Symbol:
Grb2
Name:
growth factor receptor bound protein 2
RGD ID:
619758
Description:
Enables several functions, including epidermal growth factor receptor binding activity; insulin receptor substrate binding activity; and phosphotyrosine residue binding activity. Predicted to be involved in several processes, including cell surface receptor signaling pathway; negative regulation of natural killer cell mediated cytotoxicity; and nervous system development. Predicted to act upstream of or within several processes, including embryonic morphogenesis; fibroblast growth factor receptor signaling pathway; and positive regulation of actin filament polymerization. Part of protein-containing complex. Is active in presynapse. Human ortholog(s) of this gene implicated in breast cancer; prostate adenocarcinoma; and prostate cancer. Orthologous to human GRB2 (growth factor receptor bound protein 2); PARTICIPATES IN insulin signaling pathway; insulin-like growth factor signaling pathway; brain-derived neurotrophic factor signaling pathway; INTERACTS WITH 1,2-dimethylhydrazine; 1-[3-(dimethylamino)propyl]-1-(4-fluorophenyl)-1,3-dihydro-2-benzofuran-5-carbonitrile; 17beta-estradiol.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
adapter protein GRB2; Ash-psi; growth factor receptor-bound protein 2; growth factor receptor-bound protein 2-like; LOC103690155; MGC108668; protein Ash; SH2/SH3 adapter GRB2; uncharacterized LOC103690155
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 101,380,354 - 101,448,138 (-) NCBI GRCr8 mRatBN7.2 10 100,881,404 - 100,949,193 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 100,869,718 - 100,949,309 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 105,941,694 - 106,010,414 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 105,404,767 - 105,473,487 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 100,802,375 - 100,870,155 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 104,193,953 - 104,263,071 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 104,193,955 - 104,263,071 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 104,019,823 - 104,087,251 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Rnor_5.0 10 104,735,560 - 104,738,091 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 105,722,014 - 105,818,649 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 105,737,088 - 105,833,269 (-) NCBI Celera 10 99,455,840 - 99,524,352 (-) NCBI Celera Cytogenetic Map 10 q32.1 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Grb2 Rat (+)-Tetrandrine decreases expression ISO GRB2 (Homo sapiens) 6480464 tetrandrine results in decreased expression of GRB2 protein CTD PMID:30549224 Grb2 Rat 1,2-dimethylhydrazine decreases expression EXP 6480464 1 and 2-Dimethylhydrazine results in decreased expression of GRB2 mRNA CTD PMID:32387197 Grb2 Rat 1,2-dimethylhydrazine multiple interactions ISO Grb2 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of GRB2 mRNA CTD PMID:22206623 Grb2 Rat 1,2-dimethylhydrazine decreases expression ISO Grb2 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of GRB2 mRNA CTD PMID:22206623 Grb2 Rat 1-[3-(dimethylamino)propyl]-1-(4-fluorophenyl)-1,3-dihydro-2-benzofuran-5-carbonitrile increases expression EXP 6480464 Citalopram results in increased expression of GRB2 mRNA CTD PMID:28467792 Grb2 Rat 17alpha-ethynylestradiol multiple interactions ISO Grb2 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of GRB2 mRNA CTD PMID:17942748 Grb2 Rat 17alpha-ethynylestradiol increases expression ISO Grb2 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of GRB2 mRNA CTD PMID:17942748 Grb2 Rat 17beta-estradiol multiple interactions EXP 6480464 [Estradiol co-treated with Progesterone co-treated with Methylnitrosourea] results in increased expression of GRB2 mRNA and [Estradiol co-treated with Progesterone co-treated with Methylnitrosourea] results in increased expression of GRB2 protein CTD PMID:22465879 Grb2 Rat 17beta-estradiol multiple interactions ISO GRB2 (Homo sapiens) 6480464 IGF1R mutant form inhibits the reaction [Estradiol results in increased expression of GRB2 mRNA] CTD PMID:23094148 Grb2 Rat 17beta-estradiol increases expression ISO GRB2 (Homo sapiens) 6480464 Estradiol results in increased expression of GRB2 mRNA CTD PMID:23094148 Grb2 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Grb2 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of GRB2 mRNA CTD PMID:17942748 Grb2 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 