396. Epub 2024 Apr 4.
135.	Effects of single nucleotide polymorphisms 869 T/C and 915 G/C in the exon 1 locus of transforming growth factor-beta1 gene on chronic obstructive pulmonary disease susceptibility in Chinese.	Liu DS, etal., Chin Med J (Engl). 2010 Feb 20;123(4):390-4.
136.	Thalidomide attenuates tumor growth and preserves fast-twitch skeletal muscle fibers in cholangiocarcinoma rats.	Liu KH, etal., Surgery. 2008 Mar;143(3):375-83. Epub 2007 Dec 21.
137.	[Change and significance of Th22 cells in patients with aplastic anemia].	Liu LM, etal., Zhonghua Yi Xue Za Zhi. 2013 May 28;93(20):1537-40.
138.	Leptin and acetaldehyde synergistically promotes αSMA expression in hepatic stellate cells by an interleukin 6-dependent mechanism.	Liu Y, etal., Alcohol Clin Exp Res. 2011 May;35(5):921-8. doi: 10.1111/j.1530-0277.2010.01422.x. Epub 2011 Feb 5.
139.	Crosstalk between the activated Slit2-Robo1 pathway and TGF-β1 signalling promotes cardiac fibrosis.	Liu Y, etal., ESC Heart Fail. 2021 Feb;8(1):447-460. doi: 10.1002/ehf2.13095. Epub 2020 Nov 24.
140.	Ghrelin protects against obesity-induced myocardial injury by regulating the lncRNA H19/miR-29a/IGF-1 signalling axis.	Liu Y, etal., Exp Mol Pathol. 2020 Jun;114:104405. doi: 10.1016/j.yexmp.2020.104405. Epub 2020 Feb 19.
141.	Betaglycan can act as a dual modulator of TGF-beta access to signaling receptors: mapping of ligand binding and GAG attachment sites.	Lopez-Casillas F, etal., J Cell Biol. 1994 Feb;124(4):557-68.
142.	In situ detection of TGF betas, TGF beta receptor II mRNA and telomerase activity in rat cholangiocarcinogenesis.	Lu JP, etal., World J Gastroenterol 2003 Mar;9(3):590-4.
143.	Mepacrine inhibits subepithelial fibrosis by reducing the expression of arginase and TGF-beta1 in an extended subacute mouse model of allergic asthma.	Mabalirajan U, etal., Am J Physiol Lung Cell Mol Physiol. 2009 Sep;297(3):L411-9. Epub 2009 Jun 19.
144.	Inhibition of matrix metalloproteinase on hepatic transforming growth factor beta1 and caspase-3 activation in hemorrhage.	Maitra SR, etal., Acad Emerg Med. 2005 Sep;12(9):797-803. doi: 10.1197/j.aem.2005.04.017.
145.	Elevated plasma TGF-beta1 levels in patients with chronic obstructive pulmonary disease.	Mak JC, etal., Respir Med. 2009 Jul;103(7):1083-9. Epub 2009 Jan 31.
146.	Tissue concentration of transforming growth factor beta1 and basic fibroblast growth factor in skin wounds created with a CO2 laser and scalpel: a comparative experimental study, using an animal model of skin resurfacing.	Manolis EN, etal., Wound Repair Regen. 2007 Mar-Apr;15(2):252-7.
147.	Stromal SPARC expression and patient survival after chemoradiation for non-resectable pancreatic adenocarcinoma.	Mantoni TS, etal., Cancer Biol Ther. 2008 Nov 24;7(11).
148.	Serum TGF-beta1 in atopic asthma.	Manuyakorn W, etal., Asian Pac J Allergy Immunol. 2008 Dec;26(4):185-9.
149.	Transforming growth factor-beta1 supports the rapid morphogenesis of heterotopic endochondral bone initiated by human osteogenic protein-1 via the synergistic upregulation of molecular markers.	Matsaba T, etal., Growth Factors 2001;19(2):73-86.
150.	Lacrimal gland inflammation is responsible for ocular pathology in TGF-beta 1 null mice.	McCartney-Francis NL, etal., Am J Pathol. 1997 Nov;151(5):1281-8.
151.	Elevated circulating TGFβ1 during acute liver failure activates TGFβR2 on cortical neurons and exacerbates neuroinflammation and hepatic encephalopathy in mice.	McMillin M, etal., J Neuroinflammation. 2019 Apr 2;16(1):69. doi: 10.1186/s12974-019-1455-y.
152.	Platelet TGF-beta1 contributions to plasma TGF-beta1, cardiac fibrosis, and systolic dysfunction in a mouse model of pressure overload.	Meyer A, etal., Blood. 2012 Jan 26;119(4):1064-74. doi: 10.1182/blood-2011-09-377648. Epub 2011 Dec 1.
153.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
154.	N-acetylcysteine inhibits RhoA and promotes apoptotic cell clearance during intense lung inflammation.	Moon C, etal., Am J Respir Crit Care Med. 2010 Feb 15;181(4):374-87. Epub 2009 Dec 3.
155.	Transforming growth factor-beta and inflammation in vascular (type IV) Ehlers-Danlos syndrome.	Morissette R, etal., Circ Cardiovasc Genet. 2014 Feb;7(1):80-8. doi: 10.1161/CIRCGENETICS.113.000280. Epub 2014 Jan 6.
156.	Loss of integrin alpha(v)beta6-mediated TGF-beta activation causes Mmp12-dependent emphysema.	Morris DG, etal., Nature 2003 Mar 13;422(6928):169-73.
157.	Reduced TGF-beta1 expression and its target genes in human insulinomas.	Nabokikh A, etal., Exp Clin Endocrinol Diabetes. 2007 Nov;115(10):674-82.
158.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
159.	Immunohistochemical expression of receptor-tyrosine kinase c-kit protein and TGF-beta1 in invasive ductal carcinoma of the pancreas.	Nio Y, etal., Anticancer Res. 2005 Sep-Oct;25(5):3523-9.
160.	Changes in TGF-beta receptors of rat hepatocytes during primary culture and liver regeneration: increased expression of TGF-beta receptors associated with increased sensitivity to TGF-beta-mediated growth inhibition.	Nishikawa Y, etal., J Cell Physiol. 1998 Sep;176(3):612-23.
161.	Zhonghua jie he he hu xi za zhi = Zhonghua jiehe he huxi zazhi = Chinese journal of tuberculosis and respiratory diseases	Niu RC, etal., Zhonghua Jie He He Hu Xi Za Zhi. 2007 Nov;30(11):851-6.
162.	Association of TGFB1 -509 C>T polymorphism with breast cancer: evidence from a meta-analysis involving 23,579 subjects.	Niu W, etal., Breast Cancer Res Treat. 2010 Nov;124(1):243-9. doi: 10.1007/s10549-010-0832-0. Epub 2010 Mar 16.
163.	Serum concentrations of transforming growth factor beta 1 in patients with psoriasis vulgaris.	Nockowski P, etal., Acta Dermatovenerol Croat. 2004;12(1):2-6.
164.	Vitamin D and calcium co-therapy mitigates pre-established cadmium nephropathy by regulating renal calcium homeostatic molecules and improving anti-oxidative and anti-inflammatory activities in rat.	Obaid AA, etal., J Trace Elem Med Biol. 2023 May 24;79:127221. doi: 10.1016/j.jtemb.2023.127221.
165.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
166.	The combination of Astragalus membranaceus extract and ligustrazine to improve the inflammation in rats with thrombolytic cerebral ischemia.	Pan R, etal., Int J Immunopathol Pharmacol. 2019 Jan-Dec;33:2058738419869055. doi: 10.1177/2058738419869055.
167.	Left ventricular filling abnormalities and obesity-associated hypertension: relationship with overproduction of circulating transforming growth factor beta1.	Parrinello G, etal., J Hum Hypertens. 2005 Jul;19(7):543-50.
168.	Transforming growth factor-beta 1 signaling regulates neuroinflammation and apoptosis in mild traumatic brain injury.	Patel RK, etal., Brain Behav Immun. 2017 Aug;64:244-258. doi: 10.1016/j.bbi.2017.04.012. Epub 2017 Apr 19.
169.	Cellular and molecular events associated with the bone-protecting activity of the noncalcemic vitamin D analog Ro-26-9228 in osteopenic rats.	Peleg S, etal., Endocrinology. 2002 May;143(5):1625-36.
170.	Effect of transforming growth factor beta-1 in endotoxin-induced uveitis.	Peng B, etal., Invest Ophthalmol Vis Sci. 1997 Jan;38(1):257-60.
