Advanced Search (OLGA)

Gene: Sod2 (superoxide dismutase 2) Rattus norvegicus

Analyze

Symbol:

Sod2

Name:

superoxide dismutase 2

RGD ID:

3732

Description:

Enables several functions, including manganese ion binding activity; oxygen binding activity; and superoxide dismutase activity. Involved in several processes, including cellular response to ethanol; hydrogen peroxide biosynthetic process; and negative regulation of membrane hyperpolarization. Located in mitochondrial nucleoid. Used to study esophagus adenocarcinoma; hypertension; intestinal disease; and myocardial infarction. Biomarker of several diseases, including adult respiratory distress syndrome; artery disease (multiple); bladder neck obstruction; congenital diaphragmatic hernia; and steatotic liver disease (multiple). Human ortholog(s) of this gene implicated in several diseases, including autoimmune disease of musculoskeletal system (multiple); cardiomyopathy (multiple); diabetes mellitus (multiple); liver disease (multiple); and optic nerve disease (multiple). Orthologous to human SOD2 (superoxide dismutase 2); PARTICIPATES IN hypertension pathway; Huntington's disease pathway; INTERACTS WITH (+)-pilocarpine; (+)-schisandrin B; (+)-sesamin.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

manganese superoxide dismutase; mitochondrial superoxide dismutase 2; MnSOD; Superoxide dimutase 2 mitochondrial; Superoxide dimutase 2, mitochondrial; Superoxide dismutase 2 mitochondrial; superoxide dismutase 2, mitochondrial; superoxide dismutase [Mn], mitochondrial

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SOD2 (superoxide dismutase 2)	RGD	RGD
Mus musculus (house mouse):	Sod2 (superoxide dismutase 2, mitochondrial)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Sod2 (superoxide dismutase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SOD2 (superoxide dismutase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SOD2 (superoxide dismutase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Sod2 (superoxide dismutase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SOD2 (superoxide dismutase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SOD2 (superoxide dismutase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Sod2 (superoxide dismutase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Sod2 (superoxide dismutase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Sod2 (superoxide dismutase 2, mitochondrial)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	SOD2 (superoxide dismutase 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	sod2 (superoxide dismutase 2, mitochondrial)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Sod2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	SOD2	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	sod-2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	sod-3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	sod2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	sod2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Candidate Gene For:

Iddm22

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	50,043,323 - 50,050,168 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	50,043,325 - 50,050,168 (-)	Ensembl				GRCr8
mRatBN7.2	1	47,638,318 - 47,645,163 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	47,636,528 - 47,645,189 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	48,187,171 - 48,194,016 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	54,175,067 - 54,181,918 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	48,262,686 - 48,269,531 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	47,914,757 - 47,921,587 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	47,914,759 - 47,921,587 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	51,827,380 - 51,834,232 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	41,862,997 - 41,870,327 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	43,323,111 - 43,329,909 (-)	NCBI		Celera
RGSC_v3.1	1	41,865,943 - 41,873,272 (-)	NCBI
Cytogenetic Map	1	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

abdominal aortic aneurysm (IEP,ISO)

Acute Coronary Syndrome (ISO)

acute kidney tubular necrosis (ISO)

acute myeloid leukemia (ISO)

adenocarcinoma (ISO)

adrenoleukodystrophy (ISO)

adult respiratory distress syndrome (IEP,ISO)

Albuminuria (ISO)

alcohol-associated liver disease (ISO)

alcoholic liver cirrhosis (ISO)

Alzheimer's disease (ISO)

amyotrophic lateral sclerosis (ISO)

amyotrophic lateral sclerosis type 1 (ISS)

anaplastic thyroid carcinoma (ISO)

anemia (ISO)

Aortic Calcification (IEP)

aortic disease (ISO)

Arsenic Poisoning (ISO)

asphyxia neonatorum (ISO)

asthma (ISO)

atherosclerosis (ISO)

autoimmune disease (ISO)

Bacteremia (ISO)

bilirubin metabolic disorder (ISO)

bladder neck obstruction (IEP)

brain edema (ISO)

Brain Injuries (ISO)

brain ischemia (ISO)

Brain Neoplasms (ISO)

breast cancer (ISO)

Breast Neoplasms (ISO)

Canavan disease (ISS)

carcinoma (ISO)

Cardiac Arrhythmias (IDA)

Cardiogenic Shock (ISO)

Cardiomegaly (ISO)

cardiomyopathy (ISO)

carotid artery disease (ISO)

central nervous system disease (ISO)

Central Nervous System Infections (ISO)

Chemical and Drug Induced Liver Injury (IMP,ISO)

chronic progressive external ophthalmoplegia (ISO)

Colonic Neoplasms (ISO)

Colorectal Neoplasms (ISO)

congenital diaphragmatic hernia (IEP)

congestive heart failure (ISO,ISS)

cystitis (IEP)

diabetic angiopathy (ISO)

Diabetic Nephropathies (ISO)

diffuse large B-cell lymphoma (ISO)

dilated cardiomyopathy (ISO,ISS)

disease of cellular proliferation (ISO)

Disease Progression (ISO)

Disorders of Environmental Origin (IEP)

Drug-induced Neutropenia (ISO)

Endotoxemia (ISO)

Esophageal Neoplasms (ISO)

Esophageal Stenosis (ISO)

esophagitis (ISO)

esophagus adenocarcinoma (IDA)

esophagus squamous cell carcinoma (ISO)

exfoliation syndrome (ISO)

Experimental Diabetes Mellitus (IEP,ISO)

Experimental Mammary Neoplasms (ISO)

Experimental Radiation Injuries (ISO)

extrinsic allergic alveolitis (ISO)

familial adenomatous polyposis (ISO)

Farber lipogranulomatosis (ISO)

Fever (ISO)

Fibrosis (ISO)

gestational diabetes (ISO)

head and neck squamous cell carcinoma (ISO)

Hearing Loss, Noise-Induced (ISO)

hemolytic anemia (ISO)

Hemorrhagic Shock (IEP)

hepatocellular carcinoma (ISO)

Huntington's disease (ISO)

hyperhomocysteinemia (IEP)

Hyperoxia (IEP)

hypertension (IDA,ISO)

hyperthyroidism (ISO)

Hypertriglyceridemia (ISO)

hypoglycemia (ISO)

Hypopharyngeal Neoplasms (ISO)

hypothyroidism (IEP)

Hypoxia (ISO)

inclusion body myositis (ISO)

infectious mononucleosis (ISO)

Insulin Resistance (ISO)

interstitial lung disease (ISO)

intestinal disease (IDA)

invasive ductal carcinoma (ISO)

ischemia (ISO)

kidney disease (ISO)

Kidney Neoplasms (ISO)

Kuhnt-Junius degeneration (ISO)

Leber hereditary optic neuropathy (ISO)

left ventricular failure (ISO)

Leigh disease (ISS)

Lewy body dementia (ISO)

liver cirrhosis (ISO)

lung adenocarcinoma (ISO)

lung cancer (ISO)

lung disease (ISO)

lung non-small cell carcinoma (ISO)

Lymphatic Metastasis (ISO)

macular degeneration (ISO)

major depressive disorder (ISO)

male infertility (ISO)

malignant mesothelioma (ISO)

Marfan syndrome (ISO)

melanoma (ISO)

MELAS syndrome (ISO)

Mesothelioma (ISO)

metabolic dysfunction and alcohol associated liver disease (IEP)

metabolic dysfunction-associated steatohepatitis (IEP,ISO)

metabolic dysfunction-associated steatotic liver disease (ISO)

Metabolic Syndrome (ISO)

methylmalonic acidemia (ISO)

middle cerebral artery infarction (ISO)

mitochondrial metabolism disease (ISO)

Mouth Neoplasms (ISO)

multiple chemical sensitivity (ISO)

multiple myeloma (ISO)

mycosis fungoides (ISO)

myelomeningocele (ISO)

myocardial infarction (IDA,IEP,ISO)

Myocardial Ischemia (ISO)

Myocardial Reperfusion Injury (ISO)

Nasal Polyps (ISO)

Necrosis (ISO)

Neoplasm Invasiveness (ISO)

Neoplasm Metastasis (ISO)

Neoplastic Cell Transformation (ISO)

nephrotic syndrome (ISO)

Nerve Degeneration (ISO)

neurodegenerative disease (ISO)

neuronal ceroid lipofuscinosis (ISO)

obesity (ISO)

optic neuritis (ISO)

osteoarthritis (ISO)

osteoporosis (ISO)

ovarian cancer (ISO)

Ovarian Neoplasms (ISO)

pancreatic cancer (ISO)

papilloma (ISO)

Parkinson's disease (ISO)

perinatal necrotizing enterocolitis (ISO)

peripheral nervous system disease (ISO)

polyneuropathy (ISO)

pre-malignant neoplasm (ISO)

Premature Birth (ISO)

Presbycusis (IEP)

primary biliary cholangitis (ISO)

primary open angle glaucoma (ISO)

Prostatic Neoplasms (ISO)

pseudoxanthoma elasticum (ISO)

psoriasis (ISO)

Pulmonary Arterial Hypertension (IEP,ISO)

pulmonary hypertension (ISO)

Radiation Injuries (ISO)

reactive arthritis (ISO)

renal cell carcinoma (ISO)

renal fibrosis (ISO)

Reperfusion Injury (IEP,ISO)

Respiratory Tract Granuloma (ISO)

Reticulocytosis (ISO)

Retina Reperfusion Injury (IEP,ISO)

retinitis pigmentosa (ISO)

rheumatoid arthritis (ISO)

sarcoidosis (ISO)

Sengers syndrome (ISO)

sensorineural hearing loss (IEP)

Sepsis (IEP)

sideroblastic anemia (ISO)

Skin Abnormalities (ISO)

skin disease (ISO)

Skin Neoplasms (ISO)

squamous cell carcinoma (ISO)

status epilepticus (IEP)

steatotic liver disease (ISO)

stomach cancer (ISO)

Stomach Neoplasms (ISO)

substance-induced psychosis (ISO)

systemic lupus erythematosus (ISO)

Tardive Dyskinesia (ISO)

Thyroid Neoplasms (ISO)

Tongue Neoplasms (ISO)

transient cerebral ischemia (IEP,ISO)

Turner syndrome (ISO)

type 1 diabetes mellitus (ISO)

type 2 diabetes mellitus (ISO)

urinary bladder cancer (ISO)

urticaria (ISO)

uveitis (ISO)

vascular disease (ISO)

vitiligo (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-albicanol (ISO)

(+)-catechin (ISO)

(+)-epicatechin-3-O-gallate (ISO)

(+)-pilocarpine (EXP)

(+)-schisandrin B (EXP)

(+)-sesamin (EXP)

(+)-taxifolin (EXP)

(-)-cotinine (EXP)

(-)-epigallocatechin 3-gallate (EXP,ISO)

(1->4)-beta-D-glucan (ISO)

(E)-cinnamyl alcohol (ISO)

(R)-adrenaline (EXP,ISO)

(R)-lipoic acid (EXP,ISO)

(R)-noradrenaline (EXP,ISO)

(R,R)-tramadol (EXP)

(R,R,R)-alpha-tocopherol (EXP)

(S)-amphetamine (ISO)

(S)-naringenin (EXP)

(S)-nicotine (EXP,ISO)

(Z)-ligustilide (ISO)

1,1'-azobis(N,N-dimethylformamide) (ISO)

1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (EXP)

1,1-bis(2-aminoethyl)-2-hydroxy-3-oxotriazane (EXP,ISO)

1,1-dichloroethene (ISO)

1,10-phenanthroline (ISO)

1,2-dimethylhydrazine (EXP,ISO)

1,4-benzoquinone (ISO)

1,4-dithiothreitol (ISO)

1-bromopropane (EXP)

1-chloro-2,4-dinitrobenzene (ISO)

1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (ISO)

1-naphthyl isothiocyanate (EXP)

11-deoxycorticosterone (EXP)

17alpha-ethynylestradiol (EXP,ISO)

17beta-estradiol (EXP,ISO)

17beta-hydroxy-5alpha-androstan-3-one (EXP,ISO)

1H-[1,2,4]oxadiazolo[4,3-a]quinoxalin-1-one (EXP)

1H-pyrazole (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (EXP)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,2,2-tetramine (EXP,ISO)