CBL protein promotes the reaction [Tetrachlorodibenzodioxin promotes the reaction [GRB2 protein binds to SOS1 protein]] more ... CTD PMID:9918770 Grb2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Grb2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of GRB2 mRNA CTD PMID:19465110 and PMID:22666406 Grb2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Grb2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of GRB2 mRNA CTD PMID:21570461 Grb2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of GRB2 mRNA CTD PMID:22298810 and PMID:34747641 Grb2 Rat 2,6-dimethoxyphenol multiple interactions ISO GRB2 (Homo sapiens) 6480464 [Sodium Chloride co-treated with pyrogallol 1 more ... CTD PMID:38598786 Grb2 Rat 3-chloropropane-1,2-diol decreases expression EXP 6480464 alpha-Chlorohydrin analog results in decreased expression of GRB2 protein CTD PMID:26597043 Grb2 Rat 4,4'-sulfonyldiphenol increases expression ISO GRB2 (Homo sapiens) 6480464 bisphenol S results in increased expression of GRB2 protein CTD PMID:34186270 Grb2 Rat 4-hydroxyphenyl retinamide increases expression ISO GRB2 (Homo sapiens) 6480464 Fenretinide results in increased expression of GRB2 protein CTD PMID:15059897 Grb2 Rat aflatoxin B1 increases methylation ISO GRB2 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of GRB2 intron CTD PMID:30157460 Grb2 Rat Aflatoxin B2 alpha decreases methylation ISO GRB2 (Homo sapiens) 6480464 aflatoxin B2 results in decreased methylation of GRB2 intron CTD PMID:30157460 Grb2 Rat AICA ribonucleotide multiple interactions EXP 6480464 GRB2 protein affects the reaction [AICA ribonucleotide results in increased activity of PRKCZ protein] CTD PMID:11978788 Grb2 Rat all-trans-retinoic acid increases expression ISO GRB2 (Homo sapiens) 6480464 Tretinoin results in increased expression of GRB2 mRNA CTD PMID:33167477 Grb2 Rat allyl isothiocyanate decreases expression ISO GRB2 (Homo sapiens) 6480464 allyl isothiocyanate results in decreased expression of GRB2 protein CTD PMID:37318315 Grb2 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of GRB2 mRNA CTD PMID:16483693 Grb2 Rat ammonium chloride decreases expression EXP 6480464 Ammonium Chloride results in decreased expression of GRB2 protein CTD PMID:16483693 Grb2 Rat antirheumatic drug decreases expression ISO GRB2 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of GRB2 mRNA CTD PMID:24449571 Grb2 Rat arsenic acid multiple interactions ISO GRB2 (Homo sapiens) 6480464 arsenic acid promotes the reaction [SHC1 protein binds to GRB2 protein] CTD PMID:14674888 Grb2 Rat arsenite(3-) multiple interactions ISO GRB2 (Homo sapiens) 6480464 arsenite promotes the reaction [SHC1 protein binds to GRB2 protein] CTD PMID:14674888 Grb2 Rat arsenous acid decreases expression ISO GRB2 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of GRB2 protein CTD PMID:25419056 Grb2 Rat arsenous acid increases expression ISO GRB2 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of GRB2 mRNA CTD PMID:20458559 Grb2 Rat Azoxymethane multiple interactions ISO Grb2 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of GRB2 mRNA CTD PMID:29950665 Grb2 Rat Benoxacor decreases expression ISO Grb2 (Mus musculus) 6480464 benoxacor results in decreased expression of GRB2 mRNA CTD PMID:34850242 Grb2 Rat benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of GRB2 protein CTD PMID:21467743 Grb2 Rat benzo[a]pyrene affects methylation ISO GRB2 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of GRB2 intron CTD PMID:30157460 Grb2 Rat benzo[e]pyrene decreases methylation ISO GRB2 (Homo sapiens) 6480464 benzo(e)pyrene results in decreased methylation of GRB2 intron CTD PMID:30157460 Grb2 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Grb2 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of GRB2 mRNA CTD PMID:34319233 Grb2 Rat bisdemethoxycurcumin decreases expression ISO GRB2 (Homo sapiens) 6480464 bisdemethoxycurcumin results in decreased expression of GRB2 protein CTD PMID:35735092 Grb2 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of GRB2 mRNA CTD PMID:25181051 and PMID:34947998 Grb2 Rat bisphenol A multiple interactions ISO GRB2 (Homo sapiens) 6480464 ESR1 protein affects the reaction [bisphenol A results in increased expression of GRB2 protein] CTD PMID:30615907 Grb2 Rat bisphenol A increases expression ISO GRB2 (Homo sapiens) 6480464 bisphenol A results in increased expression of GRB2 protein CTD PMID:30615907 and PMID:34186270 Grb2 