171.	Synergistic heterozygosity for TGFbeta1 SNPs and BMPR2 mutations modulates the age at diagnosis and penetrance of familial pulmonary arterial hypertension.	Phillips JA 3rd, etal., Genet Med. 2008 May;10(5):359-65.
172.	Significant expression of endoglin (CD105), TGFbeta-1 and TGFbeta R-2 in the atherosclerotic aorta: an immunohistological study.	Piao M and Tokunaga O, J Atheroscler Thromb. 2006 Apr;13(2):82-9.
173.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
174.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
175.	Identification of transforming growth factor beta1-driven genetic programs of acute lung fibrosis.	Pulichino AM, etal., Am J Respir Cell Mol Biol. 2008 Sep;39(3):324-36. Epub 2008 Apr 10.
176.	cDNA cloning by PCR of rat transforming growth factor beta-1.	Qian SW, etal., Nucleic Acids Res 1990 May 25;18(10):3059.
177.	Altered growth factor expression in the aging penis: the Brown-Norway rat model.	Rajasekaran M, etal., J Androl 2002 May-Jun;23(3):393-9.
178.	Antioxidant and pro-oxidant effects of oil palm (Elaeis guineensis) leaves extract in experimental diabetic nephropathy: a duration-dependent outcome.	Rajavel V, etal., BMC Complement Altern Med. 2013 Sep 29;13(1):242.
179.	Steady state levels of transforming growth factor-beta1 and -beta2 mRNA and protein expression are elevated in colonic tumors in vivo irrespective of dietary lipids intervention.	Raju J, etal., Int J Cancer 2002 Aug 20;100(6):635-41.
180.	Obese state leads to elevated levels of TGF-beta and COX isoforms in platelets of Zucker rats.	Raju J, etal., Mol Cell Biochem. 2006 Mar;284(1-2):19-24. Epub 2006 Feb 14.
181.	Transforming growth factor-beta stimulates vascular endothelial growth factor production by folliculostellate pituitary cells.	Renner U, etal., Endocrinology 2002 Oct;143(10):3759-65.
182.	GOA pipeline	RGD automated data pipeline
183.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
184.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
185.	T-helper 2 cytokines, transforming growth factor beta1, and eosinophil products induce fibrogenesis and alter muscle motility in patients with eosinophilic esophagitis.	Rieder F, etal., Gastroenterology. 2014 May;146(5):1266-77.e1-9. doi: 10.1053/j.gastro.2014.01.051. Epub 2014 Jan 28.
186.	Prevalence of diabetes mellitus and correlation of urinary transforming growth factor-beta1 with blood hemoglobin A1C in the Atascosa Diabetes Study.	Riojas MA, etal., Ethn Dis. 2008 Spring;18(2 Suppl 2):S2-54-9.
187.	Heat shock protein 47 as indispensible participant in liver fibrosis: Possible protective effect of lactoferrin.	Rizk FH, etal., IUBMB Life. 2018 Aug;70(8):795-805. doi: 10.1002/iub.1884. Epub 2018 Aug 9.
188.	Transforming growth factor-beta1 induces collagen synthesis and accumulation via p38 mitogen-activated protein kinase (MAPK) pathway in cultured L(6)E(9) myoblasts.	Rodriguez-Barbero A, etal., FEBS Lett 2002 Feb 27;513(2-3):282-8.
189.	Mucosal Cytokine Profiles After Induction Therapy With Granulocyte/Monocyte Apheresis in New-onset Inflammatory Colitis.	Rolandsdotter H, etal., J Pediatr Gastroenterol Nutr. 2018 Apr;66(4):e103-e107. doi: 10.1097/MPG.0000000000001735.
190.	The -509 C/T genotype of TGFbeta1 might contribute to the pathogenesis of benign airway stenosis.	Rovo L, etal., Otolaryngol Head Neck Surg. 2010 Mar;142(3):441-3.
191.	Therapeutic Effects of Evasin-1, a Chemokine Binding Protein, in Bleomycin-Induced Pulmonary Fibrosis.	Russo RC, etal., Am J Respir Cell Mol Biol. 2010 Sep 10.
192.	Transforming growth factor- 1 C-509T polymorphism, oxidant stress, and early-onset childhood asthma.	Salam MT, etal., Am J Respir Crit Care Med. 2007 Dec 15;176(12):1192-9. Epub 2007 Aug 2.
193.	Increased urinary TGF-beta1 and cortical renal GLUT1 and GLUT2 levels: additive effects of hypertension and diabetes.	Schaan BD, etal., Nephron Physiol. 2005;100(3):p43-50. Epub 2005 Apr 25.
194.	Transforming growth factor beta1 and beta2 (TGFbeta2 / TGFbeta2) profile changes in previously irradiated free flap beds.	Schultze-Mosgau S, etal., Head Neck. 2002 Jan;24(1):33-41.
195.	Growth factors and interleukin-6 across the lung circulation in pulmonary hypertension.	Selimovic N, etal., Eur Respir J. 2009 Sep;34(3):662-8. Epub 2009 Mar 26.
196.	Activin-A induces regulatory T cells that suppress T helper cell immune responses and protect from allergic airway disease.	Semitekolou M, etal., J Exp Med. 2009 Aug 3;206(8):1769-85. Epub 2009 Jul 20.
197.	Alternative neural crest cell fates are instructively promoted by TGFbeta superfamily members.	Shah NM, etal., Cell. 1996 May 3;85(3):331-43.
198.	Association of interleukin-2, interleukin-4 and transforming growth factor-beta gene polymorphisms with Behcet's disease.	Shahram F, etal., Clin Exp Rheumatol. 2011 May 31.
199.	A dual role for TGF-beta1 in the control and persistence of fungal pneumonia.	Shao X, etal., J Immunol. 2005 Nov 15;175(10):6757-63.
200.	Paclitaxel alleviates liver fibrosis induced by bile duct ligation in rats: Role of TGF-β1, IL-10 and c-Myc.	Sharawy MH, etal., Life Sci. 2018 Oct 15;211:245-251. doi: 10.1016/j.lfs.2018.09.037. Epub 2018 Sep 20.
201.	Involvement of transforming growth factor-beta in regulation of calcium transients in diabetic vascular smooth muscle cells.	Sharma K, etal., Am J Physiol Renal Physiol 2003 Dec;285(6):F1258-70.
202.	TGF-beta impairs renal autoregulation via generation of ROS.	Sharma K, etal., Am J Physiol Renal Physiol. 2005 May;288(5):F1069-77. Epub 2005 Jan 11.
203.	Variants in TGFB1, dust mite exposure, and disease severity in children with asthma.	Sharma S, etal., Am J Respir Crit Care Med. 2009 Mar 1;179(5):356-62. Epub 2008 Dec 18.
204.	Janus Kinase 2 (JAK2) Dissociates Hepatosteatosis from Hepatocellular Carcinoma in Mice.	Shi SY, etal., J Biol Chem. 2017 Mar 3;292(9):3789-3799. doi: 10.1074/jbc.M116.752519. Epub 2017 Jan 18.
205.	Mechanistic investigation of immunosuppression in patients with condyloma acuminata.	Shi YJ, etal., Mol Med Rep. 2013 Aug;8(2):480-6. doi: 10.3892/mmr.2013.1511. Epub 2013 Jun 6.
206.	Effects of Omega-3 Fatty Acids on Erectile Dysfunction in a Rat Model of Atherosclerosis-induced Chronic Pelvic Ischemia.	Shim JS, etal., J Korean Med Sci. 2016 Apr;31(4):585-9. doi: 10.3346/jkms.2016.31.4.585. Epub 2016 Feb 22.
207.	Oncopreventive effects of theanine and theobromine on dimethylhydrazine-induced colon cancer model.	Shojaei-Zarghani S, etal., Biomed Pharmacother. 2021 Feb;134:111140. doi: 10.1016/j.biopha.2020.111140. Epub 2020 Dec 24.
208.	Association between Altered Expression and Genetic Variations of Transforming Growth Factor ß-Smad Pathway with Chronic Myeloid Leukemia.	Shokeen Y, etal., Int J Hematol Oncol Stem Cell Res. 2018 Jan 1;12(1):14-22.
209.	TGF-beta expression during rat pregnancy and activity on decidual cell survival.	Shooner C, etal., Reprod Biol Endocrinol. 2005 May 31;3:20.
210.	Transforming growth factor beta signaling impairs Neu-induced mammary tumorigenesis while promoting pulmonary metastasis.	Siegel PM, etal., Proc Natl Acad Sci U S A 2003 Jul 8;100(14):8430-5. Epub 2003 Jun 13.