2,3,2-tetramine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3-bis(4-hydroxyphenyl)propionitrile (EXP,ISO)

2,4,6-trinitrotoluene (ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (EXP)

2,6-di-tert-butyl-4-methylphenol (ISO)

2,6-dimethoxyphenol (ISO)

2-(3,4-dimethoxyphenyl)-5-\{[2-(3,4-dimethoxyphenyl)ethyl](methyl)amino\}-2-(propan-2-yl)pentanenitrile (EXP)

2-acetamidofluorene (EXP)

2-deoxy-D-glucose (ISO)

2-hydroxypropanoic acid (ISO)

2-methoxy-17beta-estradiol (ISO)

2-palmitoylglycerol (ISO)

2-tert-butylhydroquinone (ISO)

3',5'-cyclic AMP (ISO)

3'-amino-3'-deoxy-N(6),N(6)-dimethyladenosine (EXP,ISO)

3,3',4,4',5-pentachlorobiphenyl (EXP)

3,3',5'-triiodo-L-thyronine (EXP)

3,4-dihydroxybenzoate (ISO)

3,4-dihydroxybenzoic acid (EXP,ISO)

3,7-dihydropurine-6-thione (ISO)

3-[3-(tert-butylsulfanyl)-1-(4-chlorobenzyl)-5-(propan-2-yl)-1H-indol-2-yl]-2,2-dimethylpropanoic acid (ISO)

3-\{1-[3-(dimethylamino)propyl]-1H-indol-3-yl\}-4-(1H-indol-3-yl)-1H-pyrrole-2,5-dione (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

3-methylcholanthrene (ISO)

3-nitropropanoic acid (EXP)

3-phenylprop-2-enal (ISO)

4'-epidoxorubicin (ISO)

4,4'-sulfonyldiphenol (ISO)

4-chlorobiphenyl (ISO)

4-hydroxy-3-[4-(2-hydroxyphenyl)phenyl]-6-oxo-7H-thieno[2,3-b]pyridine-5-carbonitrile (ISO)

4-hydroxy-TEMPO (EXP,ISO)

4-hydroxynon-2-enal (ISO)

4-hydroxyphenyl retinamide (ISO)

4-nitrophenol (ISO)

4-vinylcyclohexene dioxide (EXP)

5-(dimethylamino)-N-(3,4-dimethyl-5-isoxazolyl)-1-naphthalenesulfonamide (EXP)

5-aminolevulinic acid (EXP)

5-aza-2'-deoxycytidine (ISO)

5-fluorouracil (ISO)

5-Hydroxycapric acid (EXP)

5-methoxytryptamine (EXP)

5-methyl-4-oxido-2-pyrazin-4-iumcarboxylic acid (ISO)

6-chloro-2,3,4,9-tetrahydro-1H-carbazole-1-carboxamide (EXP,ISO)

6-propyl-2-thiouracil (EXP)

6alpha-methylprednisolone (EXP,ISO)

7,12-dimethyltetraphene (EXP,ISO)

7,9-dihydro-1H-purine-2,6,8(3H)-trione (ISO)

7H-xanthine (EXP,ISO)

8-Br-cAMP (ISO)

8-bromo-3',5'-cyclic GMP (EXP)

9-cis,11-trans-octadecadienoic acid (EXP)

9H-xanthine (EXP,ISO)

[6]-Shogaol (ISO)

AACOCF3 (ISO)

acetamiprid (EXP)

acetic acid (EXP)

acetylcholine (ISO)

acetylsalicylic acid (EXP,ISO)

acrolein (EXP,ISO)

acrylamide (EXP,ISO)

acrylonitrile (ISO)

Actein (ISO)

acteoside (ISO)

actinomycin D (EXP,ISO)

aflatoxin B1 (ISO)

Aflatoxin G1 (ISO)

AICA ribonucleotide (ISO)

alatrofloxacin (ISO)

albendazole (EXP)

aldehydo-D-glucose (EXP,ISO)

alginic acid (ISO)

all-trans-retinoic acid (ISO)

all-trans-retinol (EXP)

Allylamine (EXP)

alpha,alpha-trehalose (EXP)

alpha-D-galactose (EXP,ISO)

alpha-hexylcinnamaldehyde (ISO)

alpha-pinene (ISO)

aluminium atom (EXP)

aluminium trinitrate (EXP,ISO)

aluminium(0) (EXP)

ametryn (EXP)

aminoacetone (EXP)

aminoguanidine (ISO)

amiodarone (ISO)

amitrole (ISO)

ammonium acetate (EXP)

ammonium chloride (EXP)

amosite asbestos (ISO)

amphetamine (EXP)

amphibole asbestos (ISO)

anthra[1,9-cd]pyrazol-6(2H)-one (ISO)

ANTIMYCIN (ISO)

antimycin A (EXP,ISO)

antirheumatic drug (ISO)

apocynin (EXP,ISO)

arachidonic acid (EXP,ISO)

aristolochic acid A (ISO)

arjunolic acid (EXP)

arsane (EXP,ISO)

arsenic atom (EXP,ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

astemizole (EXP)

astragaloside IV (EXP)

atazanavir sulfate (ISO)

atenolol (EXP,ISO)

atorvastatin calcium (EXP,ISO)

ATP (ISO)

atrasentan (EXP)

atrazine (EXP,ISO)

azathioprine (ISO)

baicalin (ISO)

Bandrowski's base (ISO)

barium chloride (EXP)

Bavachalcone (ISO)

Bay-K-8644 (ISO)

benzbromarone (ISO)

benzene (ISO)

benzene-1,2,4-triol (ISO)

benzo[a]pyrene (ISO)

berberine (EXP,ISO)

beta-carotene (EXP)

beta-naphthoflavone (ISO)

bifenthrin (EXP,ISO)

bis(2-butoxyethyl)phthalate (EXP)

bis(2-chloroethyl) sulfide (ISO)

bis(2-ethylhexyl) phthalate (EXP,ISO)

bisphenol A (EXP,ISO)

bisphenol AF (EXP,ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

bleomycin A2 (EXP,ISO)

bortezomib (ISO)

bosentan (ISO)

brequinar (ISO)

bucladesine (ISO)

butanal (ISO)

butylated hydroxyanisole (ISO)

butyric acid (ISO)

C60 fullerene (EXP)

cadmium acetate (EXP)

cadmium atom (EXP,ISO)

cadmium dichloride (EXP,ISO)

cadmium sulfate (ISO)

caffeine (EXP,ISO)

calcidiol (EXP)

calcitriol (EXP)

calcium atom (EXP)

calcium dichloride (ISO)

calcium(0) (EXP)

Calphostin C (ISO)

camphene (EXP)

camptothecin (ISO)

Candesartan cilexetil (EXP)

cannabidiol (EXP)

capsaicin (ISO)

captan (ISO)

carbamazepine (EXP,ISO)

carbon monoxide (EXP,ISO)

carbon nanotube (EXP,ISO)

carbonyl cyanide p-trifluoromethoxyphenylhydrazone (ISO)

carboplatin (EXP)

carmustine (ISO)

carnosic acid (ISO)

carotenoid (ISO)

carteolol (ISO)

carvedilol (EXP)

celastrol (EXP)

celecoxib (ISO)

ceric oxide (ISO)

cerium trichloride (ISO)

chenodeoxycholic acid (ISO)

chicoric acid (EXP)

Chikusetsusaponin-V (ISO)

chloramine T (EXP)

chlorobenzene (ISO)

chlorogenic acid (ISO)

chlorohydrocarbon (ISO)

chlorpyrifos (EXP,ISO)

cholesterol (ISO)

choline (ISO)

chromium atom (ISO)

chromium(6+) (EXP,ISO)

chrysazin (ISO)

cinnamyl alcohol (ISO)

ciprofibrate (EXP)

cisplatin (EXP,ISO)

clofibric acid (EXP)

clozapine (EXP)

cobalt atom (EXP)

cobalt dichloride (EXP)

cocaine (ISO)

coenzyme Q10 (EXP,ISO)

colforsin daropate hydrochloride (ISO)

conjugated linoleic acid (EXP)

copper atom (EXP,ISO)

copper(0) (EXP,ISO)

copper(II) chloride (ISO)

copper(II) sulfate (EXP,ISO)

corosolic acid (ISO)

corticosterone (EXP)

coumestrol (ISO)

creatinine (ISO)

crocidolite asbestos (EXP,ISO)

CU-O LINKAGE (ISO)

curcumin (EXP,ISO)

Cyanoginosin (EXP)

cycloheximide (ISO)

cyclophosphamide (EXP,ISO)

cyclosporin A (EXP,ISO)

cyfluthrin (ISO)

cyhalothrin (EXP)

cypermethrin (EXP,ISO)

cysteamine (EXP)

cytochalasin B (ISO)

D-glucose (EXP,ISO)

daidzein (ISO)

dapsone (EXP,ISO)

daunorubicin (EXP)

DDE (EXP,ISO)

decabromodiphenyl ether (ISO)

Decursin (ISO)

dehydroepiandrosterone (EXP)

Dendrobine (ISO)

deoxycholic acid (ISO)

deoxynivalenol (ISO)

desferrioxamine B (ISO)

dexamethasone (EXP,ISO)

dextran sulfate (ISO)

diallyl trisulfide (EXP,ISO)

diarsenic trioxide (ISO)

diazinon (EXP)

dibenziodolium (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (EXP)

dichloromethane (ISO)

dichlorvos (EXP)

diclofenac (EXP,ISO)

dicoumarol (EXP,ISO)

dicrotophos (ISO)

dieldrin (EXP)

diethyl maleate (ISO)

diethylstilbestrol (ISO)

dihydroartemisinin (ISO)

dihydrogen (ISO)

dimethylarsinous acid (ISO)

Diosbulbin B (ISO)

dioxygen (EXP,ISO)

diprotium (ISO)

diprotium oxide (ISO)

diquat (EXP,ISO)

disodium selenite (EXP,ISO)

disulfiram (ISO)

dithianon (ISO)

divanadium pentaoxide (ISO)

dizocilpine maleate (EXP)

docebenone (EXP)

dopamine (EXP)

dorsomorphin (ISO)

doxorubicin (EXP,ISO)

dronedarone (ISO)

ebselen (EXP)

eckol (ISO)

edaravone (EXP)

elemental selenium (ISO)

ellagic acid (EXP)

emodin (EXP,ISO)

enalapril (EXP,ISO)

endosulfan (ISO)

enilconazole (ISO)

enniatin (ISO)

enzyme inhibitor (EXP,ISO)

epalrestat (ISO)

eplerenone (EXP)

Erythropoietin (ISO)

ethanol (EXP,ISO)

ethylene glycol dimethacrylate (ISO)

etoposide (ISO)

eugenol (ISO)

EUK-8 (ISO)

febuxostat (EXP)

fenofibrate (EXP)

fentanyl (EXP)

fenthion (ISO)

ferric ammonium citrate (EXP,ISO)

ferric oxide (ISO)

flutamide (EXP,ISO)

fluvastatin (ISO)

folic acid (ISO)

formaldehyde (EXP,ISO)

formononetin (EXP,ISO)

Forsythiaside (ISO)

fraxetin (ISO)

fulvestrant (EXP,ISO)

furfural (ISO)

Fusaric acid (ISO)

galactose (EXP,ISO)

gallium nitrate (ISO)

gallocatechin (ISO)

Ganoderic acid A (EXP,ISO)

genistein (EXP,ISO)

gentamycin (EXP)

geraniol (EXP,ISO)

gingerol (ISO)

ginsenoside Re (ISO)

Ginsenoside Rh4 (ISO)

glafenine (EXP)

gliclazide (EXP)

gliotoxin (ISO)

glucose (EXP,ISO)

glutathione (ISO)

glutathione disulfide (ISO)

glycochenodeoxycholic acid (ISO)

glycocholic acid (ISO)

glycodeoxycholic acid (ISO)

glycyrrhizinic acid (EXP)

glyphosate (EXP,ISO)

Goe 6976 (ISO)

haloperidol (EXP)

helenalin (ISO)

hemin (EXP)

hesperetin (ISO)

hesperidin (EXP)

hexachlorobenzene (EXP)

hexaconazole (ISO)

hexadecanoic acid (EXP,ISO)

homocysteine (ISO)