Rat bisphenol AF increases expression ISO GRB2 (Homo sapiens) 6480464 bisphenol AF results in increased expression of GRB2 protein CTD PMID:34186270 Grb2 Rat bufalin decreases expression ISO GRB2 (Homo sapiens) 6480464 bufalin results in decreased expression of GRB2 protein CTD PMID:23949904 Grb2 Rat cadmium atom increases expression ISO GRB2 (Homo sapiens) 6480464 Cadmium results in increased expression of GRB2 protein CTD PMID:14499349 Grb2 Rat cadmium dichloride affects expression ISO GRB2 (Homo sapiens) 6480464 Cadmium Chloride affects the expression of GRB2 mRNA CTD PMID:33129824 Grb2 Rat calcitriol increases expression ISO GRB2 (Homo sapiens) 6480464 Calcitriol results in increased expression of GRB2 mRNA CTD PMID:15951637 Grb2 Rat cannabidiol multiple interactions ISO GRB2 (Homo sapiens) 6480464 [Cannabidiol co-treated with moringin] results in increased expression of GRB2 mRNA and [Oxygen co-treated with Ozone co-treated with Cannabidiol] results in decreased expression of GRB2 mRNA CTD PMID:30096889 and PMID:32992648 Grb2 Rat casticin decreases expression ISO Grb2 (Mus musculus) 6480464 casticin results in decreased expression of GRB2 protein CTD PMID:28444820 Grb2 Rat cerium trichloride affects expression ISO Grb2 (Mus musculus) 6480464 cerous chloride affects the expression of GRB2 mRNA CTD PMID:23139204 Grb2 Rat chlordecone decreases expression ISO Grb2 (Mus musculus) 6480464 Chlordecone results in decreased expression of GRB2 mRNA CTD PMID:29980752 Grb2 Rat chlorpyrifos increases expression ISO Grb2 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of GRB2 mRNA CTD PMID:27737797 Grb2 Rat choline multiple interactions EXP 6480464 [Folic Acid deficiency co-treated with Methionine deficiency co-treated with Choline deficiency] results in increased expression of GRB2 protein CTD PMID:19566968 Grb2 Rat chrysin decreases expression ISO GRB2 (Homo sapiens) 6480464 chrysin results in decreased expression of GRB2 protein CTD PMID:30578657 Grb2 Rat citalopram increases expression EXP 6480464 Citalopram results in increased expression of GRB2 mRNA CTD PMID:28467792 Grb2 Rat clofibrate decreases expression ISO Grb2 (Mus musculus) 6480464 Clofibrate results in decreased expression of GRB2 mRNA CTD PMID:23811191 Grb2 Rat cobalt dichloride increases expression ISO GRB2 (Homo sapiens) 6480464 cobaltous chloride results in increased expression of GRB2 mRNA CTD PMID:19376846 Grb2 Rat cocaine increases expression EXP 6480464 Cocaine results in increased expression of GRB2 protein CTD PMID:25100957 Grb2 Rat copper(II) sulfate increases expression ISO GRB2 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of GRB2 mRNA CTD PMID:19549813 Grb2 Rat crocidolite asbestos affects expression ISO GRB2 (Homo sapiens) 6480464 Asbestos and Crocidolite affects the expression of GRB2 mRNA CTD PMID:17331233 Grb2 Rat curcumin decreases expression ISO GRB2 (Homo sapiens) 6480464 Curcumin analog results in decreased expression of GRB2 mRNA CTD PMID:26409325 Grb2 Rat cypermethrin decreases expression ISO GRB2 (Homo sapiens) 6480464 cypermethrin results in decreased expression of GRB2 mRNA CTD PMID:27704156 Grb2 Rat DDT multiple interactions ISO GRB2 (Homo sapiens) 6480464 DDT promotes the reaction [GRB2 protein binds to SOS1 protein] CTD PMID:9070211 Grb2 Rat decabromodiphenyl ether increases expression EXP 6480464 decabromobiphenyl ether results in increased expression of GRB2 mRNA CTD PMID:23640034 Grb2 Rat dexamethasone multiple interactions ISO GRB2 (Homo sapiens) 6480464 Dexamethasone inhibits the reaction [EGF protein promotes the reaction [EGFR protein binds to GRB2 protein]] and Mifepristone inhibits the reaction [Dexamethasone inhibits the reaction [EGF protein promotes the reaction [EGFR protein binds to GRB2 protein]]] CTD PMID:10807665 Grb2 Rat dextran sulfate multiple interactions ISO Grb2 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of GRB2 mRNA CTD PMID:29950665 Grb2 Rat diallyl disulfide affects expression ISO GRB2 (Homo sapiens) 6480464 diallyl disulfide affects the expression of GRB2 protein CTD PMID:21695758 Grb2 Rat diallyl disulfide decreases expression ISO GRB2 (Homo sapiens) 6480464 diallyl disulfide results in decreased expression of GRB2 protein CTD PMID:21695758 Grb2 Rat Diallyl sulfide decreases expression ISO GRB2 (Homo sapiens) 6480464 allyl sulfide results in decreased expression of GRB2 protein CTD PMID:21695758 Grb2 Rat diarsenic trioxide decreases expression ISO GRB2 