211.	Transforming growth factor beta 1 promotes cell cycle exit through the cyclin-dependent kinase inhibitor p21 in the developing cerebral cortex.	Siegenthaler JA and Miller MW, J Neurosci. 2005 Sep 21;25(38):8627-36.
212.	Downregulation of transforming growth factor-beta2 facilitates inflammation in the central nervous system by reciprocal astrocyte/microglia interactions.	Siglienti I, etal., J Neuropathol Exp Neurol. 2007 Jan;66(1):47-56.
213.	Transforming growth factor-beta1 promoter polymorphism C-509T is associated with asthma.	Silverman ES, etal., Am J Respir Crit Care Med. 2004 Jan 15;169(2):214-9. Epub 2003 Nov 3.
214.	Effects of dexamethasone exposure on rat metanephric development: in vitro and in vivo studies.	Singh RR, etal., Am J Physiol Renal Physiol. 2007 Aug;293(2):F548-54. Epub 2007 May 30.
215.	Formononetin protects against balloon injury‑induced neointima formation in rats by regulating proliferation and migration of vascular smooth muscle cells via the TGF‑β1/Smad3 signaling pathway.	Song T, etal., Int J Mol Med. 2018 Oct;42(4):2155-2162. doi: 10.3892/ijmm.2018.3784. Epub 2018 Jul 18.
216.	Lesion-associated expression of transforming growth factor-beta-2 in the rat nervous system: evidence for down-regulating the phagocytic activity of microglia and macrophages.	Stoll G, etal., Brain Pathol. 2004 Jan;14(1):51-8.
217.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
218.	Expression of transforming growth factor-beta-inducible gene-h3 in normal and cyclosporine-treated rat kidney.	Sun BK, etal., J Lab Clin Med 2004 Mar;143(3):175-83.
219.	Localization of 54 rat genes, and definition of new synteny groups conserved in the human and the rat.	Szpirer C, etal., Mamm Genome 2000 Sep;11(9):729-35
220.	Long noncoding RNA H19 controls DUSP5/ERK1/2 axis in cardiac fibroblast proliferation and fibrosis.	Tao H, etal., Cardiovasc Pathol. 2016 Sep-Oct;25(5):381-9. doi: 10.1016/j.carpath.2016.05.005. Epub 2016 Jun 2.
221.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
222.	Transforming growth factor beta 1 is implicated in the failure of tamoxifen therapy in human breast cancer.	Thompson AM, etal., Br J Cancer. 1991 Apr;63(4):609-14.
223.	Transforming growth factor beta 1 as a biomarker for prostate cancer.	Thompson TC, etal., J Cell Biochem Suppl. 1992;16H:54-61.
224.	Reduced expression of dentin sialophosphoprotein is associated with dysplastic dentin in mice overexpressing transforming growth factor-beta 1 in teeth.	Thyagarajan T, etal., J Biol Chem 2001 Apr 6;276(14):11016-20. Epub 2000 Dec 14.
225.	[Influence of human bone marrow-derived mesenchymal stem cells on the lung of newborn rats damaged by hyperoxia]	Tian ZF, etal., Zhonghua Er Ke Za Zhi. 2008 Jan;46(1):4-8.
226.	Differential effects of transforming growth factor-beta1 on cellular proliferation in the developing prostate.	Tomlinson DC, etal., Endocrinology. 2004 Sep;145(9):4292-300. Epub 2004 Jun 10.
227.	Plasma levels of TGF-beta1 in homeostasis of the inflammation in sickle cell disease.	Torres Lde S, etal., Cytokine. 2016 Apr;80:18-25. doi: 10.1016/j.cyto.2016.02.012. Epub 2016 Feb 27.
228.	The potential role of TGFbeta1, TGFbeta2 and TGFbeta3 protein expression in colorectal carcinomas. Correlation with classic histopathologic factors and patient survival.	Tsamandas AC, etal., Strahlenther Onkol. 2004 Apr;180(4):201-8.
229.	Clinical significance of sCD105 in angiogenesis and disease activity in multiple myeloma.	Tsirakis G, etal., Eur J Intern Med. 2012 Jun;23(4):368-73. doi: 10.1016/j.ejim.2012.01.012. Epub 2012 Mar 3.
230.	T-cell regulation in chronic paranasal sinus disease.	Van Bruaene N, etal., J Allergy Clin Immunol. 2008 Jun;121(6):1435-41, 1441.e1-3.
231.	Proteoglycan expression in bleomycin lung fibroblasts: role of transforming growth factor-beta(1) and interferon-gamma.	Venkatesan N, etal., Am J Physiol Lung Cell Mol Physiol 2002 Oct;283(4):L806-14.
232.	Genetic susceptibility of epidermal growth factor +61A>G and transforming growth factor beta1 -509C>T gene polymorphisms with gallbladder cancer.	Vishnoi M, etal., Hum Immunol. 2008 Jun;69(6):360-7. Epub 2008 May 6.
233.	Mechanical stretch via transforming growth factor-beta1 activates microRNA-208a to regulate hypertrophy in cultured rat cardiac myocytes.	Wang BW, etal., J Formos Med Assoc. 2013 Oct;112(10):635-43. doi: 10.1016/j.jfma.2013.01.002. Epub 2013 Feb 4.
234.	[A preliminary study on the changes of expression of PDGF-beta, PDGFR-beta, TGF-beta 1, TGFR, bFGF and its relationship with the wound age in wound healing]	Wang HJ, etal., Fa Yi Xue Za Zhi. 2001 Nov;17(4):198-201, 204.
235.	Cloning and expression of glucocorticoid-induced genes in fetal rat lung fibroblasts. Transforming growth factor-beta 3.	Wang J, etal., J Biol Chem 1995 Feb 10;270(6):2722-8.
236.	Long Noncoding RNA H19 Promotes Neuroinflammation in Ischemic Stroke by Driving Histone Deacetylase 1-Dependent M1 Microglial Polarization.	Wang J, etal., Stroke. 2017 Aug;48(8):2211-2221. doi: 10.1161/STROKEAHA.117.017387. Epub 2017 Jun 19.
237.	The impact of 1,25-dihydroxyvitamin D3 on the expression of connective tissue growth factor and transforming growth factor-beta1 in the myocardium of rats with diabetes.	Wang L, etal., Diabetes Res Clin Pract. 2014 May;104(2):226-33. doi: 10.1016/j.diabres.2014.01.031. Epub 2014 Feb 14.
238.	Nitric oxide and cGMP-dependent protein kinase regulation of glucose-mediated thrombospondin 1-dependent transforming growth factor-beta activation in mesangial cells.	Wang S, etal., J Biol Chem 2002 Mar 22;277(12):9880-8. Epub 2002 Jan 9.
239.	Silencing CD36 gene expression results in the inhibition of latent-TGF-beta1 activation and suppression of silica-induced lung fibrosis in the rat.	Wang X, etal., Respir Res. 2009 May 13;10(1):36.
240.	[Effects of salvianolic acid B on expressions of TGF-beta1 and its receptors in liver of rats with dimethylnitrosamine-induced hepatic fibrosis]	Wang XN, etal., Zhong Xi Yi Jie He Xue Bao. 2005 Jul;3(4):286-9.
241.	Hepatoprotective effects of AdipoRon against d-galactosamine-induced liver injury in mice.	Wang Y, etal., Eur J Pharm Sci. 2016 Oct 10;93:123-31. doi: 10.1016/j.ejps.2016.08.017. Epub 2016 Aug 9.
242.	Inhibitory effects of tranilast on expression of transforming growth factor-beta isoforms and receptors in injured arteries.	Ward MR, etal., Atherosclerosis. 1998 Apr;137(2):267-75. doi: 10.1016/s0021-9150(97)00275-x.
243.	Treatment with cardiotonic pills(®) after ischemia-reperfusion ameliorates myocardial fibrosis in rats.	Wei XH, etal., Microcirculation. 2013 Jan;20(1):17-29. doi: 10.1111/micc.12002.
244.	Quantitative monitoring of the mRNA expression pattern of the TGF-beta-isoforms (beta 1, beta 2, beta 3) during transdifferentiation of hepatic stellate cells using a newly developed real-time SYBR Green PCR.	Wickert L, etal., Biochem Biophys Res Commun 2002 Jul 12;295(2):330-5.