Honokiol (EXP)

hydrogen chloride (ISO)

hydrogen peroxide (EXP,ISO)

hydrogen sulfide (ISO)

hydroquinone (ISO)

hydroxytyrosol (EXP,ISO)

ibuprofen (ISO)

icariin (EXP,ISO)

idebenone (EXP)

indirubin-3'-monoxime (ISO)

indometacin (EXP,ISO)

ionomycin (ISO)

irinotecan (ISO)

iron atom (EXP,ISO)

iron dextran (EXP)

iron trichloride (EXP)

iron(0) (EXP,ISO)

iron(2+) sulfate (anhydrous) (ISO)

isoeugenol (ISO)

isoflavones (EXP)

isoflurane (EXP,ISO)

isoliquiritigenin (ISO)

isoniazide (EXP,ISO)

isoprenaline (EXP,ISO)

isotretinoin (ISO)

ivermectin (ISO)

kaempferol (ISO)

kainic acid (EXP,ISO)

ketorolac tromethamine (EXP)

kojic acid (EXP)

L-1,4-dithiothreitol (ISO)

L-ascorbic acid (EXP,ISO)

L-cysteine (ISO)

L-dehydroascorbic acid (ISO)

L-methionine (ISO)

lanthanum trichloride (ISO)

lapatinib (ISO)

lead diacetate (EXP,ISO)

lead(0) (EXP,ISO)

leflunomide (EXP)

lenvatinib (EXP)

Leonurine (EXP,ISO)

leptomycin B (ISO)

linalool (ISO)

linderalactone (ISO)

linsidomine (ISO)

lipoic acid (EXP,ISO)

lipopolysaccharide (EXP,ISO)

lithium atom (ISO)

lithium chloride (ISO)

lithium hydride (ISO)

loliolide (ISO)

losartan (EXP)

lutein (ISO)

luteolin (ISO)

luzindole (ISO)

LY294002 (EXP,ISO)

lycopene (EXP,ISO)

malathion (EXP,ISO)

maneb (ISO)

manganese atom (EXP,ISO)

manganese(0) (EXP,ISO)

manganese(II) chloride (EXP,ISO)

masoprocol (ISO)

mechlorethamine (EXP)

medroxyprogesterone acetate (EXP,ISO)

melatonin (EXP,ISO)

meloxicam (ISO)

menadione (EXP,ISO)

mercaptoethanol (ISO)

mercaptopurine (ISO)

mercury dichloride (EXP,ISO)

metam (ISO)

metformin (ISO)

methamphetamine (ISO)

methimazole (EXP)

methotrexate (ISO)

methyl methanesulfonate (ISO)

methylarsonic acid (EXP,ISO)

methylglyoxal (ISO)

methylmercury chloride (EXP,ISO)

methylparaben (ISO)

mevalonic acid (ISO)

microcystin-LR (ISO)

mifepristone (EXP,ISO)

minocycline (ISO)

mitomycin C (ISO)

Mitoquinone (EXP,ISO)

Mitotane (EXP)

MitoTEMPO (ISO)

mono(2-ethylhexyl) phthalate (EXP,ISO)

monocrotophos (EXP)

morphine (ISO)

myxothiazol (ISO)

N,N-diethyl-m-toluamide (EXP)

N,N-dimethylglycine (ISO)

N-[2-(4-bromocinnamylamino)ethyl]isoquinoline-5-sulfonamide (ISO)

N-acetyl-beta-D-glucosamine (ISO)

N-acetyl-D-glucosamine (ISO)

N-acetyl-L-cysteine (EXP,ISO)

N-Acetyl-S-(1,2-dichlorovinyl)-cysteine (ISO)

N-acetylsphingosine (EXP,ISO)

N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO)

N-ethylmaleimide (ISO)

N-methyl-4-phenylpyridinium (ISO)

N-methyl-N-nitrosourea (ISO)

N-nitrosodiethylamine (EXP)

N-phosphocreatine (EXP)

N-tosyl-L-phenylalanyl chloromethyl ketone (ISO)

naringin (ISO)

nebivolol (EXP,ISO)

nefazodone (EXP,ISO)

nerolidol (EXP)

nickel atom (EXP,ISO)

nickel dichloride (ISO)

nickel sulfate (ISO)

nicorandil (EXP)

nicotinamide (EXP,ISO)

nicotine (EXP,ISO)

nicotinic acid (ISO)

nifedipine (EXP,ISO)

nimesulide (EXP,ISO)

nitric oxide (EXP,ISO)

nitrofen (EXP)

nitrogen dioxide (EXP,ISO)

nitroglycerin (EXP)

nitroprusside (ISO)

nitroxoline (ISO)

NMN zwitterion (ISO)

NS-398 (ISO)

O-(chloroacetylcarbamoyl)fumagillol (EXP)

obeticholic acid (ISO)

ochratoxin A (ISO)

octadecanoic acid (ISO)

okadaic acid (ISO)

oleic acid (EXP,ISO)

oltipraz (EXP)

oxaliplatin (EXP)

oxidopamine (EXP)

ozone (EXP,ISO)

p-menthan-3-ol (ISO)

paclitaxel (ISO)

paracetamol (EXP,ISO)

paraoxon (ISO)

paraquat (EXP,ISO)

paricalcitol (ISO)

paroxetine (ISO)

pentanal (ISO)

peptidoglycan (ISO)

perfluorononanoic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

perfluoroundecanoic acid (EXP)

permethrin (EXP)

peroxynitrous acid (ISO)

phenanthrene (ISO)

phencyclidine (ISO)

phenobarbital (EXP)

phenols (ISO)

phenylarsine oxide (ISO)

phenylmercury acetate (ISO)

phenylpropanolamine (EXP)

PhIP (ISO)

phlorizin (ISO)

phorbol 13-acetate 12-myristate (EXP,ISO)

phosgene (ISO)

physostigmine (ISO)

pifithrin-alpha hydrobromide (ISO)

pioglitazone (ISO)

pipoxolan (ISO)

pirinixic acid (EXP,ISO)

piroxicam (ISO)

poly(I:C) (EXP,ISO)

poly(vinylpyrrolidone) (ISO)

porphyrins (ISO)

potassium atom (ISO)

potassium bromate (ISO)

potassium dichromate (EXP)

potassium iodide (ISO)

prednisolone (ISO)

probucol (EXP)

procyanidin (ISO)

progesterone (EXP,ISO)

propanal (ISO)

propofol (EXP)

prostaglandin E2 (ISO)

pterostilbene (ISO)

puerarin (EXP)

purine-6-thiol (ISO)

Pyridostigmine bromide (EXP,ISO)

pyridoxamine (EXP)

pyrrolidine dithiocarbamate (ISO)

pyrroloquinoline quinone (EXP)

quartz (EXP)

quercetin (EXP,ISO)

quinolin-8-ol (EXP)

rac-lactic acid (ISO)

raloxifene (ISO)

reactive oxygen species (EXP,ISO)

Rebamipide (EXP)

rebaudioside A (ISO)

regorafenib (EXP)

resveratrol (EXP,ISO)

rofecoxib (ISO)

rosmarinic acid (ISO)

rotenone (EXP,ISO)

rottlerin (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

S-adenosyl-L-methioninate (ISO)

S-adenosyl-L-methionine (ISO)

S-allylcysteine (ISO)

S-butyl-DL-homocysteine (S,R)-sulfoximine (ISO)

S-nitroso-N-acetyl-D-penicillamine (EXP,ISO)

salicyl alcohol (EXP)

Salidroside (EXP,ISO)

salsalate (EXP)

salvianolic acid B (EXP)

saquinavir (ISO)

SB 203580 (EXP,ISO)

SB 431542 (EXP,ISO)

selenic acid (ISO)

selenium atom (ISO)

selenocystine (ISO)

selenomethionine (ISO)

serpentine asbestos (EXP,ISO)

silibinin (EXP,ISO)

silicic acid (ISO)

silicon atom (ISO)

silicon dioxide (EXP,ISO)

silver atom (ISO)

silver(0) (ISO)

simvastatin (EXP,ISO)

sirolimus (ISO)

sodium acetate trihydrate (EXP,ISO)

sodium arsenate (ISO)

sodium arsenite (EXP,ISO)

sodium atom (ISO)

sodium aurothiomalate (ISO)

sodium chloride (EXP,ISO)

sodium cholate (ISO)

sodium dichromate (EXP,ISO)

sodium fluoride (EXP,ISO)

sodium nitrate (EXP,ISO)

Sodium oleate (EXP)

Sodium salicylate (ISO)

staurosporine (ISO)

sterigmatocystin (EXP)

steviol (ISO)

stevioside (ISO)

streptozocin (EXP,ISO)

succimer (ISO)

sulfamethoxazole (EXP)

sulforaphane (ISO)

sulfur dioxide (ISO)

sulindac (ISO)

sunitinib (ISO)

Sunset Yellow FCF (ISO)

superoxide (EXP,ISO)

T-2 toxin (EXP,ISO)

tacrolimus hydrate (EXP,ISO)

tamoxifen (EXP,ISO)

tanespimycin (ISO)

tartrazine (ISO)

taurocholic acid (EXP,ISO)

temozolomide (ISO)

tert-butyl ethyl ether (EXP)

tert-butyl hydroperoxide (ISO)

testosterone (EXP)

tetrachloromethane (EXP,ISO)

tetrathiomolybdate(2-) (ISO)

thallium atom (EXP)

thapsigargin (ISO)

Theaflavin 3,3'-digallate (EXP)

thenoyltrifluoroacetone (ISO)

thioacetamide (EXP,ISO)

thiram (ISO)

thymoquinone (EXP)

thyroxine (EXP)

Tiron (ISO)

titanium atom (ISO)

titanium dioxide (EXP,ISO)

tolcapone (ISO)

topotecan (EXP)

tramadol (EXP)

trandolapril (EXP)

trans-isoeugenol (ISO)

trans-piceid (ISO)

trazodone (EXP)

triadimefon (EXP)

trichlorfon (EXP)

trichostatin A (ISO)

triclosan (ISO)

trilobatin (EXP)

triolein (EXP)

triphenyl phosphate (EXP,ISO)

Triptolide (ISO)

tris(2-butoxyethyl) phosphate (ISO)

tris(2-chloroethyl) phosphate (ISO)

troglitazone (EXP,ISO)

trovafloxacin (ISO)

tunicamycin (ISO)

urea (ISO)

urethane (ISO)

valdecoxib (EXP)

valproic acid (EXP,ISO)

vancomycin (ISO)

verapamil (EXP)

vincaleukoblastine (ISO)

vinclozolin (EXP)

vincristine (ISO)

vitamin E (EXP,ISO)

vorinostat (EXP,ISO)

vosaroxin (ISO)

VX nerve agent (ISO)

water (ISO)

withaferin A (ISO)

wortmannin (EXP)

WR-1065 (ISO)

zearalenone (EXP,ISO)

zebularine (ISO)

zerumbone (ISO)

zidovudine (EXP,ISO)

zinc atom (EXP)

zinc oxide (ISO)

zinc protoporphyrin (ISO)

zinc pyrithione (ISO)

zinc sulfate (ISO)

zinc(0) (EXP)

ziram (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

acetylcholine-mediated vasodilation involved in regulation of systemic arterial blood pressure (ISO)

apoptotic mitochondrial changes (ISO)

cellular response to ethanol (IEP)

cellular response to oxidative stress (IEA,ISO,ISS)

detection of oxygen (ISO)

erythrophore differentiation (ISO)

glutathione metabolic process (ISO)

heart development (ISO)

hemopoiesis (ISO)

hydrogen peroxide biosynthetic process (IDA)

hydrogen peroxide metabolic process (IMP)

intracellular oxygen homeostasis (IEA,ISO)

intrinsic apoptotic signaling pathway in response to DNA damage (ISO)

intrinsic apoptotic signaling pathway in response to oxidative stress (ISO)

liver development (ISO)

locomotory behavior (ISO)

mitochondrion organization (ISO)

multicellular organismal-level iron ion homeostasis (ISO)

negative regulation of apoptotic process (IMP)

negative regulation of cell population proliferation (IEA,ISO)

negative regulation of fat cell differentiation (ISO)

negative regulation of fibroblast proliferation (ISO)

negative regulation of membrane hyperpolarization (IMP)

negative regulation of neuron apoptotic process (IEA,ISO)