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of GRB2 protein CTD PMID:25419056 Grb2 Rat diarsenic trioxide increases expression ISO GRB2 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of GRB2 mRNA CTD PMID:20458559 Grb2 Rat dioxygen multiple interactions ISO GRB2 (Homo sapiens) 6480464 [Oxygen co-treated with Ozone co-treated with Cannabidiol] results in decreased expression of GRB2 mRNA and [Oxygen co-treated with Ozone] results in decreased expression of GRB2 mRNA CTD PMID:32992648 Grb2 Rat disodium selenite decreases expression ISO GRB2 (Homo sapiens) 6480464 Sodium Selenite results in decreased expression of GRB2 mRNA CTD PMID:16705456 Grb2 Rat disodium selenite increases expression ISO GRB2 (Homo sapiens) 6480464 Sodium Selenite results in increased expression of GRB2 mRNA CTD PMID:18175754 Grb2 Rat enzyme inhibitor multiple interactions ISO GRB2 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of GRB2 protein CTD PMID:23301498 Grb2 Rat escitalopram increases expression EXP 6480464 Escitalopram results in increased expression of GRB2 mRNA CTD PMID:28467792 Grb2 Rat ethanol affects splicing ISO Grb2 (Mus musculus) 6480464 Ethanol affects the splicing of GRB2 mRNA CTD PMID:30319688 Grb2 Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of GRB2 mRNA CTD PMID:24136188 Grb2 Rat flavonoids increases expression EXP 6480464 Flavonoids results in increased expression of GRB2 mRNA CTD PMID:18035473 Grb2 Rat folic acid multiple interactions EXP 6480464 [Folic Acid deficiency co-treated with Methionine deficiency co-treated with Choline deficiency] results in increased expression of GRB2 protein CTD PMID:19566968 Grb2 Rat folic acid multiple interactions ISO Grb2 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of GRB2 mRNA CTD PMID:22206623 Grb2 Rat furfural multiple interactions ISO GRB2 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of and affects the localization of GRB2 protein and [Sodium Chloride co-treated with Furaldehyde] results in increased expression of GRB2 protein CTD PMID:38598786 Grb2 Rat gallic acid decreases expression ISO GRB2 (Homo sapiens) 6480464 Gallic Acid results in decreased expression of GRB2 protein CTD PMID:22387266 Grb2 Rat genistein decreases expression ISO GRB2 (Homo sapiens) 6480464 Genistein results in decreased expression of GRB2 mRNA CTD PMID:16705744 Grb2 Rat genistein increases expression ISO GRB2 (Homo sapiens) 6480464 Genistein results in increased expression of GRB2 mRNA CTD PMID:20884965 Grb2 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of GRB2 mRNA CTD PMID:22061828 Grb2 Rat glyphosate decreases expression ISO GRB2 (Homo sapiens) 6480464 Glyphosate results in decreased expression of GRB2 mRNA CTD PMID:31295307 Grb2 Rat hydrogen peroxide affects expression ISO GRB2 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of GRB2 mRNA CTD PMID:21179406 Grb2 Rat hydroquinone affects expression ISO GRB2 (Homo sapiens) 6480464 hydroquinone affects the expression of GRB2 protein CTD PMID:20021034 Grb2 Rat ivermectin decreases expression ISO GRB2 (Homo sapiens) 6480464 Ivermectin results in decreased expression of GRB2 protein CTD PMID:32959892 Grb2 Rat L-methionine multiple interactions EXP 6480464 [Folic Acid deficiency co-treated with Methionine deficiency co-treated with Choline deficiency] results in increased expression of GRB2 protein CTD PMID:19566968 Grb2 Rat letrozole increases expression ISO Grb2 (Mus musculus) 6480464 letrozole results in increased expression of GRB2 protein CTD PMID:15967659 Grb2 Rat maneb multiple interactions ISO Grb2 (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in decreased expression of GRB2 mRNA more ... CTD PMID:23963992 Grb2 Rat melatonin multiple interactions ISO Grb2 (Mus musculus) 6480464 Melatonin inhibits the reaction [[Maneb co-treated with Paraquat] results in decreased expression of GRB2 mRNA] CTD PMID:23963992 Grb2 Rat methamphetamine affects expression EXP 6480464 Methamphetamine affects the expression of GRB2 protein CTD PMID:17904249 Grb2 Rat methapyrilene decreases methylation ISO GRB2 (Homo sapiens) 6480464 Methapyrilene results in decreased methylation of GRB2 intron CTD PMID:30157460 Grb2 Rat microcystin-LR decreases expression EXP 6480464 cyanoginosin LR results in decreased expression of GRB2 protein CTD PMID:22430071 Grb2 Rat mifepristone multiple interactions ISO GRB2 (Homo sapiens) 6480464 Mifepristone inhibits the reaction [Dexamethasone inhibits the reaction [EGF protein promotes the