245.	Cell-type-specific activation of PAK2 by transforming growth factor beta independent of Smad2 and Smad3.	Wilkes MC, etal., Mol Cell Biol. 2003 Dec;23(23):8878-89.
246.	Antigen presentation by vaginal cells: role of TGFbeta as a mediator of estradiol inhibition of antigen presentation.	Wira CR, etal., Endocrinology 2002 Aug;143(8):2872-9.
247.	Polymorphism of the TGFB1 gene is not associated with bronchial allergic asthma in a Polish population.	Wisniewski A, etal., Hum Immunol. 2009 Feb;70(2):134-8. Epub 2009 Jan 9.
248.	Existence of a regulatory loop between MCP-1 and TGF-beta in glomerular immune injury.	Wolf G, etal., Am J Physiol Renal Physiol 2002 Nov;283(5):F1075-84.
249.	Renoprotective effects of carvedilol in hypertensive-stroke prone rats may involve inhibition of TGF beta expression.	Wong VY, etal., Br J Pharmacol. 2001 Nov;134(5):977-84. doi: 10.1038/sj.bjp.0704329.
250.	Expression of TGF beta1 genes and their receptor types I, II, and III in low- and high-grade malignancy non-Hodgkin's lymphomas.	Woszczyk D, etal., Med Sci Monit. 2004 Jan;10(1):CR33-7.
251.	Plasma transforming growth factor-beta1 level in patients with severe community-acquired pneumonia and association with disease severity.	Wu HP, etal., J Formos Med Assoc. 2009 Jan;108(1):20-7.
252.	TGF-beta1 promotes microglial amyloid-beta clearance and reduces plaque burden in transgenic mice.	Wyss-Coray T, etal., Nat Med 2001 May;7(5):612-8.
253.	Simvastatin ameliorates ventricular remodeling via the TGFbeta1 signaling pathway in rats following myocardial infarction.	Xiao X, etal., Mol Med Rep. 2016 Apr 25. doi: 10.3892/mmr.2016.5178.
254.	Effect of prenatal tetrandrine administration on transforming growth factor-beta1 level in the lung of nitrofen-induced congenital diaphragmatic hernia rat model.	Xu C, etal., J Pediatr Surg. 2009 Aug;44(8):1611-20.
255.	TGF-beta signaling alterations and susceptibility to colorectal cancer.	Xu Y and Pasche B, Hum Mol Genet. 2007 Apr 15;16 Spec No 1:R14-20.
256.	Release of biologically active TGF-beta1 by alveolar epithelial cells results in pulmonary fibrosis.	Xu YD, etal., Am J Physiol Lung Cell Mol Physiol. 2003 Sep;285(3):L527-39. Epub 2003 Feb 21.
257.	Biologic Evaluation of Diabetes and Local Recurrence in Non-Small Cell Lung Cancer.	Yang X, etal., Pathol Oncol Res. 2017 Jan;23(1):73-77. doi: 10.1007/s12253-016-0086-1. Epub 2016 Jul 13.
258.	Activation of rat alveolar macrophage-derived latent transforming growth factor beta-1 by plasmin requires interaction with thrombospondin-1 and its cell surface receptor, CD36.	Yehualaeshet T, etal., Am J Pathol. 1999 Sep;155(3):841-51.
259.	Increased plasma levels of cystatin C and transforming growth factor-beta1 in patients with coronary artery ectasia: can there be a potential interaction between cystatin C and transforming growth factor-beta1.	Yetkin E, etal., Coron Artery Dis. 2007 May;18(3):211-4.
260.	Indole-3-propionic acid suppresses indoxyl sulfate-induced expression of fibrotic and inflammatory genes in proximal tubular cells.	Yisireyili M, etal., Nagoya J Med Sci. 2017 Nov;79(4):477-486. doi: 10.18999/nagjms.79.4.477.
261.	Role of TGF-beta1 in the development of pancreatic fibrosis in Otsuka Long-Evans Tokushima Fatty rats.	Yoshikawa H, etal., Am J Physiol Gastrointest Liver Physiol 2002 Mar;282(3):G549-58.
262.	Single nucleotide polymorphism at rs1982073:T869C of the TGFbeta 1 gene is associated with the risk of radiation pneumonitis in patients with non-small-cell lung cancer treated with definitive radiotherapy.	Yuan X, etal., J Clin Oncol. 2009 Jul 10;27(20):3370-8. Epub 2009 Apr 20.
263.	[Expression of Smad4 and transforming growth factor-beta1, transforming growth factor-beta receptor II in cholangiocarcinoma tissue and its biological significance]	Zhang BY, etal., Zhonghua Wai Ke Za Zhi. 2005 Jul 1;43(13):846-9.
264.	Regulation of FLRG expression in rat primary astroglial cells and injured brain tissue by transforming growth factor-beta 1 (TGF-beta 1).	Zhang G, etal., J Neurosci Res 2003 Apr 1;72(1):33-45.
265.	Lefty-1 inhibits renal epithelial-mesenchymal transition by antagonizing the TGF-β/Smad signaling pathway.	Zhang L, etal., J Mol Histol. 2020 Feb;51(1):77-87. doi: 10.1007/s10735-020-09859-8. Epub 2020 Feb 17.
266.	Role of increased penile expression of transforming growth factor-beta1 and activation of the Smad signaling pathway in erectile dysfunction in streptozotocin-induced diabetic rats.	Zhang LW, etal., J Sex Med. 2008 Oct;5(10):2318-29. Epub 2008 Sep 5.
267.	Potassium channel changes of peripheral blood T-lymphocytes from Kazakh hypertensive patients in Northwest China and the inhibition effect towards potassium channels by telmisartan.	Zhang Q, etal., Kardiol Pol. 2016;74(5):476-488. doi: 10.5603/KP.a2015.0210. Epub 2015 Oct 27.
268.	Acute Effects of Transforming Growth Factor-β1 on Neuronal Excitability and Involvement in the Pain of Rats with Chronic Pancreatitis.	Zhang X, etal., J Neurogastroenterol Motil. 2016 Apr 30;22(2):333-43. doi: 10.5056/jnm15127.
269.	Analysis of serum cytokines in patients with severe acute respiratory syndrome.	Zhang Y, etal., Infect Immun. 2004 Aug;72(8):4410-5. doi: 10.1128/IAI.72.8.4410-4415.2004.
270.	Effects of aging on growth factors gene and protein expression in the dorsal and ventral lobes of rat prostate.	Zhao H, etal., Biochem Biophys Res Commun 2002 Mar 29;292(2):482-91.
271.	Transforming growth factor-beta(s) and their receptors in aging rat prostate.	Zhao H, etal., Biochem Biophys Res Commun. 2002 Jun 7;294(2):464-9.
272.	Reduced MIR130A is involved in primary immune thrombocytopenia via targeting TGFB1 and IL18.	Zhao H, etal., Br J Haematol. 2014 Sep;166(5):767-73. doi: 10.1111/bjh.12934. Epub 2014 May 7.
273.	Velvet Antler Peptide Prevents Pressure Overload-induced Cardiac Fibrosis via Transforming Growth Factor (TGF)-beta1 Pathway inhibition.	Zhao L, etal., Eur J Pharmacol. 2016 Apr 21. pii: S0014-2999(16)30260-6. doi: 10.1016/j.ejphar.2016.04.039.
274.	Indoleamine 2,3-dioxygenase 1 deficiency attenuates CCl4-induced fibrosis through Th17 cells down-regulation and tryptophan 2,3-dioxygenase compensation.	Zhong W, etal., Oncotarget. 2017 Jun 20;8(25):40486-40500. doi: 10.18632/oncotarget.17119.
275.	Açaí (Euterpe oleracea Mart.) attenuates alcohol-induced liver injury in rats by alleviating oxidative stress and inflammatory response.	Zhou J, etal., Exp Ther Med. 2018 Jan;15(1):166-172. doi: 10.3892/etm.2017.5427. Epub 2017 Nov 1.
276.	High expression of IDO1 and TGF-β1 during recurrence and post infection clearance with Chlamydia trachomatis, are independent of host IFN-γ response.	Ziklo N, etal., BMC Infect Dis. 2019 Mar 4;19(1):218. doi: 10.1186/s12879-019-3843-4.
277.	Characterization of the TGF-beta1 signaling abnormalities in the Gata1low mouse model of myelofibrosis.	Zingariello M, etal., Blood. 2013 Apr 25;121(17):3345-63. doi: 10.1182/blood-2012-06-439661. Epub 2013 Mar 5.
278.	Transforming growth factor beta 1 induces cachexia and systemic fibrosis without an antitumor effect in nude mice.	Zugmaier G, etal., Cancer Res. 1991 Jul 1;51(13):3590-4.