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway (IEA,ISO)

negative regulation of vascular associated smooth muscle cell proliferation (IEA,ISO)

neuron development (ISO)

positive regulation of cell migration (IEA,ISO)

positive regulation of hydrogen peroxide biosynthetic process (IMP)

positive regulation of nitric oxide biosynthetic process (ISO)

positive regulation of vascular associated smooth muscle cell apoptotic process (IEA,ISO)

positive regulation of vascular associated smooth muscle cell differentiation involved in phenotypic switching (IEA,ISO)

post-embryonic development (ISO)

protein homotetramerization (IEA,ISO)

regulation of blood pressure (ISO)

regulation of catalytic activity (ISO)

regulation of mitochondrial membrane potential (ISO)

regulation of transcription by RNA polymerase II (IEA,ISO,ISS)

release of cytochrome c from mitochondria (ISO)

removal of superoxide radicals (IDA,IEA,ISO)

respiratory electron transport chain (ISO)

response to activity (IEA,IEP,ISO)

response to axon injury (ISO)

response to cadmium ion (IEP)

response to electrical stimulus (IEP)

response to gamma radiation (ISO)

response to hydrogen peroxide (IEA,IEP,ISO)

response to hyperoxia (ISO)

response to hypoxia (IEP)

response to immobilization stress (IEP)

response to isolation stress (IEP)

response to L-ascorbic acid (IEP)

response to lipopolysaccharide (IEP)

response to magnetism (IEP)

response to manganese ion (IEP)

response to nutrient levels (IDA)

response to oxidative stress (IEP,ISO)

response to oxygen levels (IEA)

response to reactive oxygen species (ISO)

response to selenium ion (IEP)

response to silicon dioxide (IEP)

response to superoxide (IEA,ISO)

response to xenobiotic stimulus (IDA)

response to zinc ion (IEP)

superoxide anion generation (ISO)

superoxide metabolic process (IEA,ISO,ISS)

vasodilation (ISO)

Cellular Component

cytoplasm (IDA)

mitochondrial matrix (IEA,ISO)

mitochondrial nucleoid (IDA)

mitochondrion (IBA,IEA,ISO)

Molecular Function

DNA binding (IDA)

enzyme binding (IPI)

identical protein binding (IEA,IPI,ISO)

manganese ion binding (IBA,IDA,IEA,ISO,ISS)

metal ion binding (IEA)

oxidoreductase activity (IEA,ISO)

oxygen binding (IDA)

protein binding (ISO)

superoxide dismutase activity (IBA,IDA,IEA,ISO,ISS)

Molecular Pathway Annotations Click to see Annotation Detail View

Huntington's disease pathway (IEA)

hypertension pathway (IDA)