reaction [EGFR protein binds to GRB2 protein]]] CTD PMID:10807665 Grb2 Rat N-methyl-N-nitrosourea multiple interactions EXP 6480464 [Estradiol co-treated with Progesterone co-treated with Methylnitrosourea] results in increased expression of GRB2 mRNA and [Estradiol co-treated with Progesterone co-treated with Methylnitrosourea] results in increased expression of GRB2 protein CTD PMID:22465879 Grb2 Rat nickel atom increases expression ISO GRB2 (Homo sapiens) 6480464 Nickel results in increased expression of GRB2 mRNA CTD PMID:24768652 and PMID:25583101 Grb2 Rat nitrates multiple interactions ISO Grb2 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of GRB2 mRNA CTD PMID:35964746 Grb2 Rat nitric oxide decreases expression ISO Grb2 (Mus musculus) 6480464 Nitric Oxide deficiency results in decreased expression of GRB2 mRNA CTD PMID:15878706 Grb2 Rat Nonidet P-40 decreases expression ISO GRB2 (Homo sapiens) 6480464 Nonidet P-40 results in decreased expression of GRB2 mRNA CTD PMID:26552463 Grb2 Rat ouabain decreases expression ISO GRB2 (Homo sapiens) 6480464 Ouabain results in decreased expression of GRB2 protein CTD PMID:28795476 Grb2 Rat ozone multiple interactions ISO GRB2 (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of GRB2 mRNA more ... CTD PMID:32992648 and PMID:35430440 Grb2 Rat ozone increases expression EXP 6480464 Ozone results in increased expression of GRB2 protein CTD PMID:33146391 Grb2 Rat p-menthan-3-ol decreases expression ISO GRB2 (Homo sapiens) 6480464 Menthol results in decreased expression of GRB2 mRNA CTD PMID:26760959 Grb2 Rat paracetamol affects expression ISO Grb2 (Mus musculus) 6480464 Acetaminophen affects the expression of GRB2 mRNA CTD PMID:17562736 Grb2 Rat paracetamol decreases expression ISO Grb2 (Mus musculus) 6480464 Acetaminophen results in decreased expression of GRB2 mRNA CTD PMID:34219507 Grb2 Rat paracetamol affects expression EXP 6480464 Acetaminophen affects the expression of GRB2 mRNA CTD PMID:16701773 Grb2 Rat paraquat multiple interactions ISO Grb2 (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in decreased expression of GRB2 mRNA more ... CTD PMID:23963992 Grb2 Rat perfluorooctanoic acid decreases expression EXP 6480464 perfluorooctanoic acid results in decreased expression of GRB2 mRNA CTD PMID:19162173 Grb2 Rat phenylarsine oxide multiple interactions EXP 6480464 [oxophenylarsine results in decreased phosphorylation of PLCG1 protein] inhibits the reaction [PLCG1 protein binds to GRB2 protein] CTD PMID:9281317 Grb2 Rat phosphane decreases expression EXP 6480464 phosphine results in decreased expression of GRB2 mRNA CTD PMID:34427094 Grb2 Rat pirinixic acid decreases expression ISO Grb2 (Mus musculus) 6480464 pirinixic acid results in decreased expression of GRB2 mRNA CTD PMID:23811191 Grb2 Rat pregnenolone 16alpha-carbonitrile increases expression ISO Grb2 (Mus musculus) 6480464 Pregnenolone Carbonitrile results in increased expression of GRB2 mRNA CTD PMID:28903501 Grb2 Rat progesterone multiple interactions EXP 6480464 [Estradiol co-treated with Progesterone co-treated with Methylnitrosourea] results in increased expression of GRB2 mRNA and [Estradiol co-treated with Progesterone co-treated with Methylnitrosourea] results in increased expression of GRB2 protein CTD PMID:22465879 Grb2 Rat propiconazole decreases expression ISO Grb2 (Mus musculus) 6480464 propiconazole results in decreased expression of GRB2 mRNA CTD PMID:21278054 Grb2 Rat quercetin increases expression ISO GRB2 (Homo sapiens) 6480464 Quercetin results in increased expression of GRB2 mRNA CTD PMID:27514524 Grb2 Rat quercetin decreases expression ISO GRB2 (Homo sapiens) 6480464 Quercetin results in decreased expression of GRB2 protein CTD PMID:23645742 Grb2 Rat resveratrol decreases expression ISO GRB2 (Homo sapiens) 6480464 resveratrol results in decreased expression of GRB2 mRNA CTD PMID:12002526 Grb2 Rat resveratrol multiple interactions ISO GRB2 (Homo sapiens) 6480464 resveratrol promotes the reaction [[ITGAV protein binds to ITGB3 protein] which affects the localization of GRB2 protein] CTD PMID:21467134 Grb2 Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of GRB2 protein CTD PMID:35544339 Grb2 Rat S-butyl-DL-homocysteine (S,R)-sulfoximine decreases expression ISO Grb2 (Mus musculus) 6480464 Buthionine Sulfoximine results in decreased expression of GRB2 mRNA CTD PMID:15878706 Grb2 Rat sodium arsenite increases expression ISO GRB2 (Homo sapiens) 6480464 sodium arsenite