Additional References at PubMed

PMID:1333888	PMID:1436033	PMID:1821856	PMID:2070682	PMID:2209468	PMID:3470709	PMID:7600998	PMID:7848824	PMID:8009224	PMID:8053900	PMID:8167376	PMID:8421714
PMID:9008713	PMID:9389648	PMID:9757003	PMID:9770491	PMID:9921650	PMID:9950587	PMID:10092230	PMID:10513816	PMID:10885742	PMID:11157754	PMID:11158066	PMID:11502704
PMID:11711431	PMID:11799106	PMID:11906205	PMID:11961311	PMID:12021073	PMID:12199527	PMID:12208849	PMID:12484516	PMID:12496370	PMID:12538588	PMID:12646048	PMID:12646629
PMID:12697724	PMID:12704789	PMID:12712323	PMID:12730080	PMID:12773577	PMID:12794007	PMID:12806594	PMID:12837295	PMID:12865256	PMID:12867422	PMID:12876289	PMID:12893825
PMID:12937160	PMID:12970361	PMID:12971963	PMID:14514686	PMID:14517293	PMID:14555988	PMID:14575307	PMID:14575314	PMID:14623275	PMID:14623893	PMID:14633629	PMID:14633705
PMID:14656760	PMID:14670985	PMID:14697288	PMID:14708940	PMID:14717916	PMID:14726452	PMID:14960316	PMID:14967845	PMID:14988498	PMID:15019289	PMID:15040835	PMID:15047629
PMID:15100250	PMID:15153551	PMID:15184388	PMID:15187003	PMID:15201552	PMID:15219857	PMID:15222754	PMID:15248184	PMID:15251335	PMID:15253713	PMID:15282343	PMID:15316360
PMID:15334054	PMID:15334678	PMID:15450206	PMID:15451575	PMID:15489334	PMID:15492480	PMID:15550525	PMID:15604101	PMID:15604136	PMID:15652405	PMID:15657445	PMID:15677311
PMID:15677465	PMID:15702480	PMID:15808558	PMID:15820682	PMID:15964416	PMID:15990875	PMID:15993878	PMID:15994428	PMID:16005428	PMID:16019429	PMID:16020542	PMID:16097048
PMID:16103255	PMID:16105028	PMID:16115393	PMID:16115399	PMID:16146787	PMID:16182431	PMID:16183734	PMID:16246848	PMID:16362724	PMID:16371439	PMID:16380081	PMID:16449286
PMID:16458528	PMID:16473861	PMID:16546826	PMID:16549155	PMID:16549518	PMID:16685417	PMID:16690877	PMID:16754747	PMID:16770245	PMID:16778334	PMID:16778384	PMID:16785237
PMID:16816361	PMID:16935907	PMID:16941024	PMID:16943770	PMID:16944045	PMID:17068209	PMID:17133352	PMID:17158884	PMID:17203207	PMID:17206447	PMID:17215516	PMID:17293613
PMID:17324121	PMID:17335076	PMID:17374997	PMID:17379848	PMID:17392319	PMID:17396111	PMID:17401695	PMID:17406824	PMID:17438144	PMID:17481928	PMID:17485851	PMID:17530031
PMID:17541159	PMID:17568773	PMID:17625791	PMID:17629588	PMID:17629604	PMID:17640965	PMID:17664181	PMID:17669238	PMID:17692821	PMID:17721978	PMID:17723189	PMID:17725545
PMID:17763394	PMID:17765135	PMID:17878231	PMID:17898001	PMID:17916675	PMID:17928287	PMID:17933714	PMID:17938236	PMID:17951031	PMID:17982486	PMID:17999987	PMID:18039789
PMID:18040277	PMID:18057996	PMID:18071753	PMID:18080134	PMID:18086923	PMID:18090228	PMID:18095586	PMID:18171523	PMID:18184458	PMID:18189272	PMID:18212064	PMID:18256274
PMID:18266973	PMID:18274641	PMID:18283107	PMID:18300271	PMID:18341643	PMID:18354256	PMID:18356065	PMID:18367662	PMID:18368049	PMID:18375249	PMID:18389287	PMID:18395914
PMID:18422491	PMID:18428026	PMID:18453574	PMID:18471258	PMID:18472332	PMID:18498113	PMID:18505915	PMID:18538673	PMID:18548003	PMID:18552272	PMID:18555217	PMID:18581202
PMID:18588859	PMID:18593713	PMID:18597229	PMID:18611337	PMID:18611343	PMID:18614704	PMID:18625725	PMID:18633183	PMID:18679024	PMID:18687224	PMID:18695043	PMID:18705752
PMID:18722097	PMID:18727865	PMID:18753609	PMID:18758225	PMID:18782534	PMID:18783370	PMID:18790002	PMID:18794329	PMID:18832382	PMID:18835815	PMID:18846337	PMID:18941241
PMID:18955796	PMID:18983774	PMID:18997793	PMID:19003557	PMID:19023196	PMID:19029909	PMID:19041694	PMID:19056892	PMID:19061498	PMID:19069655	PMID:19098300	PMID:19129258
PMID:19143766	PMID:19153267	PMID:19161227	PMID:19172096	PMID:19194552	PMID:19197123	PMID:19200954	PMID:19204403	PMID:19207862	PMID:19218122	PMID:19272247	PMID:19291685
PMID:19304912	PMID:19323784	PMID:19342372	PMID:19342445	PMID:19349682	PMID:19357233	PMID:19366691	PMID:19374881	PMID:19407952	PMID:19426591	PMID:19457680	PMID:19501566
PMID:19525370	PMID:19570397	PMID:19578009	PMID:19605630	PMID:19645615	PMID:19656380	PMID:19663807	PMID:19668241	PMID:19696167	PMID:19734317	PMID:19736306	PMID:19737467
PMID:19744530	PMID:19785951	PMID:19788071	PMID:19874817	PMID:19913496	PMID:19926889	PMID:19959709	PMID:20034899	PMID:20039536	PMID:20065510	PMID:20067797	PMID:20089379
PMID:20104486	PMID:20134202	PMID:20180418	PMID:20182310	PMID:20211260	PMID:20215829	PMID:20221422	PMID:20226149	PMID:20335535	PMID:20375011	PMID:20380796	PMID:20386537
PMID:20404057	PMID:20417179	PMID:20424484	PMID:20432467	PMID:20463011	PMID:20472273	PMID:20498031	PMID:20501701	PMID:20507850	PMID:20547156	PMID:20573232	PMID:20576680
PMID:20600816	PMID:20608350	PMID:20613497	PMID:20619281	PMID:20640990	PMID:20653032	PMID:20653044	PMID:20676968	PMID:20684325	PMID:20697373	PMID:20860549	PMID:20873545
PMID:20874717	PMID:20875417	PMID:20878350	PMID:20926802	PMID:20930066	PMID:20938722	PMID:20952728	PMID:20972576	PMID:20977838	PMID:21038676	PMID:21144460	PMID:21147091
PMID:21158157	PMID:21168935	PMID:21192306	PMID:21209102	PMID:21245329	PMID:21245484	PMID:21262769	PMID:21336728	PMID:21354908	PMID:21367774	PMID:21390327	PMID:21412780
PMID:21429339	PMID:21471198	PMID:21505983	PMID:21509626	PMID:21560355	PMID:21567395	PMID:21605584	PMID:21664439	PMID:21674130	PMID:21677751	PMID:21690069	PMID:21718540
PMID:21739215	PMID:21791611	PMID:21791914	PMID:21841309	PMID:21850315	PMID:21859884	PMID:21868333	PMID:21895415	PMID:21911934	PMID:21931759	PMID:21941776	PMID:21956870
PMID:21958301	PMID:21984612	PMID:21996044	PMID:22013804	PMID:22020089	PMID:22031849	PMID:22035631	PMID:22041779	PMID:22057676	PMID:22073128	PMID:22094034	PMID:22095944
PMID:22097314	PMID:22165288	PMID:22166643	PMID:22172122	PMID:22252490	PMID:22258325	PMID:22269326	PMID:22270542	PMID:22285838	PMID:22332556	PMID:22338217	PMID:22371337
PMID:22384127	PMID:22384214	PMID:22447946	PMID:22451679	PMID:22483454	PMID:22516433	PMID:22551312	PMID:22579701	PMID:22579999	PMID:22613868	PMID:22661380	PMID:22684563
PMID:22706027	PMID:22714676	PMID:22718393	PMID:22734808	PMID:22735812	PMID:22790384	PMID:22835458	PMID:22851187	PMID:22875344	PMID:22899499	PMID:22911900	PMID:22949406
PMID:22964152	PMID:23006535	PMID:23009856	PMID:23044204	PMID:23085271	PMID:23089551	PMID:23091366	PMID:23099153	PMID:23110133	PMID:23174757	PMID:23193663	PMID:23270462
PMID:23271281	PMID:23275087	PMID:23291610	PMID:23306843	PMID:23338707	PMID:23359369	PMID:23403244	PMID:23416528	PMID:23430124	PMID:23471555	PMID:23486522	PMID:23524565
PMID:23528014	PMID:23547562	PMID:23560091	PMID:23592137	PMID:23832727	PMID:23861879	PMID:23868260	PMID:23871832	PMID:23937416	PMID:23970162	PMID:23979707	PMID:23990681
PMID:24036265	PMID:24038377	PMID:24103556	PMID:24157151	PMID:24246300	PMID:24290447	PMID:24311432	PMID:24329763	PMID:24338227	PMID:24344329	PMID:24356887	PMID:24379181
PMID:24461183	PMID:24474615	PMID:24489578	PMID:24530353	PMID:24573206	PMID:24586048	PMID:24591339	PMID:24601883	PMID:24610459	PMID:24634122	PMID:24659892	PMID:24665937
PMID:24718260	PMID:24721794	PMID:24840640	PMID:25010983	PMID:25031710	PMID:25040634	PMID:25063067	PMID:25065622	PMID:25078775	PMID:25093615	PMID:25100282	PMID:25150141
PMID:25163461	PMID:25178280	PMID:25185755	PMID:25192797	PMID:25245272	PMID:25310401	PMID:25322725	PMID:25348957	PMID:25359088	PMID:25375034	PMID:25393149	PMID:25422985
PMID:25446187	PMID:25446530	PMID:25451261	PMID:25451291	PMID:25491150	PMID:25514442	PMID:25538336	PMID:25560248	PMID:25561788	PMID:25633415	PMID:25715398	PMID:25715833
PMID:25736907	PMID:25740471	PMID:25787292	PMID:25788532	PMID:25857705	PMID:25884585	PMID:25893292	PMID:25923922	PMID:25960249	PMID:25967237	PMID:26016731	PMID:26026059
PMID:26045739	PMID:26075533	PMID:26082460	PMID:26097534	PMID:26125699	PMID:26169693	PMID:26187065	PMID:26253398	PMID:26256678	PMID:26279426	PMID:26311719	PMID:26340021
PMID:26341460	PMID:26373045	PMID:26405299	PMID:26493107	PMID:26518453	PMID:26535698	PMID:26566727	PMID:26568079	PMID:26617694	PMID:26617806	PMID:26634652	PMID:26637070
PMID:26680767	PMID:26687115	PMID:26722423	PMID:26728369	PMID:26729053	PMID:26751072	PMID:26781185	PMID:26788514	PMID:26825317	PMID:26858265	PMID:26869361	PMID:26872211
PMID:26898453	PMID:26928632	PMID:26934489	PMID:26945889	PMID:26946943	PMID:26954391	PMID:27031437	PMID:27053343	PMID:27072267	PMID:27109695	PMID:27162619	PMID:27217701
PMID:27247942	PMID:27279449	PMID:27282665	PMID:27297622	PMID:27333806	PMID:27340942	PMID:27345362	PMID:27348628	PMID:27364974	PMID:27379382	PMID:27470217	PMID:27485077
PMID:27486809	PMID:27492484	PMID:27530924	PMID:27566082	PMID:27567557	PMID:27579669	PMID:27618520	PMID:27633115	PMID:27633729	PMID:27665369	PMID:27693081	PMID:27703278
PMID:27714812	PMID:27736730	PMID:27756197	PMID:27840939	PMID:27885436	PMID:27927626	PMID:28000380	PMID:28009003	PMID:28039055	PMID:28063381	PMID:28077319	PMID:28091942
PMID:28092863	PMID:28125630	PMID:28162229	PMID:28193525	PMID:28220578	PMID:28281184	PMID:28303407	PMID:28322466	PMID:28338461	PMID:28350874	PMID:28399671	PMID:28539652
PMID:28552397	PMID:28566504	PMID:28584818	PMID:28647476	PMID:28658504	PMID:28673338	PMID:28679591	PMID:28688765	PMID:28713909	PMID:28719898	PMID:28737766	PMID:28817810
PMID:28821620	PMID:28823370	PMID:28837849	PMID:28848997	PMID:28849131	PMID:28943431	PMID:29069575	PMID:29102631	PMID:29104873	PMID:29166374	PMID:29167509	PMID:29200096
PMID:29215720	PMID:29233682	PMID:29237506	PMID:29334566	PMID:29366910	PMID:29397070	PMID:29402324	PMID:29424488	PMID:29529050	PMID:29537200	PMID:29650971	PMID:29687863
PMID:29704604	PMID:29746862	PMID:29859189	PMID:29909984	PMID:29921370	PMID:29941815	PMID:30070388	PMID:30132829	PMID:30260287	PMID:30307981	PMID:30317638	PMID:30418079
PMID:30468668	PMID:30549198	PMID:30711634	PMID:30894415	PMID:30938133	PMID:31078269	PMID:31173168	PMID:31240740	PMID:31247293	PMID:31346987	PMID:31405564	PMID:31411795
PMID:31434608	PMID:31486510	PMID:31527065	PMID:31576777	PMID:31646592	PMID:31729530	PMID:31766450	PMID:31781338	PMID:31960436	PMID:31975615	PMID:32004504	PMID:32093382
PMID:32096184	PMID:32097614	PMID:32160810	PMID:32169420	PMID:32258113	PMID:32274619	PMID:32389801	PMID:32416687	PMID:32432762	PMID:32602585	PMID:32633389	PMID:32741046
PMID:32881898	PMID:32951332	PMID:32965022	PMID:32980902	PMID:33040788	PMID:33098519	PMID:33160814	PMID:33236148	PMID:33243628	PMID:33441166	PMID:33441835	PMID:33448318
PMID:33469184	PMID:33577025	PMID:33577033	PMID:33754025	PMID:33760134	PMID:33760143	PMID:33771655	PMID:33867340	PMID:33940568	PMID:33992834	PMID:33994866	PMID:34116735
PMID:34137693	PMID:34175710	PMID:34492249	PMID:34533647	PMID:34665902	PMID:34696976	PMID:34834085	PMID:34929632	PMID:34938805	PMID:35139422	PMID:35167998	PMID:35232222
PMID:36319684	PMID:36413536	PMID:36495519	PMID:36542225	PMID:36589821	PMID:36631456	PMID:36857632	PMID:36919130	PMID:37030120	PMID:37172885	PMID:37370156	PMID:37389959
PMID:37433223	PMID:38122948	PMID:38781757	PMID:39168432