References

References - curated

#	Reference Title	Reference Citation
1.	Inflammatory cytokines and reactive oxygen species as mediators of chronic kidney disease-related vascular calcification.	Agharazii M, etal., Am J Hypertens. 2015 Jun;28(6):746-55. doi: 10.1093/ajh/hpu225. Epub 2014 Nov 27.
2.	Expression and polymorphism (rs4880) of mitochondrial superoxide dismutase (SOD2) and asparaginase induced hepatotoxicity in adult patients with acute lymphoblastic leukemia.	Alachkar H, etal., Pharmacogenomics J. 2016 Mar 29. doi: 10.1038/tpj.2016.7.
3.	Effects of static magnetic field exposure on antioxidative enzymes activity and DNA in rat brain.	Amara S, etal., Gen Physiol Biophys. 2009 Sep;28(3):260-5.
4.	Mice with a partial deficiency of manganese superoxide dismutase show increased vulnerability to the mitochondrial toxins malonate, 3-nitropropionic acid, and MPTP.	Andreassen OA, etal., Exp Neurol. 2001 Jan;167(1):189-95. doi: 10.1006/exnr.2000.7525.
5.	Hydrogen peroxide affects contractile activity and anti-oxidant enzymes in rat uterus.	Appiah I, etal., Br J Pharmacol. 2009 Dec;158(8):1932-41. Epub .
6.	Possible role of increased oxidative stress in pulmonary hypertension in experimental diaphragmatic hernia.	Aras-Lopez R, etal., Pediatr Surg Int. 2016 Feb;32(2):141-5. doi: 10.1007/s00383-015-3826-5. Epub 2015 Nov 3.
7.	Epigenetic attenuation of mitochondrial superoxide dismutase 2 in pulmonary arterial hypertension: a basis for excessive cell proliferation and a new therapeutic target.	Archer SL, etal., Circulation. 2010 Jun 22;121(24):2661-71. doi: 10.1161/CIRCULATIONAHA.109.916098. Epub 2010 Jun 7.
8.	Postischemic recovery of contractile function is impaired in SOD2(+/-) but not SOD1(+/-) mouse hearts.	Asimakis GK, etal., Circulation. 2002 Feb 26;105(8):981-6.
9.	Pattern of superoxide dismutase enzymatic activity and RNA changes in rat heart ventricles after myocardial infarction.	Assem M, etal., Am J Pathol. 1997 Aug;151(2):549-55.
10.	Nutrition- and virus-induced stress represses the expression of manganese superoxide dismutase in vitro.	Berger MM, etal., Exp Biol Med (Maywood). 2004 Sep;229(8):843-9.
11.	Polymorphism in the manganese superoxide dismutase (MnSOD) gene and risk of breast cancer in young women.	Bergman M, etal., J Cancer Res Clin Oncol. 2005 Jul;131(7):439-44. Epub 2005 May 10.
12.	Alteration in the expression of inflammatory parameters as a result of oxidative stress produced by moderate zinc deficiency in rat lung.	Biaggio VS, etal., Exp Lung Res. 2010 Feb;36(1):31-44.
13.	Chimeric SOD2/3 inhibits at the endothelial-neutrophil interface to limit vascular dysfunction in ischemia-reperfusion.	Bonder CS, etal., Am J Physiol Gastrointest Liver Physiol. 2004 Sep;287(3):G676-84. Epub 2004 Apr 15.
14.	Superoxide Dismutase 2 Polymorphisms and Osteoporosis in Asian Indians: A Genetic Association Analysis.	Botre C, etal., Cell Mol Biol Lett. 2015 Dec;20(4):685-97. doi: 10.1515/cmble-2015-0041.
15.	Rat mitochondrial manganese superoxide dismutase: amino acid positions involved in covalent modifications, activity, and heat stability.	Castellano I, etal., Biopolymers. 2009 Dec;91(12):1215-26.
16.	Genetic Variation of Superoxide Dismutases in Patients with Primary Open-angle Glaucoma.	Celojevic D, etal., Ophthalmic Genet. 2013 May 2.
17.	Reduction in molecular synthesis or enzyme activity of superoxide dismutases and catalase contributes to oxidative stress and neurogenic hypertension in spontaneously hypertensive rats.	Chan SH, etal., Free Radic Biol Med. 2006 Jun 1;40(11):2028-39. Epub 2006 Feb 21.
18.	Gene expression changes after hypoxic preconditioning in rat hepatocytes.	Chen W, etal., Hepatobiliary Pancreat Dis Int. 2006 Aug;5(3):416-21.
19.	Peroxisome proliferator-activated receptor γ co-activator 1-α as a critical co-activator of the murine hepatic oxidative stress response and mitochondrial biogenesis in Staphylococcus aureus sepsis.	Cherry AD, etal., J Biol Chem. 2014 Jan 3;289(1):41-52. doi: 10.1074/jbc.M113.512483. Epub 2013 Nov 19.
20.	Superoxide dismutase inactivation in pathophysiology of asthmatic airway remodeling and reactivity.	Comhair SA, etal., Am J Pathol. 2005 Mar;166(3):663-74.
21.	Manganese superoxide dismutase enhances the invasive and migratory activity of tumor cells.	Connor KM, etal., Cancer Res. 2007 Nov 1;67(21):10260-7.
22.	Regulation of lung oxidative damage by endogenous superoxide dismutase in sepsis.	Constantino L, etal., Intensive Care Med Exp. 2014 Dec;2(1):17. doi: 10.1186/2197-425X-2-17. Epub 2014 May 23.
23.	Expression of antioxidant enzymes in diseases of the human pancreas: another link between chronic pancreatitis and pancreatic cancer.	Cullen JJ, etal., Pancreas. 2003 Jan;26(1):23-7.
24.	Association of genetic polymorphisms in SOD2, SOD3, GPX3, and GSTT1 with hypertriglyceridemia and low HDL-C level in subjects with high risk of coronary artery disease.	Decharatchakul N, etal., PeerJ. 2019 Aug 1;7:e7407. doi: 10.7717/peerj.7407. eCollection 2019.
25.	Manganese superoxide dismutase is a p53-regulated gene that switches cancers between early and advanced stages.	Dhar SK, etal., Cancer Res. 2011 Nov 1;71(21):6684-95. doi: 10.1158/0008-5472.CAN-11-1233. Epub 2011 Oct 18.
26.	iTRAQ-based proteomics reveals SOD2 as a potential salivary biomarker in liver cancer.	Ding F, etal., Int J Biol Markers. 2019 Sep;34(3):221-231. doi: 10.1177/1724600819841619. Epub 2019 May 1.
27.	Human neuronal changes in brain edema and increased intracranial pressure.	Faragó N, etal., Acta Neuropathol Commun. 2016 Aug 4;4(1):78. doi: 10.1186/s40478-016-0356-x.
28.	Acute and/or chronic stress models modulate CuZnSOD and MnSOD protein expression in rat liver.	Filipovic D, etal., Mol Cell Biochem. 2009 Dec 19.
29.	Gene polymorphisms of superoxide dismutases and catalase in diabetes mellitus.	Flekac M, etal., BMC Med Genet. 2008 Apr 21;9:30.
30.	Paraoxonase and superoxide dismutase gene polymorphisms and noise-induced hearing loss.	Fortunato G, etal., Clin Chem. 2004 Nov;50(11):2012-8. Epub 2004 Sep 2.
31.	Superoxide dismutase responds to hyperoxia in rat hippocampus.	Freiberger J, etal., Undersea Hyperb Med. 2004 Summer;31(2):227-32.
32.	Absence of mitochondrial superoxide dismutase results in a murine hemolytic anemia responsive to therapy with a catalytic antioxidant.	Friedman JS, etal., J Exp Med. 2001 Apr 16;193(8):925-34.
33.	Sensitivity of liver injury in heterozygous Sod2 knockout mice treated with troglitazone or acetaminophen.	Fujimoto K, etal., Toxicol Pathol. 2009 Feb;37(2):193-200. doi: 10.1177/0192623308329282.
34.	Manganese superoxide dismutase mediates the early release of mitochondrial cytochrome C and subsequent DNA fragmentation after permanent focal cerebral ischemia in mice.	Fujimura M, etal., J Neurosci. 1999 May 1;19(9):3414-22.
35.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
36.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
37.	Manganese superoxide dismutase gene (SOD2) polymorphism and exudative age-related macular degeneration in the Japanese population.	Gotoh N, etal., Am J Ophthalmol. 2008 Jul;146(1):146; author reply 146-7. doi: 10.1016/j.ajo.2008.03.017.
38.	Natural compound methyl protodioscin protects rat brain from ischemia/reperfusion injury through regulation of Mul1/SOD2 pathway.	Guo S, etal., Eur J Pharmacol. 2019 Apr 15;849:50-58. doi: 10.1016/j.ejphar.2019.01.057. Epub 2019 Feb 1.
39.	Joint effects of alcohol consumption and polymorphisms in alcohol and oxidative stress metabolism genes on risk of head and neck cancer.	Hakenewerth AM, etal., Cancer Epidemiol Biomarkers Prev. 2011 Nov;20(11):2438-49. doi: 10.1158/1055-9965.EPI-11-0649. Epub 2011 Sep 22.
40.	MnSOD antisense treatment and exercise-induced protection against arrhythmias.	Hamilton KL, etal., Free Radic Biol Med. 2004 Nov 1;37(9):1360-8.
41.	RORalpha decreases oxidative stress through the induction of SOD2 and GPx1 expression and thereby protects against nonalcoholic steatohepatitis in mice.	Han YH, etal., Antioxid Redox Signal. 2014 Nov 20;21(15):2083-94. doi: 10.1089/ars.2013.5655. Epub 2014 Apr 10.
42.	Enhanced expression of manganese-dependent superoxide dismutase in human and sheep CLN6 tissues.	Heine C, etal., Biochem J. 2003 Dec 1;376(Pt 2):369-76.
43.	Polymorphisms in the SOD2 and HLA-DRB1 genes are associated with nonfamilial idiopathic dilated cardiomyopathy in Japanese.	Hiroi S, etal., Biochem Biophys Res Commun. 1999 Aug 2;261(2):332-9.
44.	Nucleotide sequences of cDNAs coding for rat manganese-containing superoxide dismutase.	Ho YS and Crapo JD, Nucleic Acids Res 1987 Dec 10;15(23):10070.
45.	Molecular structure of a functional rat gene for manganese-containing superoxide dismutase.	Ho YS, etal., Am J Respir Cell Mol Biol 1991 Mar;4(3):278-86.
46.	Epigenetic silencing of manganese superoxide dismutase (SOD-2) in KAS 6/1 human multiple myeloma cells increases cell proliferation.	Hodge DR, etal., Cancer Biol Ther. 2005 May;4(5):585-92. Epub 2005 May 5.
47.	Functional polymorphism in the manganese superoxide dismutase (MnSOD) gene in patients with asthma.	Holla LI, etal., Clin Biochem. 2006 Mar;39(3):299-302. Epub 2006 Jan 19.
48.	Mitochondrial manganese-superoxide dismutase expression in ovarian cancer: role in cell proliferation and response to oxidative stress.	Hu Y, etal., J Biol Chem. 2005 Nov 25;280(47):39485-92. Epub 2005 Sep 22.
49.	MicroRNA and mRNA expression profiling in rat acute respiratory distress syndrome.	Huang C, etal., BMC Med Genomics. 2014 Jul 28;7:46. doi: 10.1186/1755-8794-7-46.
50.	Genetic modification of prenatal lethality and dilated cardiomyopathy in Mn superoxide dismutase mutant mice.	Huang TT, etal., Free Radic Biol Med. 2001 Nov 1;31(9):1101-10.
51.	Superoxide Dismutase 2 Genetic Variation as a Susceptibility Risk Factor for Alcoholic Cirrhosis.	Huang YS, etal., Alcohol Alcohol. 2016 Feb 11. pii: agw004.
52.	Genetic variations of superoxide dismutase 2 and cytochrome P450 2E1 in non-alcoholic steatohepatitis.	Huang YS, etal., Liver Int. 2014 Jul;34(6):931-6. doi: 10.1111/liv.12533. Epub 2014 Apr 4.
53.	Time response of carboplatin-induced hearing loss in rat.	Husain K, etal., Hear Res. 2004 May;191(1-2):110-8.
54.	Therapeutic effects of acupuncture with MOK, a polyherbal medicine, on PTU-induced hypothyroidism in rats.	Hwang JH, etal., Exp Ther Med. 2018 Jul;16(1):310-320. doi: 10.3892/etm.2018.6190. Epub 2018 May 18.
55.	Effect of cadmium on 24-hour pattern in expression of redox enzyme and clock genes in rat medial basal hypothalamus.	Jimenez-Ortega V, etal., Biometals. 2010 Apr;23(2):327-37. Epub 2010 Jan 27.
56.	MnSOD in mouse heart: acute responses to ischemic preconditioning and ischemia-reperfusion injury.	Jin ZQ, etal., Am J Physiol Heart Circ Physiol. 2005 Jun;288(6):H2986-94. Epub 2005 Jan 28.
57.	Age-associated increases in oxidative stress and antioxidant enzyme activities in cardiac interfibrillar mitochondria: implications for the mitochondrial theory of aging.	Judge S, etal., FASEB J. 2005 Mar;19(3):419-21. Epub 2005 Jan 10.
58.	SOD2 knockdown mouse model of early AMD.	Justilien V, etal., Invest Ophthalmol Vis Sci. 2007 Oct;48(10):4407-20.
59.	The signal sequence polymorphism of the MnSOD gene is associated with the degree of carotid atherosclerosis.	Kakko S, etal., Atherosclerosis. 2003 May;168(1):147-52.
60.	Antioxidant enzyme gene expression in congestive heart failure following myocardial infarction.	Khaper N, etal., Mol Cell Biochem. 2003 Sep;251(1-2):9-15.
61.	Association of mitochondrial antioxidant enzymes with mitochondrial DNA as integral nucleoid constituents.	Kienhofer J, etal., FASEB J. 2009 Feb 19.
62.	Differential expression of EC-SOD, Mn-SOD and CuZn-SOD in rat lung exposed to crystalline silica.	Kim H, etal., J Occup Health. 2007 May;49(3):242-8.
63.	Reactive oxygen species/oxidative stress contributes to progression of kidney fibrosis following transient ischemic injury in mice.	Kim J, etal., Am J Physiol Renal Physiol. 2009 Aug;297(2):F461-70. Epub 2009 May 20.
64.	An association between manganese superoxide dismutase polymorphism and outcome of chemotherapy in acute myeloid leukemia.	Koistinen P, etal., Haematologica. 2006 Jun;91(6):829-32.
65.	MnSOD expression within tumor cells is closely related to mode of invasion in human gastric cancer.	Korenaga D, etal., Oncol Rep. 2003 Jan-Feb;10(1):27-30.
66.	Involvement of superoxide dismutase isoenzymes and their genetic variants in progression of and higher susceptibility to vitiligo.	Laddha NC, etal., Free Radic Biol Med. 2013 Dec;65:1110-25. doi: 10.1016/j.freeradbiomed.2013.08.189. Epub 2013 Sep 12.
67.	Exercise training inducibility of MnSOD protein expression and activity is retained while reducing prooxidant signaling in the heart of senescent rats.	Lawler JM, etal., Am J Physiol Regul Integr Comp Physiol. 2009 May;296(5):R1496-502. Epub 2009 Mar 18.
68.	Neurodegeneration, myocardial injury, and perinatal death in mitochondrial superoxide dismutase-deficient mice.	Lebovitz RM, etal., Proc Natl Acad Sci U S A. 1996 Sep 3;93(18):9782-7.
69.	Dietary schizophyllan reduces mitochondrial damage by activating SIRT3 in mice.	Lee D, etal., Arch Pharm Res. 2020 Apr;43(4):449-461. doi: 10.1007/s12272-020-01231-4. Epub 2020 Mar 31.
70.	Polydatin protects hepatocytes against mitochondrial injury in acute severe hemorrhagic shock via SIRT1-SOD2 pathway.	Li P, etal., Expert Opin Ther Targets. 2015 Jul;19(7):997-1010. doi: 10.1517/14728222.2015.1054806.
71.	Time dependent bladder apoptosis induced by acute bladder outlet obstruction and subsequent emptying is associated with decreased MnSOD expression and Bcl-2/Bax ratio.	Li WJ, etal., J Korean Med Sci. 2010 Nov;25(11):1652-6. Epub 2010 Oct 26.
72.	Ischemia and reperfusion of liver induces eNOS and iNOS expression: effects of a NO donor and NOS inhibitor.	Lin HI, etal., Chin J Physiol. 2004 Sep 30;47(3):121-7.
73.	Proteomic expression analysis of mycosis fungoides (MF) skin tissues: overexpressions of SOD2, S100A8 and FABP5 in MF.	Liu J, etal., J Dermatol Sci. 2010 Oct;60(1):42-4. doi: 10.1016/j.jdermsci.2010.07.014. Epub 2010 Aug 10.
74.	Ketamine-induced ulcerative cystitis and bladder apoptosis involve oxidative stress mediated by mitochondria and the endoplasmic reticulum.	Liu KM, etal., Am J Physiol Renal Physiol. 2015 Aug 15;309(4):F318-31. doi: 10.1152/ajprenal.00607.2014. Epub 2015 Jun 24.
75.	Effects of bis (2-butoxyethyl) phthalate on adrenocortical function in male rats in puberty partially via down-regulating NR5A1/NR4A1/NR4A2 pathways.	Liu M, etal., Environ Toxicol. 2022 Oct;37(10):2419-2433. doi: 10.1002/tox.23607. Epub 2022 Jun 28.