results in increased expression of GRB2 mRNA CTD PMID:12016162 more ... Grb2 Rat sodium arsenite decreases expression ISO GRB2 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of GRB2 protein CTD PMID:30528433 Grb2 Rat sodium arsenite multiple interactions EXP 6480464 [sodium arsenite results in increased phosphorylation of SHC1 protein] promotes the reaction [SHC1 protein modified form binds to GRB2 protein] and sodium arsenite promotes the reaction [SHC1 protein modified form binds to GRB2 protein] CTD PMID:9710602 Grb2 Rat sodium chloride multiple interactions ISO GRB2 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of and affects the localization of GRB2 protein more ... CTD PMID:38598786 Grb2 Rat sorafenib decreases expression ISO GRB2 (Homo sapiens) 6480464 sorafenib results in decreased expression of GRB2 mRNA CTD PMID:26409325 Grb2 Rat sulindac increases expression EXP 6480464 Sulindac results in increased expression of GRB2 mRNA CTD PMID:24136188 Grb2 Rat tert-butyl hydroperoxide increases expression ISO GRB2 (Homo sapiens) 6480464 tert-Butylhydroperoxide results in increased expression of GRB2 mRNA CTD PMID:15336504 Grb2 Rat titanium dioxide multiple interactions ISO Grb2 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of GRB2 mRNA CTD PMID:29950665 Grb2 Rat titanium dioxide decreases methylation ISO Grb2 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of GRB2 gene CTD PMID:35295148 Grb2 Rat trimethyltin increases expression ISO Grb2 (Mus musculus) 6480464 trimethyltin results in increased expression of GRB2 mRNA CTD PMID:20833246 Grb2 Rat triphenyl phosphate affects expression ISO GRB2 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of GRB2 mRNA CTD PMID:37042841 Grb2 Rat Triptolide decreases expression ISO Grb2 (Mus musculus) 6480464 triptolide results in decreased expression of GRB2 protein CTD PMID:26420756 Grb2 Rat uranium atom affects expression ISO GRB2 (Homo sapiens) 6480464 Uranium affects the expression of GRB2 mRNA CTD PMID:15672453 Grb2 Rat valproic acid increases expression ISO GRB2 (Homo sapiens) 6480464 Valproic Acid results in increased expression of GRB2 mRNA CTD PMID:23179753
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(+)-Tetrandrine (ISO) 1,2-dimethylhydrazine (EXP,ISO) 1-[3-(dimethylamino)propyl]-1-(4-fluorophenyl)-1,3-dihydro-2-benzofuran-5-carbonitrile (EXP) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,6-dimethoxyphenol (ISO) 3-chloropropane-1,2-diol (EXP) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) AICA ribonucleotide (EXP) all-trans-retinoic acid (ISO) allyl isothiocyanate (ISO) ammonium chloride (EXP) antirheumatic drug (ISO) arsenic acid (ISO) arsenite(3-) (ISO) arsenous acid (ISO) Azoxymethane (ISO) Benoxacor (ISO) benzo[a]pyrene (EXP,ISO) benzo[e]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisdemethoxycurcumin (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) bufalin (ISO) cadmium atom (ISO) cadmium dichloride (ISO) calcitriol (ISO) cannabidiol (ISO) casticin (ISO) cerium trichloride (ISO) chlordecone (ISO) chlorpyrifos (ISO) choline (EXP) chrysin (ISO) citalopram (EXP) clofibrate (ISO) cobalt dichloride (ISO) cocaine (EXP) copper(II) sulfate (ISO) crocidolite asbestos (ISO) curcumin (ISO) cypermethrin (ISO) DDT (ISO) decabromodiphenyl ether (EXP) dexamethasone (ISO) dextran sulfate (ISO) diallyl disulfide (ISO) Diallyl sulfide (ISO) diarsenic trioxide (ISO) dioxygen (ISO) disodium selenite (ISO) enzyme inhibitor (ISO) escitalopram (EXP) ethanol (ISO) finasteride (EXP) flavonoids (EXP) folic acid (EXP,ISO) furfural (ISO) gallic acid (ISO) genistein (ISO) gentamycin (EXP) glyphosate (ISO) hydrogen peroxide (ISO) hydroquinone (ISO) ivermectin (ISO) L-methionine (EXP) letrozole (ISO) maneb (ISO) melatonin (ISO) methamphetamine (EXP) methapyrilene (ISO) microcystin-LR (EXP) mifepristone (ISO) N-methyl-N-nitrosourea (EXP) nickel atom (ISO) nitrates (ISO) nitric oxide (ISO) Nonidet P-40 (ISO) ouabain (ISO) ozone (EXP,ISO) p-menthan-3-ol (ISO) paracetamol (EXP,ISO) paraquat (ISO) perfluorooctanoic acid (EXP) phenylarsine oxide (EXP) phosphane (EXP) pirinixic acid (ISO) pregnenolone 16alpha-carbonitrile (ISO) progesterone (EXP) propiconazole (ISO) quercetin (ISO) resveratrol (ISO) rotenone (EXP) S-butyl-DL-homocysteine (S,R)-sulfoximine (ISO) sodium arsenite (EXP,ISO) sodium chloride (ISO) sorafenib (ISO) sulindac (EXP) tert-butyl hydroperoxide (ISO) titanium dioxide (ISO) trimethyltin (ISO) triphenyl phosphate (ISO) Triptolide (ISO) uranium atom (ISO) valproic acid (ISO)