Genomics

Comparative Map Data

Tgfb1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	90,324,312 - 90,340,627 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	90,324,046 - 90,340,899 (+)	Ensembl				GRCr8
mRatBN7.2	1	81,196,532 - 81,212,848 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	81,196,532 - 81,212,847 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	86,588,717 - 86,605,032 (+)	NCBI	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	95,140,207 - 95,156,569 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	88,344,513 - 88,360,828 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0
Dahl_SR_JrHsd	1	88,944,249 - 88,960,564 (+)	NCBI
Lyon_Normotensive	1	94,081,083 - 94,097,398 (+)	NCBI
Lyon_Hypertensive	1	90,624,611 - 90,640,951 (+)	NCBI
F344_StmMcwi	1	89,069,578 - 89,085,893 (+)	NCBI
Rnor_6.0	1	82,480,875 - 82,497,196 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	82,480,195 - 82,497,199 (+)	Ensembl		Rnor_6.0 Ensembl	rn6	Rnor6.0
Rnor_5.0	1	83,742,151 - 83,758,472 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	80,894,705 - 80,911,020 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	75,636,001 - 75,652,315 (+)	NCBI		Celera
RGSC_v3.1	1	80,972,549 - 80,988,992 (+)	NCBI
Cytogenetic Map	1	q21	NCBI

TGFB1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	41,330,323 - 41,353,922 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	41,288,203 - 41,353,961 (-)	Ensembl		GRCh38.p14 Ensembl	hg38	GRCh38
GRCh37	19	41,836,228 - 41,859,827 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	46,528,491 - 46,551,656 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	19	46,528,658 - 46,551,158	NCBI
Celera	19	38,636,964 - 38,659,992 (-)	NCBI		Celera
Cytogenetic Map	19	q13.2	NCBI
HuRef	19	38,268,902 - 38,291,920 (-)	NCBI		HuRef
CHM1_1	19	41,836,504 - 41,859,495 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	19	44,151,181 - 44,174,790 (-)	NCBI		T2T-CHM13v2.0

Tgfb1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	25,386,406 - 25,404,503 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	25,386,390 - 25,404,506 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	7	25,687,002 - 25,705,077 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	25,687,002 - 25,705,077 (+)	Ensembl		GRCm38.p6 Ensembl	mm10	GRCm38
MGSCv37	7	26,472,021 - 26,490,015 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	7	25,395,762 - 25,413,756 (+)	NCBI		MGSCv36	mm8
Celera	7	20,295,914 - 20,313,908 (+)	NCBI		Celera
Cytogenetic Map	7	A3	NCBI
cM Map	7	13.98	NCBI

Tgfb1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955555	270,652 - 288,441 (-)	Ensembl		ChiLan1.0 Ensembl
ChiLan1.0	NW_004955555	274,405 - 288,441 (-)	NCBI	ChiLan1.0	ChiLan1.0

TGFB1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	47,541,048 - 47,564,105 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	49,409,816 - 49,432,810 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	38,324,009 - 38,347,003 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	46,831,659 - 46,852,973 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	46,831,659 - 46,852,973 (-)	Ensembl		PanPan1.1 Ensembl	panPan2	panpan1.1

B9D2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	112,621,832 - 112,627,726 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	112,621,633 - 112,643,885 (+)	Ensembl		CanFam3.1 Ensembl	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	112,025,951 - 112,032,055 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	113,219,930 - 113,226,035 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	113,219,701 - 113,241,694 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	112,781,179 - 112,787,278 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	112,413,522 - 112,419,614 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	113,406,803 - 113,412,909 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Tgfb1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mIctTri1.hap1	15	12,907,006 - 12,923,496 (+)	NCBI		mIctTri1.hap1
HiC_Itri_2	NW_024409349	15,314,010 - 15,330,197 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936661	3,742,066 - 3,758,272 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936661	3,742,080 - 3,758,266 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TGFB1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	49,332,173 - 49,349,046 (-)	Ensembl		Sscrofa11.1 Ensembl	susScr11	Sscrofa11.1
Sscrofa11.1	6	49,332,169 - 49,348,642 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	45,127,027 - 45,141,968 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3
Pig Cytomap	6	q11-q21	NCBI

TGFB1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mChlSab1.0.hap1	6	17,992,673 - 18,014,689 (+)	NCBI		mChlSab1.0.hap1
Vero_WHO_p1.0	NW_023666073	13,886,646 - 13,908,666 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0
ChlSab1.1	6	35,651,583 - 35,674,387 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	35,648,677 - 35,674,365 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM

Tgfb1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624907	162,567 - 175,696 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2
HetGla_female_1.0 Ensembl	NW_004624907	161,569 - 176,605 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
Naked mole-rat maternal Ensembl	29	5,685,360 - 5,702,475 (+)	Ensembl

Tgfb1
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	2	169,090,515 - 169,108,146 (-)	NCBI	Rrattus_CSIRO_v1	Rrattus_CSIRO_v1

Variants

Variants in Tgfb1
192 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	59
Count of miRNA genes:	50
Interacting mature miRNAs:	59
Transcripts:	ENSRNOT00000028051
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578649	Bmd8	Bone mineral density QTL 8	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	1	51940904	101229020	Rat
1582234	Gluco18	Glucose level QTL 18	3.4	0.0003	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	87889942	132889942	Rat
1358359	Sradr1	Stress Responsive Adrenal Weight QTL 1	4.74		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	39728272	132889942	Rat
4889929	Bss87	Bone structure and strength QTL 87	6.7		tibia area (VT:1000281)	tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722)	1	46302615	91302615	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	51941022	208479811	Rat
2313062	Bmd73	Bone mineral density QTL 73	3.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	46302615	91302615	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	51940904	168768703	Rat
2313065	Bss67	Bone structure and strength QTL 67	3.1	0.0001	tibia area (VT:1000281)	tibia total energy absorbed before break (CMO:0001736)	1	46302615	91302615	Rat
1331800	Scl25	Serum cholesterol level QTL 25	3.013		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	1	87785026	142582336	Rat
7421628	Bp361	Blood pressure QTL 361		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	83019780	128019780	Rat
2313069	Bss68	Bone structure and strength QTL 68	2.9	0.0001	tibia size trait (VT:0100001)	tibia total energy absorbed before break (CMO:0001736)	1	46302615	91302615	Rat
631495	Bp96	Blood pressure QTL 96	4.52		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	66404680	111404680	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	34184556	172281316	Rat
2313075	Bss66	Bone structure and strength QTL 66	3.4	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	46302615	91302615	Rat
631512	Scl6	Serum cholesterol level QTL 6	9.6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	1	81269860	99645535	Rat
2298545	Neuinf8	Neuroinflammation QTL 8	4.6		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	1	66009857	160501508	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	34565911	208798288	Rat
2313077	Bss69	Bone structure and strength QTL 69	3.5	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	46302615	91302615	Rat
1302788	Scl19	Serum cholesterol QTL 19	4.6	0.001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	66400974	132889942	Rat
1549903	Bp267	Blood pressure QTL 267			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	84107164	115183752	Rat
2313402	Anxrr24	Anxiety related response QTL 24			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	1	51511344	153680016	Rat
61342	Bp27	Blood pressure QTL 27	3.4	0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	65405637	96805205	Rat
4889962	Bss94	Bone structure and strength QTL 94	3.8		tibia area (VT:1000281)	tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722)	1	51909206	91302615	Rat
1358192	Ept13	Estrogen-induced pituitary tumorigenesis QTL 13	3.4		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	1	86622262	131622262	Rat
6903308	Scl36	Serum cholesterol QTL 36	2	0.0125	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	58769992	103769992	Rat
2313092	Bmd72	Bone mineral density QTL 72	2.5	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	46302615	91302615	Rat
2300164	Bmd44	Bone mineral density QTL 44	5.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	1	66077886	111077886	Rat
2313097	Bss70	Bone structure and strength QTL 70	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	46302615	91302615	Rat
152025249	Scl82	Serum cholesterol level QTL 82	4.77		blood cholesterol amount (VT:0000180)		1	52891222	109116986	Rat
10054135	Gmadr2	Adrenal mass QTL 2	1.97	0.0129	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	86993904	131993904	Rat
7411712	Strs4	Sensitivity to stroke QTL 4	8.7		cerebrum integrity trait (VT:0010549)	percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932)	1	87558587	132558587	Rat
4889919	Bss86	Bone structure and strength QTL 86	4.1		tibia area (VT:1000281)	tibia midshaft total cross-sectional area (CMO:0001715)	1	46302615	91302615	Rat

Markers in Region

PMC307658P1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	81,196,768 - 81,196,853 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	82,481,112 - 82,481,196	NCBI	Rnor6.0
Rnor_5.0	1	83,742,388 - 83,742,472	UniSTS	Rnor5.0
RGSC_v3.4	1	80,894,942 - 80,895,026	UniSTS	RGSC3.4
Celera	1	75,636,238 - 75,636,322	UniSTS
Cytogenetic Map	1	q22	UniSTS

RH139885

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	81,194,907 - 81,195,093 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	82,479,244 - 82,479,429	NCBI	Rnor6.0
Rnor_5.0	1	83,740,753 - 83,740,938	UniSTS	Rnor5.0
Celera	1	75,634,392 - 75,634,577	UniSTS
RH 3.4 Map	1	826.0	UniSTS
Cytogenetic Map	1	q22	UniSTS
Cytogenetic Map	1	q21	UniSTS

Tgfb1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	1	90,339,729 - 90,340,475 (+)	Marker Load Pipeline
mRatBN7.2	1	81,211,950 - 81,212,696 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	82,496,299 - 82,497,044	NCBI	Rnor6.0
Rnor_5.0	1	83,757,575 - 83,758,320	UniSTS	Rnor5.0
RGSC_v3.4	1	80,910,123 - 80,910,868	UniSTS	RGSC3.4
Celera	1	75,651,418 - 75,652,163	UniSTS
Cytogenetic Map	1	q22	UniSTS

UniSTS:498452

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	81,196,799 - 81,196,862 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	82,481,143 - 82,481,205	NCBI	Rnor6.0
Rnor_5.0	1	83,742,419 - 83,742,481	UniSTS	Rnor5.0
RGSC_v3.4	1	80,894,973 - 80,895,035	UniSTS	RGSC3.4
Celera	1	75,636,269 - 75,636,331	UniSTS
Cytogenetic Map	1	q22	UniSTS

Genetic Models

This gene Tgfb1 is modified in the following models/strains:

SS-Tgfb1^em3Mcwi SS-Tgfb1^em1Mcwi

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

adipose tissue	alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	entire extraembryonic component	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	pharyngeal arch	renal system	reproductive system	respiratory system	sensory system	visual system
254	156	730	1591	3992	959	1674	131	822	494	804	156	5278	2593	448	3905	38	1329	738	907	159	157

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_021578	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF105069	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY550025	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC076380	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473979	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X52498	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000028051 ⟹ ENSRNOP00000028051

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	90,324,312 - 90,340,626 (+)	Ensembl
mRatBN7.2 Ensembl	1	81,196,532 - 81,212,847 (+)	Ensembl
Rnor_6.0 Ensembl	1	82,480,195 - 82,497,199 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000168943 ⟹ ENSRNOP00000112428

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	90,324,046 - 90,340,899 (+)	Ensembl

RefSeq Acc Id:

NM_021578 ⟹ NP_067589

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	90,324,312 - 90,340,627 (+)	NCBI
mRatBN7.2	1	81,196,532 - 81,212,848 (+)	NCBI
Dahl_SR_JrHsd	1	88,944,249 - 88,960,564 (+)	NCBI
Lyon_Normotensive	1	94,081,083 - 94,097,398 (+)	NCBI
Lyon_Hypertensive	1	90,624,611 - 90,640,951 (+)	NCBI
F344_StmMcwi	1	89,069,578 - 89,085,893 (+)	NCBI
Rnor_6.0	1	82,480,875 - 82,497,196 (+)	NCBI
Rnor_5.0	1	83,742,151 - 83,758,472 (+)	NCBI
RGSC_v3.4	1	80,894,705 - 80,911,020 (+)	RGD
Celera	1	75,636,001 - 75,652,315 (+)	RGD