76.	Deregulation of manganese superoxide dismutase (SOD2) expression and lymph node metastasis in tongue squamous cell carcinoma.	Liu X, etal., BMC Cancer. 2010 Jul 9;10:365. doi: 10.1186/1471-2407-10-365.
77.	Effects of antioxidant gene therapy on retinal neurons and oxidative stress in a model of retinal ischemia/reperfusion.	Liu Y, etal., Free Radic Biol Med. 2012 Mar 1;52(5):909-15. doi: 10.1016/j.freeradbiomed.2011.12.013. Epub 2011 Dec 24.
78.	SOD2 V16A SNP in the mitochondrial targeting sequence is associated with noise induced hearing loss in Chinese workers.	Liu YM, etal., Dis Markers. 2010;28(3):137-47. doi: 10.3233/DMA-2010-0693.
79.	Increased mRNA expression of manganese superoxide dismutase in psoriasis skin lesions and in cultured human keratinocytes exposed to IL-1 beta and TNF-alpha.	Lontz W, etal., Free Radic Biol Med. 1995 Feb;18(2):349-55.
80.	Mitochondrial superoxide dismutase and glutathione peroxidase in idiosyncratic drug-induced liver injury.	Lucena MI, etal., Hepatology. 2010 Jul;52(1):303-12. doi: 10.1002/hep.23668.
81.	Aging and the brown Norway rat leydig cell antioxidant defense system.	Luo L, etal., J Androl. 2006 Mar-Apr;27(2):240-7. Epub 2005 Nov 22.
82.	Mitochondrial oxidative stress-induced apoptosis and radioprotection in proton-irradiated rat retina.	Mao XW, etal., Radiat Res. 2012 Sep;178(3):118-25. Epub 2012 Jul 10.
83.	Differential neuronal expression of manganese superoxide dismutase in Alzheimer's disease.	Marcus DL, etal., Med Sci Monit. 2006 Jan;12(1):BR8-14. Epub 2005 Dec 19.
84.	Chemoprevention of carcinogenic progression to esophageal adenocarcinoma by the manganese superoxide dismutase supplementation.	Martin RC, etal., Clin Cancer Res. 2007 Sep 1;13(17):5176-82.
85.	No apparent association between genetic polymorphisms (-102 C>T) and (-9 T>C) in the human manganese superoxide dismutase gene and gastric cancer(1).	Martin RC, etal., J Surg Res. 2005 Mar;124(1):92-7.
86.	Regulation of oxidative stress and inflammation by hepatic adiponectin receptor 2 in an animal model of nonalcoholic steatohepatitis.	Matsunami T, etal., Int J Clin Exp Pathol. 2010 May 22;3(5):472-81.
87.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
88.	A functional polymorphism in the manganese superoxide dismutase gene and diabetic nephropathy.	Mollsten A, etal., Diabetes. 2007 Jan;56(1):265-9.
89.	Manganese intoxication decreases the expression of manganoproteins in the rat basal ganglia: an immunohistochemical study.	Morello M, etal., Brain Res Bull. 2007 Nov 1;74(6):406-15. Epub 2007 Aug 2.
90.	Mitochondrial superoxide plays a crucial role in the development of mitochondrial dysfunction during high glucose exposure in rat renal proximal tubular cells.	Munusamy S and MacMillan-Crow LA, Free Radic Biol Med. 2009 Apr 15;46(8):1149-57. Epub 2009 Feb 3.
91.	Myeloperoxidase and superoxide dismutase 2 polymorphisms comodulate the risk of hepatocellular carcinoma and death in alcoholic cirrhosis.	Nahon P, etal., Hepatology. 2009 Nov;50(5):1484-93. doi: 10.1002/hep.23187.
92.	Polymorphisms of microsomal triglyceride transfer protein gene and manganese superoxide dismutase gene in non-alcoholic steatohepatitis.	Namikawa C, etal., J Hepatol. 2004 May;40(5):781-6.
93.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
94.	Elevated serum manganese superoxide dismutase in acute leukemias.	Nishiura T, etal., Cancer Lett. 1992 Mar 15;62(3):211-5.
95.	In situ reduction of oxidative damage, increased cell turnover, and delay of mitochondrial injury by overexpression of manganese superoxide dismutase in a multistage skin carcinogenesis model.	Oberley TD, etal., Antioxid Redox Signal. 2004 Jun;6(3):537-48.
96.	Wheat germ supplementation alleviates insulin resistance and cardiac mitochondrial dysfunction in an animal model of diet-induced obesity.	Ojo B, etal., Br J Nutr. 2017 Aug;118(4):241-249. doi: 10.1017/S0007114517002082.
97.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
98.	Elevated level of serum Mn-superoxide dismutase in patients with primary biliary cirrhosis: possible involvement of free radicals in the pathogenesis in primary biliary cirrhosis.	Ono M, etal., J Lab Clin Med. 1991 Nov;118(5):476-83.
99.	Reduction in superoxide dismutase expression in the epithelial mucosa of eosinophilic chronic rhinosinusitis with nasal polyps.	Ono N, etal., Int Arch Allergy Immunol. 2013;162(2):173-80. doi: 10.1159/000353122. Epub 2013 Jul 31.
100.	Superoxide dismutase in the prostate lobes of aging Brown Norway rats.	Pechenino AS and Brown TR, Prostate. 2006 Apr 1;66(5):522-35.
101.	Effect of Ca(2+) and Mg(2+) on the Mn-superoxide dismutase from rat liver and heart mitochondria.	Perez-Vazquez V, etal., Amino Acids. 2002 Jun;22(4):405-16.
102.	Effect of a single session of electrical stimulation on activity and expression of citrate synthase and antioxidant enzymes in rat soleus muscle.	Pimenta Ada S, etal., Eur J Appl Physiol. 2007 Dec;102(1):119-26. Epub 2007 Oct 26.
103.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
104.	Different roles of Sp family members in HIV-1 Tat-mediated manganese superoxide dismutase suppression in hepatocellular carcinoma cells.	Porntadavity S, etal., DNA Cell Biol. 2005 May;24(5):299-310.
105.	SOD2 gene transfer protects against optic neuropathy induced by deficiency of complex I.	Qi X, etal., Ann Neurol. 2004 Aug;56(2):182-91.
106.	Optic neuropathy induced by reductions in mitochondrial superoxide dismutase.	Qi X, etal., Invest Ophthalmol Vis Sci. 2003 Mar;44(3):1088-96.
107.	Suppression of mitochondrial oxidative stress provides long-term neuroprotection in experimental optic neuritis.	Qi X, etal., Invest Ophthalmol Vis Sci. 2007 Feb;48(2):681-91.
108.	Over-expression of Mn-superoxide dismutase as a marker of oxidative stress in lesional skin of chronic idiopathic urticaria.	Raho G, etal., Clin Exp Dermatol. 2003 May;28(3):318-20.
109.	Effect of ascorbic acid on blood oxidative stress in experimental chronic arsenicosis in rodents.	Rana T, etal., Food Chem Toxicol. 2010 Apr;48(4):1072-7. Epub 2010 Feb 1.
110.	Manganese superoxide dismutase activity in the rat adrenal.	Raza FS, etal., J Endocrinol. 2005 Jan;184(1):77-84.
111.	GOA pipeline	RGD automated data pipeline
112.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
113.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
114.	Diabetic rat testes: morphological and functional alterations.	Ricci G, etal., Andrologia. 2009 Dec;41(6):361-8.
115.	Manganese superoxide dismutase as a target of autoantibodies in acute Epstein-Barr virus infection.	Ritter K, etal., J Exp Med. 1994 Nov 1;180(5):1995-8.
116.	Proteomic analysis of human thyroid cell lines reveals reduced nuclear localization of Mn-SOD in poorly differentiated thyroid cancer cells.	Russo D, etal., J Endocrinol Invest. 2005 Feb;28(2):137-44.
117.	The mitochondrial antioxidants thioredoxin-2 and Mn-superoxide dismutase are involved in the mechanisms of brain hypoxic tolerance.	Samoilov MO, etal., Dokl Biol Sci 2002 Nov-Dec;387:498-500.
118.	Serum manganese superoxide dismutase is a new tumour marker for malignant melanoma.	Schadendorf D, etal., Melanoma Res. 1995 Oct;5(5):351-3.
119.	Selenium supplementation increases liver MnSOD expression: molecular mechanism for hepato-protection.	Shilo S, etal., J Inorg Biochem. 2008 Jan;102(1):110-8. Epub 2007 Aug 1.
120.	Differential regulation of the superoxide dismutase family in experimental aortic aneurysms and rat aortic explants.	Sinha I, etal., J Surg Res. 2007 Apr;138(2):156-62. Epub 2006 Dec 29.
121.	Effects of caloric restriction on mitochondrial function and gene transcripts in rat muscle.	Sreekumar R, etal., Am J Physiol Endocrinol Metab 2002 Jul;283(1):E38-43.
122.	Valine-alanine manganese superoxide dismutase polymorphism is not associated with alcohol-induced oxidative stress or liver fibrosis.	Stewart SF, etal., Hepatology. 2002 Dec;36(6):1355-60.
123.	The -9Ala/-9Val polymorphism in the mitochondrial targeting sequence of the manganese superoxide dismutase gene (MnSOD) is associated with age among Hispanics with colorectal carcinoma.	Stoehlmacher J, etal., Oncol Rep. 2002 Mar-Apr;9(2):235-8.
124.	Heterozygous deficiency of manganese superoxide dismutase results in severe lipid peroxidation and spontaneous apoptosis in murine myocardium in vivo.	Strassburger M, etal., Free Radic Biol Med. 2005 Jun 1;38(11):1458-70.
125.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
126.	Quantitative analysis of SOD2, ALDH1A1 and MGST1 messenger ribonucleic acid in anterior lens epithelium of patients with pseudoexfoliation syndrome.	Strzalka-Mrozik B, etal., Mol Vis. 2013 Jun 12;19:1341-9. Print 2013.
127.	Effects of selegiline on antioxidant systems in the nigrostriatum in rat.	Takahata K, etal., J Neural Transm. 2006 Feb;113(2):151-8. Epub 2005 Jun 15.
128.	Propargylamines induce antiapoptotic new protein synthesis in serum- and nerve growth factor (NGF)-withdrawn, NGF-differentiated PC-12 cells.	Tatton WG, etal., J Pharmacol Exp Ther. 2002 May;301(2):753-64.
129.	Immunohistochemical expression of superoxide dismutase (MnSOD) anti-oxidant enzyme in invasive breast carcinoma.	Tsanou E, etal., Histol Histopathol. 2004 Jul;19(3):807-13.
130.	Increased expression of manganese superoxide dismutase is associated with that of nitrotyrosine in myopathies with rimmed vacuoles.	Tsuruta Y, etal., Acta Neuropathol (Berl). 2002 Jan;103(1):59-65.
131.	Increased expression of catalase and superoxide dismutase 2 reduces cone cell death in retinitis pigmentosa.	Usui S, etal., Mol Ther. 2009 May;17(5):778-86. doi: 10.1038/mt.2009.47. Epub 2009 Mar 17.
132.	The mitochondrial superoxide dismutase A16V polymorphism in the cardiomyopathy associated with hereditary haemochromatosis.	Valenti L, etal., J Med Genet. 2004 Dec;41(12):946-50.
133.	Life-long reduction in MnSOD activity results in increased DNA damage and higher incidence of cancer but does not accelerate aging.	Van Remmen H, etal., Physiol Genomics. 2003 Dec 16;16(1):29-37.
134.	Overexpression of manganese superoxide dismutase promotes the survival of prostate cancer cells exposed to hyperthermia.	Venkataraman S, etal., Free Radic Res. 2004 Oct;38(10):1119-32.
135.	Lack of association between MnSOD gene polymorphism and sporadic Alzheimer's disease.	Ventriglia M, etal., Aging Clin Exp Res. 2005 Dec;17(6):445-8.
136.	Asbestos exposure, manganese superoxide dismutase (MnSOD) genotype, and lung cancer risk.	Wang LI, etal., J Occup Environ Med. 2004 Jun;46(6):556-64.
137.	Reduced SOD2 expression is associated with mortality of hepatocellular carcinoma patients in a mutant p53-dependent manner.	Wang R, etal., Aging (Albany NY). 2016 Jun;8(6):1184-200. doi: 10.18632/aging.100967.
138.	Oxidative stress in rats with hyperhomo-cysteinemia and intervention effect of lutein.	Wang S, etal., Eur Rev Med Pharmacol Sci. 2014;18(3):359-64.
139.	Sirtuin 1 activation enhances the PGC-1alpha/mitochondrial antioxidant system pathway in status epilepticus.	Wang SJ, etal., Mol Med Rep. 2015 Jan;11(1):521-6. doi: 10.3892/mmr.2014.2724. Epub 2014 Oct 21.
140.	Altered gene expression in neural crest cells exposed to ethanol in vitro.	Wentzel P and Eriksson UJ, Brain Res. 2009 Dec 11;1305 Suppl:S50-60. Epub 2009 Aug 22.
141.	Suppression of the malignant phenotype in human pancreatic cancer cells by the overexpression of manganese superoxide dismutase.	Weydert C, etal., Mol Cancer Ther. 2003 Apr;2(4):361-9.
142.	Myeloperoxidase and superoxide dismutase polymorphisms are associated with an increased risk of developing pancreatic adenocarcinoma.	Wheatley-Price P, etal., Cancer. 2008 Mar 1;112(5):1037-42.
143.	Overexpression of manganese superoxide dismutase prevents alcohol-induced liver injury in the rat.	Wheeler MD, etal., J Biol Chem. 2001 Sep 28;276(39):36664-72. Epub 2001 Jul 26.
144.	Prevention of mitochondrial dysfunction in post-traumatic mouse brain by superoxide dismutase.	Xiong Y, etal., J Neurochem. 2005 Nov;95(3):732-44.
145.	Genetic redox preconditioning differentially modulates AP-1 and NF kappa B responses following cardiac ischemia/reperfusion injury and protects against necrosis and apoptosis.	Yang J, etal., Mol Ther. 2003 Mar;7(3):341-53.
146.	Manganese superoxide dismutase polymorphism, treatment-related toxicity and disease-free survival in SWOG 8897 clinical trial for breast cancer.	Yao S, etal., Breast Cancer Res Treat. 2010 Nov;124(2):433-9. doi: 10.1007/s10549-010-0840-0. Epub 2010 Mar 23.
147.	Cytochrome P450 1A1 and manganese superoxide dismutase genes polymorphisms in ankylosing spondylitis.	Yen JH, etal., Immunol Lett. 2003 Aug 5;88(2):113-6.
148.	Cytochrome P450 1A1 and manganese superoxide dismutase genes polymorphisms in reactive arthritis.	Yen JH, etal., Immunol Lett. 2003 Dec 15;90(2-3):151-4.
149.	Cytochrome P450 and manganese superoxide dismutase genes polymorphisms in systemic lupus erythematosus.	Yen JH, etal., Immunol Lett. 2003 Nov 15;90(1):19-24.
150.	Knockdown of superoxide dismutase 2 enhances acetaminophen-induced hepatotoxicity in rat.	Yoshikawa Y, etal., Toxicology. 2009 Oct 1;264(1-2):89-95. doi: 10.1016/j.tox.2009.07.017. Epub 2009 Jul 30.
151.	Down-regulation of manganese-superoxide dismutase gene expression in idiopathic nephrotic syndrome.	Yoshioka T, etal., J Pediatr. 1997 May;130(5):800-7.
152.	Pseudoxanthoma elasticum: genetic variations in antioxidant genes are risk factors for early disease onset.	Zarbock R, etal., Clin Chem. 2007 Oct;53(10):1734-40. Epub 2007 Aug 10.
153.	Age-Related Decrease in the Mitochondrial Sirtuin Deacetylase Sirt3 Expression Associated with ROS Accumulation in the Auditory Cortex of the Mimetic Aging Rat Model.	Zeng L, etal., PLoS One. 2014 Feb 4;9(2):e88019. doi: 10.1371/journal.pone.0088019. eCollection 2014.
154.	Polydatin Alleviates Small Intestine Injury during Hemorrhagic Shock as a SIRT1 Activator.	Zeng Z, etal., Oxid Med Cell Longev. 2015;2015:965961. doi: 10.1155/2015/965961. Epub 2015 Aug 2.
155.	Impaired cytoprotective mechanisms in eyes with pseudoexfoliation syndrome/glaucoma.	Zenkel M, etal., Invest Ophthalmol Vis Sci. 2007 Dec;48(12):5558-66.
156.	Interaction between polymorphisms of the dopamine D3 receptor and manganese superoxide dismutase genes in susceptibility to tardive dyskinesia.	Zhang ZJ, etal., Psychiatr Genet. 2003 Sep;13(3):187-92.
157.	Manganese superoxide dismutase deficiency enhances cell turnover via tumor promoter-induced alterations in AP-1 and p53-mediated pathways in a skin cancer model.	Zhao Y, etal., Oncogene. 2002 May 30;21(24):3836-46.
158.	[Association of the SOD2 Ala(-9)Val and SOD3 Arg213Gly polymorphisms with diabetic polyneuropathy in patients with diabetes mellitus type 1]	Zotova EV, etal., Mol Biol (Mosk). 2003 May-Jun;37(3):404-8.