Biological Process
actin cytoskeleton organization (IEA,ISO) anatomical structure formation involved in morphogenesis (IEA,ISO) B cell receptor signaling pathway (IEA,ISO) branching involved in labyrinthine layer morphogenesis (IEA,ISO) cellular response to ionizing radiation (IEA,ISO) endodermal cell differentiation (IEA,ISO) epidermal growth factor receptor signaling pathway (IEA,ISO) fibroblast growth factor receptor signaling pathway (IEA,ISO) insulin receptor signaling pathway (IEA,ISO) insulin-like growth factor receptor signaling pathway (IEA,ISO) myelination (IEA,ISO) natural killer cell mediated cytotoxicity (IEA,ISO) negative regulation of epidermal growth factor receptor signaling pathway (ISO) negative regulation of natural killer cell mediated cytotoxicity (IEA,ISO) positive regulation of actin filament polymerization (IEA,ISO) positive regulation of reactive oxygen species metabolic process (IEA,ISO) Ras protein signal transduction (TAS) receptor internalization (IEA,ISO) regulation of MAPK cascade (IBA,IEA,ISO) Schwann cell development (IEA,ISO) signal transduction (IBA) signal transduction in response to DNA damage (IEA,ISO) T cell activation (IEA,ISO)
Cellular Component
cell cortex (IEA,ISO) cell-cell junction (IEA,ISO) centrosome (IEA,ISO) COP9 signalosome (IBA,IEA,ISO,ISS) cytoplasm (IBA,IEA,ISO,ISS) cytosol (IEA,ISO,TAS) endosome (IEA,ISO,ISS) Golgi apparatus (IEA) Grb2-EGFR complex (IEA,ISO) membrane (IEA,ISO) nucleoplasm (IBA) nucleus (IEA,ISO,ISS) plasma membrane (IBA,IEA,ISO) presynapse (IDA,IEP) protein-containing complex (IDA) vesicle membrane (IEA,ISO)
Molecular Function
enzyme binding (IPI) ephrin receptor binding (IEA,ISO) epidermal growth factor receptor binding (IBA,IEA,IPI,ISO,ISS) guanyl-nucleotide exchange factor adaptor activity (IEA,ISO) identical protein binding (IEA,ISO) insulin receptor substrate binding (IEA,IPI,ISO) neurotrophin TRKA receptor binding (IEA,ISO) phosphoprotein binding (IPI) phosphotyrosine residue binding (IBA,IEA,IPI,ISO) protein binding (IPI,ISO) protein domain specific binding (IEA,IPI,ISO) protein kinase binding (IEA,ISO) protein phosphatase binding (IEA,ISO) protein-containing complex binding (IDA) protein-macromolecule adaptor activity (IEA,ISO) SH3 domain binding (IEA,ISO,ISS) transmembrane receptor protein tyrosine kinase adaptor activity (IEA,ISO)
1.
Grb2 monomer-dimer equilibrium determines normal versus oncogenic function.
Ahmed Z, etal., Nat Commun. 2015 Jun 24;6:7354. doi: 10.1038/ncomms8354.
2.
Syndapin I and endophilin I bind overlapping proline-rich regions of dynamin I: role in synaptic vesicle endocytosis.
Anggono V and Robinson PJ, J Neurochem. 2007 Aug;102(3):931-43. Epub 2007 Apr 16.
3.
Met, metastasis, motility and more.
Birchmeier C, etal., Nat Rev Mol Cell Biol. 2003 Dec;4(12):915-25.
4.
Repetitive peroxide exposure reveals pleiotropic mitogen-activated protein kinase signaling mechanisms.
Chadwick W, etal., J Signal Transuct. 2011;2011. pii: 636951.
5.
Mammalian Grb2 regulates multiple steps in embryonic development and malignant transformation.
Cheng AM, etal., Cell 1998 Dec 11;95(6):793-803.
6.
SLP-76-Cbl-Grb2-Shc interactions in FcgammaRI signaling.
Chu J, etal., Blood. 1998 Sep 1;92(5):1697-706.
7.
EGF-ERBB signalling: towards the systems level.
Citri A and Yarden Y, Nat Rev Mol Cell Biol. 2006 Jul;7(7):505-16.
8.
Interaction of protein tyrosine phosphatase (PTP) 1B with its substrates is influenced by two distinct binding domains.
Dadke S and Chernoff J, Biochem J. 2002 Jun 1;364(Pt 2):377-83.
9.
Distinct tyrosine autophosphorylation sites negatively and positively modulate neu-mediated transformation.
Dankort DL, etal., Mol Cell Biol. 1997 Sep;17(9):5410-25.
10.
Effects of age on elements of insulin-signaling pathway in central nervous system of rats.
Fernandes ML, etal., Endocrine. 2001 Dec;16(3):227-34.
11.
Tyrosine phosphorylation of Cbl upon epidermal growth factor (EGF) stimulation and its association with EGF receptor and downstream signaling proteins.
Fukazawa T, etal., J Biol Chem. 1996 Jun 14;271(24):14554-9.
12.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
13.
The Met tyrosine kinase receptor in development and cancer.
Gentile A, etal., Cancer Metastasis Rev. 2008 Mar;27(1):85-94.
14.
Grb2-SH3 ligand inhibits the growth of HER2+ cancer cells and has antitumor effects in human cancer xenografts alone and in combination with docetaxel.