Sequence:

show sequence

CAACCTCAAATTATTCAGGACTATCACCTACCTTTCCTTGGGAGACCCCACCCCACCCCACAAG
CCCTGCAGGGGCGGGGCCTCCGCATCCCACCTTTGCCCGGGGTTCGCGCTCTCCGAAGTTCCGT
GGGGCGCCGCCTCCCCCATGCCGCCCTCGGGGCTGCGGCTGCTGCCGCTTCTGCTCCCACTCCC
GTGGCTTCTAGTGCTGACGCCCGGGAGGCCAGCCGCGGGACTCTCCACCTGCAAGACCATCGAC
ATGGAGCTGGTGAAACGGAAGCGCATCGAAGCCATCCGTGGCCAGATCCTGTCCAAACTAAGGC
TCGCCAGTCCCCCGAGCCAGGGGGAGGTACCGCCGGGCCCGCTGCCCGAGGCGGTGCTCGCTTT
GTACAACAGCACCCGCGACCGGGTGGCAGGCGAGAGCGCTGACCCGGAGCCCGAGCCCGAGGCG
GACTACTACGCCAAAGAAGTCACCCGCGTGCTAATGGTGGACCGCAACAACGCAATCTATGACA
AAACCAAAGACATCACACACAGTATATATATGTTCTTCAATACGTCAGACATTCGGGAAGCAGT
GCCAGAACCCCCATTGCTGTCCCGTGCAGAGCTGCGCCTGCAGAGATTCAAGTCAACTGTGGAG
CAACACGTAGAACTCTACCAGAAATATAGCAACAATTCCTGGCGTTACCTTGGTAACCGGCTGC
TGACCCCCACTGATACGCCTGAGTGGCTGTCTTTTGACGTCACTGGAGTTGTCCGGCAGTGGCT
GAACCAAGGAGACGGAATACAGGGCTTTCGCTTCAGTGCTCACTGCTCTTGTGACAGCAAAGAT
AATGTACTCCACGTGGAAATCAATGGGATCAGTCCCAAACGTCGAGGTGACCTGGGCACCATCC
ATGACATGAACCGACCCTTCCTGCTCCTCATGGCCACCCCCCTGGAAAGGGCTCAACACCTGCA
CAGCTCCAGGCACCGGAGAGCCCTGGATACCAACTACTGCTTCAGCTCCACAGAGAAGAACTGC
TGTGTACGGCAGCTGTACATTGACTTTAGGAAGGACCTGGGTTGGAAGTGGATCCACGAGCCCA
AGGGCTACCATGCCAACTTCTGTCTGGGGCCCTGCCCCTACATTTGGAGCCTGGACACACAGTA
CAGCAAGGTCCTTGCCCTCTACAACCAACACAACCCGGGTGCTTCCGCATCACCGTGCTGCGTG
CCGCAGGCTTTGGAGCCACTGCCCATCGTCTACTACGTGGGTCGCAAGCCCAAGGTGGAGCAGT
TGTCCAACATGATCGTGCGCTCCTGCAAGTGCAGCTGAGGCCCCGCCCCCGCCCCGCCCCGCCC
CTCCCGGCAGGCCCGGCCCCGCCCCCGCCCCGCCCGCAGTGCCCGGGGCTGTATTTAAGGACAC
CTGCACCCCCCCCAAGCCCATCTGGGGGCCCATTAAAGGTGACAGAGGAAAAAAAAAAAAAAAA
AAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_067589	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAD20222	(Get FASTA)	NCBI Sequence Viewer
	AAH76380	(Get FASTA)	NCBI Sequence Viewer
	AAS55640	(Get FASTA)	NCBI Sequence Viewer
	CAA36741	(Get FASTA)	NCBI Sequence Viewer
	EDM07998	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000028051
	ENSRNOP00000028051.2
	ENSRNOP00055047831
	ENSRNOP00060045208
	ENSRNOP00065046474
GenBank Protein	P17246	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_067589 ⟸ NM_021578
- Peptide Label:	precursor
- UniProtKB:	Q53YM8 (UniProtKB/Swiss-Prot), P17246 (UniProtKB/Swiss-Prot), A0ABK0M960 (UniProtKB/TrEMBL)
- Sequence:	show sequence MPPSGLRLLPLLLPLPWLLVLTPGRPAAGLSTCKTIDMELVKRKRIEAIRGQILSKLRLASPPS QGEVPPGPLPEAVLALYNSTRDRVAGESADPEPEPEADYYAKEVTRVLMVDRNNAIYDKTKDIT HSIYMFFNTSDIREAVPEPPLLSRAELRLQRFKSTVEQHVELYQKYSNNSWRYLGNRLLTPTDT PEWLSFDVTGVVRQWLNQGDGIQGFRFSAHCSCDSKDNVLHVEINGISPKRRGDLGTIHDMNRP FLLLMATPLERAQHLHSSRHRRALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHAN FCLGPCPYIWSLDTQYSKVLALYNQHNPGASASPCCVPQALEPLPIVYYVGRKPKVEQLSNMIV RSCKCS hide sequence

Ensembl Acc Id:

ENSRNOP00000028051 ⟸ ENSRNOT00000028051

Ensembl Acc Id:

ENSRNOP00000112428 ⟸ ENSRNOT00000168943

Protein Domains

TGF-beta family profile

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P17246-F1-model_v2	AlphaFold	P17246	1-390	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13689823

Promoter ID:

EPDNEW_R347

Type:

multiple initiation site

Name:

Tgfb1_1

Description:

transforming growth factor, beta 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_R348

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	82,480,150 - 82,480,210	EPDNEW

RGD ID:

13689824

Promoter ID:

EPDNEW_R348

Type:

initiation region

Name:

Tgfb1_2

Description:

transforming growth factor, beta 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_R347

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	82,480,654 - 82,480,714	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:69051	AgrOrtholog
BioCyc Gene	G2FUF-60369	BioCyc
Ensembl Genes	ENSRNOG00000020652	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
	ENSRNOG00055033547	UniProtKB/Swiss-Prot
	ENSRNOG00060031551	UniProtKB/Swiss-Prot
	ENSRNOG00065032861	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000028051	ENTREZGENE
	ENSRNOT00000028051.6	UniProtKB/Swiss-Prot
	ENSRNOT00055057991	UniProtKB/Swiss-Prot
	ENSRNOT00060054673	UniProtKB/Swiss-Prot
	ENSRNOT00065056495	UniProtKB/Swiss-Prot
Gene3D-CATH	2.10.90.10	UniProtKB/Swiss-Prot
	2.60.120.970	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7107411	IMAGE-MGC_LOAD
InterPro	Cystine-knot_cytokine	UniProtKB/Swiss-Prot
	TGF-b_C	UniProtKB/Swiss-Prot
	TGF-b_propeptide	UniProtKB/Swiss-Prot
	TGF-beta	UniProtKB/Swiss-Prot
	TGF-beta-rel	UniProtKB/Swiss-Prot
	TGFb1	UniProtKB/Swiss-Prot
	TGFb_CS	UniProtKB/Swiss-Prot
KEGG Report	rno:59086	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:93466	IMAGE-MGC_LOAD
NCBI Gene	59086	ENTREZGENE
PANTHER	PTHR11848	UniProtKB/Swiss-Prot
	TRANSFORMING GROWTH FACTOR BETA-1 PROPROTEIN	UniProtKB/Swiss-Prot
Pfam	TGF_beta	UniProtKB/Swiss-Prot
	TGFb_propeptide	UniProtKB/Swiss-Prot
PharmGKB	TGFB1	RGD
PhenoGen	Tgfb1	PhenoGen
PIRSF	TGF-beta	UniProtKB/Swiss-Prot
PRINTS	TGFBETA	UniProtKB/Swiss-Prot
	TGFBETA1	UniProtKB/Swiss-Prot
PROSITE	TGF_BETA_1	UniProtKB/Swiss-Prot
	TGF_BETA_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000020652	RatGTEx
	ENSRNOG00055033547	RatGTEx
	ENSRNOG00060031551	RatGTEx
	ENSRNOG00065032861	RatGTEx
SMART	TGFB	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF57501	UniProtKB/Swiss-Prot
TIGR	TC220292
UniProt	A0ABK0M960	ENTREZGENE, UniProtKB/TrEMBL
	P17246	ENTREZGENE
	Q53YM8	ENTREZGENE
	TGFB1_RAT	UniProtKB/Swiss-Prot
UniProt Secondary	Q53YM8	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2002-06-10	Tgfb1	transforming growth factor, beta 1			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_disease	mutations in human homolog implicated in Camurati-Engelmann hereditary disease	628503
gene_expression	expression peaks in fetal lung fibroblasts at day 18	70317
gene_expression	lacking in young prostate but present in the epithelium of aging prostate	70812
gene_expression	expressed throughout mesenchyme	70317
gene_expression	mRNA and protein is expressed in perfused kidneys	628503
gene_expression	expressed in anterior pituitary gland	628503
gene_function	mitogen	70317
gene_physical_interaction	may bind Scya2 during renal scarring	628503
gene_process	stimulatory mitogen for fetal lung epithelial cell growth	70317
gene_process	stimulates growth of fetal lung epithelial cells at low concentrations and inhibits differentiation at higher concentrations	70317
gene_process	involved in regulating extracellular matrix formation	628503
gene_process	modulates effects of TSH and growth factors on thyroid gland homeostasis	628503
gene_process	suppresses thyroid growth and differentiation	628503
gene_process	activates Tgfb receptor mediated signaling pathway involving specific Smad proteins	625677
gene_process	growth factor functioning as fundamental regulatory molecule	628521
gene_process	inhibits prolactin (PRL) secretion and lactotroph cell proliferation and stimulates vascular endothelial growth factor (Vegf) in pituitary cells	628503
gene_process	plays a role in normal immune defense and in accumulation of extracellular matrix macromolecules	628503
gene_process	may modulate growth and function of endocrine pituitary cells including intrapituitary vascular permeablility, intergrity and angiogenesis	628503
gene_process	induces collagen synthesis via MAPK pathway	1299177
gene_product	member of Tgf beta superfamily
gene_protein	2.5 kDa	628503
gene_regulation	expression is increased by the treatment of amiodarone (AM), an iodinated benzofuran derivative and effective antidysrhythmic agent	628503

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - GAD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - GAD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)