Additional References at PubMed

PMID:7333654	PMID:7493016	PMID:9393747	PMID:9462746	PMID:9651187	PMID:9927656	PMID:10049502	PMID:11156968	PMID:11226230	PMID:11527927	PMID:11583975	PMID:11796207
PMID:12176043	PMID:12551919	PMID:12646716	PMID:12709579	PMID:12769190	PMID:12865426	PMID:12931191	PMID:14651853	PMID:14980699	PMID:15182862	PMID:15205258	PMID:15375579
PMID:15489334	PMID:15637112	PMID:15642323	PMID:15781740	PMID:16103131	PMID:16219542	PMID:16238459	PMID:16677818	PMID:16843623	PMID:16873728	PMID:17023425	PMID:17023572
PMID:17145560	PMID:17215005	PMID:17322295	PMID:17349848	PMID:17367743	PMID:17597094	PMID:17634366	PMID:17670746	PMID:17923681	PMID:18218638	PMID:18559338	PMID:18614015
PMID:19047792	PMID:19265433	PMID:19376215	PMID:19478076	PMID:19500508	PMID:19774674	PMID:19822147	PMID:19893080	PMID:20235222	PMID:20489163	PMID:20495008	PMID:20654064
PMID:21143912	PMID:21357467	PMID:21506880	PMID:21625958	PMID:21942371	PMID:21988832	PMID:22043833	PMID:22171425	PMID:22474353	PMID:22540739	PMID:22732938	PMID:22758933
PMID:22829583	PMID:22981416	PMID:23157833	PMID:23168492	PMID:23195678	PMID:23238024	PMID:23275324	PMID:23376485	PMID:23533145	PMID:23935993	PMID:24191052	PMID:24465521
PMID:24563852	PMID:25978844	PMID:26071777	PMID:26231211	PMID:26316108	PMID:26721595	PMID:26770652	PMID:27021683	PMID:27067422	PMID:29116107	PMID:29775122	PMID:29847079
PMID:30502252	PMID:30811038	PMID:33099744	PMID:34169429	PMID:34670409	PMID:36153454	PMID:36922709	PMID:37921754	PMID:38659023

Genomics

Comparative Map Data

Sod2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	50,043,323 - 50,050,168 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	50,043,325 - 50,050,168 (-)	Ensembl				GRCr8
mRatBN7.2	1	47,638,318 - 47,645,163 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	47,636,528 - 47,645,189 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	48,187,171 - 48,194,016 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	54,175,067 - 54,181,918 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	48,262,686 - 48,269,531 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	47,914,757 - 47,921,587 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	47,914,759 - 47,921,587 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	51,827,380 - 51,834,232 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	41,862,997 - 41,870,327 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	43,323,111 - 43,329,909 (-)	NCBI		Celera
RGSC_v3.1	1	41,865,943 - 41,873,272 (-)	NCBI
Cytogenetic Map	1	q11	NCBI

SOD2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	159,669,069 - 159,762,281 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	159,669,069 - 159,762,529 (-)	Ensembl			hg38	GRCh38
GRCh37	6	160,090,101 - 160,183,313 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	160,020,138 - 160,034,343 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	6	160,073,582 - 160,084,614	NCBI
Celera	6	160,747,601 - 160,761,803 (-)	NCBI		Celera
Cytogenetic Map	6	q25.3	NCBI
HuRef	6	157,570,584 - 157,584,704 (-)	NCBI		HuRef
CHM1_1	6	160,363,031 - 160,377,215 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	6	160,914,924 - 161,007,912 (-)	NCBI		T2T-CHM13v2.0

Sod2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	17	13,226,726 - 13,237,006 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	17	13,225,733 - 13,258,950 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	17	13,007,839 - 13,018,119 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	17	13,006,846 - 13,040,063 (+)	Ensembl			mm10	GRCm38
MGSCv37	17	13,200,705 - 13,210,985 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	17	12,850,771 - 12,861,051 (+)	NCBI		MGSCv36	mm8
Celera	17	13,040,822 - 13,051,101 (+)	NCBI		Celera
Cytogenetic Map	17	A1	NCBI
cM Map	17	8.75	NCBI

Sod2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955439	21,209,101 - 21,224,163 (+)	Ensembl
ChiLan1.0	NW_004955439	21,209,101 - 21,223,538 (+)	NCBI	ChiLan1.0	ChiLan1.0

SOD2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	5	179,778,227 - 179,792,471 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	6	177,683,324 - 177,697,556 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	157,562,814 - 157,610,155 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	162,576,082 - 162,589,960 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	6	162,576,082 - 162,589,960 (-)	Ensembl			panPan2	panpan1.1

SOD2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	48,943,472 - 48,955,158 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	48,836,262 - 48,955,706 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	49,785,674 - 49,797,617 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	49,127,570 - 49,139,634 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	49,020,475 - 49,139,710 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	49,010,294 - 49,022,236 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	48,881,250 - 48,893,258 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	49,447,616 - 49,459,607 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Sod2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404946	143,926,345 - 143,939,641 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936489	11,178,015 - 11,191,781 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936489	11,178,338 - 11,191,601 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SOD2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	7,679,352 - 7,689,560 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	1	7,679,352 - 7,689,564 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	9,475,310 - 9,485,526 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SOD2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	13	87,284,537 - 87,297,998 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	13	87,280,686 - 87,297,974 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666040	59,683,827 - 59,727,382 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Sod2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624855	3,260,809 - 3,271,367 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624855	3,260,800 - 3,271,864 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Sod2
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	2	191,754,042 - 191,761,832 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Sod2
23 total Variants

miRNA Target Status (No longer updated)

Confirmed Target Of

miRNA Gene	Mature miRNA	Method Name	Result Type	Data Type	Support Type	PMID
Mir145	rno-miR-145-5p	Mirtarbase	external_info	qRT-PCR//Western blot//Microarray	Functional MTI	19142192

Predicted Target Of

	Summary Value
Count of predictions:	184
Count of miRNA genes:	127
Interacting mature miRNAs:	142
Transcripts:	ENSRNOT00000025794
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331732	Srn4	Serum renin concentration QTL 4	4.467		renin activity (VT:0005581)	plasma renin activity level (CMO:0000116)	1	43457837	87558729	Rat
631688	Hcas2	Hepatocarcinoma susceptibility QTL 2	3	0.0001	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	7746118	52746118	Rat
1357397	Bw41	Body weight QTL 41	4.19	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	1	29409279	74409279	Rat
1358359	Sradr1	Stress Responsive Adrenal Weight QTL 1	4.74		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	39728272	132889942	Rat
4889929	Bss87	Bone structure and strength QTL 87	6.7		tibia area (VT:1000281)	tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722)	1	46302615	91302615	Rat
1331792	Rf29	Renal function QTL 29	4.589		urine potassium amount (VT:0010539)	urine potassium level (CMO:0000128)	1	43457837	87558729	Rat
2313062	Bmd73	Bone mineral density QTL 73	3.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	46302615	91302615	Rat
8552900	Pigfal1	Plasma insulin-like growth factor 1 level QTL 1	7.4		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	1	43509952	88509952	Rat
1354643	Foco2	Food consumption QTL 2	7.17	0.0001	eating behavior trait (VT:0001431)	food intake rate (CMO:0000427)	1	42122968	87122968	Rat
2313065	Bss67	Bone structure and strength QTL 67	3.1	0.0001	tibia area (VT:1000281)	tibia total energy absorbed before break (CMO:0001736)	1	46302615	91302615	Rat
7421626	Bp360	Blood pressure QTL 360		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	6941022	51941022	Rat
1357401	Bw43	Body weight QTL 43	3.75		body mass (VT:0001259)	body weight (CMO:0000012)	1	6909353	51909353	Rat
2313069	Bss68	Bone structure and strength QTL 68	2.9	0.0001	tibia size trait (VT:0100001)	tibia total energy absorbed before break (CMO:0001736)	1	46302615	91302615	Rat
631494	Bp95	Blood pressure QTL 95	40	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	17315378	51816258	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	34184556	172281316	Rat
2313075	Bss66	Bone structure and strength QTL 66	3.4	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	46302615	91302615	Rat
5684998	Bss101	Bone structure and strength QTL 101	3.6		tibia strength trait (VT:1000284)	tibia ultimate force (CMO:0001734)	1	6909353	51909353	Rat
5684999	Bss102	Bone structure and strength QTL 102	5.5	7e-07	tibia strength trait (VT:1000284)	tibia stiffness (CMO:0001735)	1	6909353	51909353	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	34565911	208798288	Rat
1331778	Rf28	Renal function QTL 28	4.66		urine potassium amount (VT:0010539)	urine potassium excretion rate (CMO:0000761)	1	43457837	87558729	Rat
2313077	Bss69	Bone structure and strength QTL 69	3.5	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	46302615	91302615	Rat
1578756	Iddm22	Insulin dependent diabetes mellitus QTL 22	2.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	20508326	65508326	Rat
1331785	Rf27	Renal function QTL 27	4.643		urine sodium amount (VT:0006274)	urine sodium level (CMO:0000129)	1	30708375	87558729	Rat
631508	Sald1	Serum aldosterone level QTL 1	3.7		blood aldosterone amount (VT:0005346)	serum aldosterone level (CMO:0000487)	1	11684464	56684464	Rat
1300172	Bp172	Blood pressure QTL 172	3.56		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	34565726	79565726	Rat
4889451	Eae29	Experimental allergic encephalomyelitis QTL 29	5.51		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	1	7746121	52746121	Rat
1558642	Prcr2	Prostate cancer resistance QTL 2	4.3		prostate integrity trait (VT:0010571)	area of ventral prostate occupied by tumorous lesions to total ventral prostate area ratio (CMO:0000899)	1	10379492	55379492	Rat
2313092	Bmd72	Bone mineral density QTL 72	2.5	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	46302615	91302615	Rat
2313097	Bss70	Bone structure and strength QTL 70	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	46302615	91302615	Rat
9589820	Insglur3	Insulin/glucose ratio QTL 3	10.75	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	1	43509952	88509952	Rat
1354599	Bw29	Body weight QTL 29	3.46	0.001	body mass (VT:0001259)	body weight (CMO:0000012)	1	42122968	87122968	Rat
2302038	Pia31	Pristane induced arthritis QTL 31	5.5	0.001	blood autoantibody amount (VT:0003725)	serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111)	1	12820494	57820494	Rat
4889919	Bss86	Bone structure and strength QTL 86	4.1		tibia area (VT:1000281)	tibia midshaft total cross-sectional area (CMO:0001715)	1	46302615	91302615	Rat
8552948	Pigfal11	Plasma insulin-like growth factor 1 level QTL 11	4.7		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	1	43509952	88509952	Rat
634353	Rends2	Renal damage susceptibility QTL 2		0.05	kidney blood vessel morphology trait (VT:0000530)	organ lesion measurement (CMO:0000677)	1	20656420	65656420	Rat

Markers in Region

RH130474

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	47,639,557 - 47,639,751 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	47,915,997 - 47,916,190	NCBI	Rnor6.0
Rnor_5.0	1	51,832,799 - 51,832,992	UniSTS	Rnor5.0
RGSC_v3.4	1	41,864,237 - 41,864,430	UniSTS	RGSC3.4
Celera	1	43,324,351 - 43,324,544	UniSTS
Cytogenetic Map	1	q21	UniSTS

RH94608

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	47,643,876 - 47,644,042 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	47,920,301 - 47,920,466	NCBI	Rnor6.0
Rnor_5.0	1	51,828,501 - 51,828,666	UniSTS	Rnor5.0
RGSC_v3.4	1	41,869,041 - 41,869,206	UniSTS	RGSC3.4
Celera	1	43,328,623 - 43,328,788	UniSTS
Cytogenetic Map	1	q21	UniSTS

RH140146

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	1	50,043,187 - 50,043,380 (+)	Marker Load Pipeline
mRatBN7.2	1	47,638,182 - 47,638,375 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	47,914,622 - 47,914,814	NCBI	Rnor6.0
Rnor_5.0	1	51,834,175 - 51,834,367	UniSTS	Rnor5.0
RGSC_v3.4	1	41,862,862 - 41,863,054	UniSTS	RGSC3.4
Celera	1	43,322,976 - 43,323,168	UniSTS
Cytogenetic Map	1	q21	UniSTS

RH140197

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	47,638,964 - 47,639,163 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	47,915,404 - 47,915,602	NCBI	Rnor6.0
Rnor_5.0	1	51,833,387 - 51,833,585	UniSTS	Rnor5.0
RGSC_v3.4	1	41,863,644 - 41,863,842	UniSTS	RGSC3.4
Celera	1	43,323,758 - 43,323,956	UniSTS
RH 3.4 Map	1	537.1	UniSTS
Cytogenetic Map	1	q21	UniSTS

Sod2

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	66,258,521 - 66,258,762 (-)	MAPPER	mRatBN7.2
Rnor_6.0	5	65,611,977 - 65,612,217	NCBI	Rnor6.0
Rnor_5.0	5	70,095,646 - 70,095,886	UniSTS	Rnor5.0
RGSC_v3.4	5	68,929,154 - 68,929,394	UniSTS	RGSC3.4
Celera	5	61,395,425 - 61,395,665	UniSTS
Cytogenetic Map	5	q23	UniSTS
Cytogenetic Map	1	q21	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_017051	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC070913	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474077	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	GQ404503	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X56600	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	Y00497	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000025794 ⟹ ENSRNOP00000025794

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	47,636,528 - 47,645,189 (-)	Ensembl
Rnor_6.0 Ensembl	1	47,914,759 - 47,921,587 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000159926 ⟹ ENSRNOP00000111176

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	50,043,325 - 50,050,168 (-)	Ensembl

RefSeq Acc Id:

NM_017051 ⟹ NP_058747

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	50,043,323 - 50,050,168 (-)	NCBI
mRatBN7.2	1	47,638,318 - 47,645,163 (-)	NCBI
Rnor_6.0	1	47,914,757 - 47,921,587 (-)	NCBI
Rnor_5.0	1	51,827,380 - 51,834,232 (+)	NCBI
RGSC_v3.4	1	41,862,997 - 41,870,327 (-)	RGD
Celera	1	43,323,111 - 43,329,909 (-)	RGD

Sequence:

show sequence

CGGGCGGACGCCGCAGAGCAGACGCGCGGCTGCTAGCGAACGGCCGTGTTCTGAGGAGAGCAGC
GGTCGTGGGCGCCTCAGCAATGTTGTGTCGGGCGGCGTGCAGCGCGGGCAGAAGACTGGGCCCC
GCGGCCAGTACCGCGGGCTCCCGGCACAAGCACAGCCTCCCTGACCTGCCTTACGACTATGGCG
CGCTGGAGCCGCACATTAACGCGCAGATCATGCAGCTGCACCACAGCAAGCACCACGCGACCTA
CGTGAACAATCTGAACGTCACCGAGGAGAAGTACCACGAGGCGCTGGCCAAGGGAGATGTTACA
ACTCAGGTTGCTCTTCAGCCTGCACTGAAGTTCAATGGCGGGGGCCATATCAATCACAGCATTT
TCTGGACAAACCTGAGCCCTAAGGGTGGTGGAGAACCCAAAGGAGAGTTGCTGGAGGCTATCAA
GCGTGACTTTGGGTCTTTTGAGAAGTTTAAGGAGAAACTGACAGCTGTGTCTGTGGGAGTCCAA
GGTTCAGGCTGGGGCTGGCTTGGCTTCAATAAGGAGCAAGGTCGCTTACAGATTGCCGCCTGCT
CTAATCAGGACCCACTGCAAGGAACCACAGGCCTTATTCCACTGCTGGGGATTGATGTGTGGGA
GCACGCTTACTATCTTCAGTATAAAAACGTCAGACCTGACTATCTGAAAGCCATTTGGAATGTA
ATCAACTGGGAGAATGTTAGCCAAAGATACATAGTTTGCAAGAAGTGAAGCCCTTCCGCCAGGC
TGTGTGTCAGGCCCGTGGTGGGTGTTTTGTAGTAGTGTAGAGCATTGCAGCACTGTGGCTGAGC
TGTTGTAATCTTCATTGATGCCTATCCACATATGTGTAAGCATACAGTTATGATAATTTCTTAA
TTAAATGTATTGTTAGGCAACTGTTTGAGAACAGTACATACTTGGTGTGAGCTGCTCTTGATTG
AACATTTTCATTAGAGGCTTGAATTGCTTGGACGCTGTCACTGTCATCATAAGGCCATCAAAGA
TATTCCATCTCTGTGTTGGGGCCTGTGGGGAGGCTGTAATCCTGTTCTACTGCAGTTAGGAAAA
AAAATGAGTTACCCCCCCCCCCAGAATTGTTGAATAATAAAATAGAGAACTGAATAGTTCTCTT
TTCTGTTAAAAATTGCTATTTTTCATAAGTAATCCTTTGTTTAGCGGATATCACCTAGTGGTCT
TTATTTATGGCCACAGTTTCATAGAAACATCATTTTTTCACTTGAAACGTGTAACTAGGCTAAG
GATGGATGGAGTGGTAGAGCCTTTGCCTGTCTTATGTGAGGCCCTGGGCTCTACCTCACTACTG
AACAAATCAACAGACCCAAGCTAGGCTCCTGACTGACAACTGTTAATTCGGAGAGGAGTGACAT
TGTGCCTCTGGGTTTTTTTATAGGCTGAGATGCAAAAACTGTTACCTTGTCTATTAAAACCGAC
TGTGTATTGTATGAAAGTGCTCAAGATGGACAAAGTATGCAGGGCCTGTCCCATGATGTCAACA
TGGGGACTAGGCCACAGGGCATTCAGGGAAGCCATTCAGCACCATTAATTGTGTATCTCAGGAG
AACTGGACCCTGGGTGAGGTGGCACCTTTTTCAGTAGAGGCAAACGGGTTTCTGAGTGAGGTCA
GTAGGGTGTCTTGAGAACATCAGTTTTCAGAGACATGTATTTTCATTTTTTCTGCAGTCTCAAG
AACTTATACTCACAAGAGGGCCTTTGTATTGTTATTCAATAGAAGGACACCCTTTCCCTGACAA
GGTACACAGTGTTTCTGATTGTATTCCTGTGCAGCATTTGGGTGTAGAGCTGTGCACTGTTGAA
ATGCCTTTGTGAATTTGCCTTTTCACATTTCGTCTCACCATCTTCCTTGTTTTCTTTACTGACT
ATGTAATGTTTTATCAGTTGGATATTACTGAATAGTTTGTTTGTGTTTAATTGCCTTTTATTAC
CAAAAAGGCTGTGGTCAGCAACCCCAGGCATGCACATTACTTCTTAATGGAGTATTTTTTAAAG
GTTTATTTTAATTTTAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_058747	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH70913	(Get FASTA)	NCBI Sequence Viewer
	ACV32533	(Get FASTA)	NCBI Sequence Viewer
	CAA39937	(Get FASTA)	NCBI Sequence Viewer
	CAA68549	(Get FASTA)	NCBI Sequence Viewer
	EDL83700	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000025794.3
	ENSRNOP00000111176
GenBank Protein	P07895	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_058747 ⟸ NM_017051
- Peptide Label:	precursor
- UniProtKB:	P07895 (UniProtKB/Swiss-Prot), A6KP26 (UniProtKB/TrEMBL)
- Sequence:	show sequence MLCRAACSAGRRLGPAASTAGSRHKHSLPDLPYDYGALEPHINAQIMQLHHSKHHATYVNNLNV TEEKYHEALAKGDVTTQVALQPALKFNGGGHINHSIFWTNLSPKGGGEPKGELLEAIKRDFGSF EKFKEKLTAVSVGVQGSGWGWLGFNKEQGRLQIAACSNQDPLQGTTGLIPLLGIDVWEHAYYLQ YKNVRPDYLKAIWNVINWENVSQRYIVCKK hide sequence

Ensembl Acc Id:

ENSRNOP00000025794 ⟸ ENSRNOT00000025794

Ensembl Acc Id:

ENSRNOP00000111176 ⟸ ENSRNOT00000159926

Protein Domains

Manganese/iron superoxide dismutase C-terminal Manganese/iron superoxide dismutase N-terminal

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P07895-F1-model_v2	AlphaFold	P07895	1-222	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13689611

Promoter ID:

EPDNEW_R135

Type:

multiple initiation site

Name:

Sod2_1

Description:

superoxide dismutase 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	47,921,573 - 47,921,633	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:3732	AgrOrtholog
BioCyc Gene	G2FUF-61596	BioCyc
BioCyc Pathway	DETOX1-PWY [superoxide radicals degradation]	BioCyc
	DETOX1-PWY-1 [reactive oxygen species degradation]	BioCyc
BioCyc Pathway Image	DETOX1-PWY	BioCyc
	DETOX1-PWY-1	BioCyc
Ensembl Genes	ENSRNOG00000019048	Ensembl, UniProtKB/Swiss-Prot
	ENSRNOG00000086727	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000025794.5	UniProtKB/Swiss-Prot
	ENSRNOT00000159926	ENTREZGENE
Gene3D-CATH	1.10.287.990	UniProtKB/Swiss-Prot
	3.55.40.20	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7104698	IMAGE-MGC_LOAD
InterPro	Fe/Mn_Superoxide_Dismutase	UniProtKB/Swiss-Prot
	Mn/Fe_SOD	UniProtKB/Swiss-Prot
	Mn/Fe_SOD_BS	UniProtKB/Swiss-Prot
	Mn/Fe_SOD_C	UniProtKB/Swiss-Prot
	Mn/Fe_SOD_N	UniProtKB/Swiss-Prot
	Mn/Fe_SOD_N_sf	UniProtKB/Swiss-Prot
	SOD_C_sf	UniProtKB/Swiss-Prot
KEGG Report	rno:24787	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:91729	IMAGE-MGC_LOAD
NCBI Gene	24787	ENTREZGENE
PANTHER	SUPEROXIDE DISMUTASE 2	UniProtKB/Swiss-Prot
	SUPEROXIDE DISMUTASE [MN], MITOCHONDRIAL	UniProtKB/Swiss-Prot
Pfam	Sod_Fe_C	UniProtKB/Swiss-Prot
	Sod_Fe_N	UniProtKB/Swiss-Prot
PharmGKB	SOD2	RGD
PhenoGen	Sod2	PhenoGen
PIRSF	SODismutase	UniProtKB/Swiss-Prot
PRINTS	MNSODISMTASE	UniProtKB/Swiss-Prot
PROSITE	SOD_MN	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000019048	RatGTEx
	ENSRNOG00000086727	RatGTEx
Superfamily-SCOP	SSF46609	UniProtKB/Swiss-Prot
	SSF54719	UniProtKB/Swiss-Prot
UniProt	A6KP26	ENTREZGENE, UniProtKB/TrEMBL
	P07895	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2017-01-24	Sod2	superoxide dismutase 2	Sod2	superoxide dismutase 2, mitochondrial	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Sod2	superoxide dismutase 2, mitochondrial		superoxide dismutase 2	Name updated	1299863	APPROVED
2003-04-09	Sod2	superoxide dismutase 2		Superoxide dismutase 2, mitochondrial	Name updated	629478	APPROVED
2001-12-21	Sod2	Superoxide dismutase 2, mitochondrial			Name updated	69729	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_cellular_localization	localized to mitochondria	628320
gene_function	dismutates reactive oxygen radical species (ROS) to hydrogen peroxide and molecular oxygen	628320
gene_process	prevents accumulation of superoxides in cells	628320
gene_regulation	caloric restriction (CR) significantly increased mRNA (>287%) level	628320
gene_transcript	contains at least 5 exons	729952

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)

BioCyc Pathways

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)

BioCyc Pathways