Gril B, etal., Int J Cancer. 2007 Jul 15;121(2):407-15. doi: 10.1002/ijc.22674.
15.
TrkB receptor signalling: implications in neurodegenerative, psychiatric and proliferative disorders.
Gupta VK, etal., Int J Mol Sci. 2013 May 13;14(5):10122-42. doi: 10.3390/ijms140510122.
16.
Insulin receptor substrate-1/SHP-2 interaction, a phenotype-dependent switching machinery of insulin-like growth factor-I signaling in vascular smooth muscle cells.
Hayashi K, etal., J Biol Chem. 2004 Sep 24;279(39):40807-18. Epub 2004 Jul 21.
17.
The regulatory subunit of PDE6 interacts with PACSIN in photoreceptors.
Houdart F, etal., Mol Vis. 2005 Dec 9;11:1061-70.
18.
Phosphorylation of cbl after stimulation of Nb2 cells with prolactin and its association with phosphatidylinositol 3-kinase.
Hunter S, etal., Mol Endocrinol. 1997 Aug;11(9):1213-22.
19.
Functional importance of Shc tyrosine 317 on insulin signaling in Rat1 fibroblasts expressing insulin receptors.
Ishihara H, etal., J Biol Chem. 1997 Apr 4;272(14):9581-6.
20.
Molecular cloning of SLP-76, a 76-kDa tyrosine phosphoprotein associated with Grb2 in T cells.
Jackman JK, etal., J Biol Chem. 1995 Mar 31;270(13):7029-32.
21.
KEGG: Kyoto Encyclopedia of Genes and Genomes
KEGG
22.
Insulin signaling through insulin receptor substrate 1 and 2 in normal liver development.
Khamzina L, etal., Gastroenterology 2003 Aug;125(2):572-85.
23.
Downstream signaling molecules bind to different phosphorylated immunoreceptor tyrosine-based activation motif (ITAM) peptides of the high affinity IgE receptor.
Kimura T, etal., J Biol Chem. 1996 Nov 1;271(44):27962-8.
24.
Epidermal growth factor-induced phosphatidylinositol 3-kinase activation and DNA synthesis. Identification of Grb2-associated binder 2 as the major mediator in rat hepatocytes.
Kong M, etal., J Biol Chem. 2000 Nov 17;275(46):36035-42.
25.
Overexpression of MUC1 and Genomic Alterations in Its Network Associate with Prostate Cancer Progression.
Lin X, etal., Neoplasia. 2017 Nov;19(11):857-867. doi: 10.1016/j.neo.2017.06.006. Epub 2017 Sep 18.
26.
Direct binding of the proline-rich region of protein tyrosine phosphatase 1B to the Src homology 3 domain of p130(Cas).
Liu F, etal., J Biol Chem. 1996 Dec 6;271(49):31290-5.
27.
Direct binding of the signaling adapter protein Grb2 to the activation loop tyrosines on the nerve growth factor receptor tyrosine kinase, TrkA.
MacDonald JI, etal., J Biol Chem. 2000 Jun 16;275(24):18225-33.
28.
Cloning of ASH, a ubiquitous protein composed of one Src homology region (SH) 2 and two SH3 domains, from human and rat cDNA libraries.
Matuoka K, etal., Proc Natl Acad Sci U S A 1992 Oct 1;89(19):9015-9.
29.
Interaction of Grb2 via its Src homology 3 domains with synaptic proteins including synapsin I.
McPherson PS, etal., Proc Natl Acad Sci U S A. 1994 Jul 5;91(14):6486-90. doi: 10.1073/pnas.91.14.6486.
30.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
31.
IL-6/IL-6 receptor system and its role in physiological and pathological conditions.
Mihara M, etal., Clin Sci (Lond). 2012 Feb;122(4):143-59. doi: 10.1042/CS20110340.
32.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
33.
p120cbl is a major substrate of tyrosine phosphorylation upon B cell antigen receptor stimulation and interacts in vivo with Fyn and Syk tyrosine kinases, Grb2 and Shc adaptors, and the p85 subunit of phosphatidylinositol 3-kinase.
Panchamoorthy G, etal., J Biol Chem. 1996 Feb 9;271(6):3187-94.
34.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
35.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
36.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
37.
Shc and CEACAM1 interact to regulate the mitogenic action of insulin.
Poy MN, etal., J Biol Chem. 2002 Jan 11;277(2):1076-84. Epub 2001 Nov 1.
38.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
39.
Signal transduction through tyrosine-phosphorylated C-terminal fragments of amyloid precursor protein via an enhanced interaction with Shc/Grb2 adaptor proteins in reactive astrocytes of Alzheimer's disease brain.
Russo C, etal., J Biol Chem 2002 Sep 20;277(38):35282-8.
40.
Formation of Shc-Grb2 complexes is necessary to induce neoplastic transformation by overexpression of Shc proteins.
Salcini AE, etal., Oncogene. 1994 Oct;9(10):2827-36.
41.
The signaling pathway coupling epidermal growth factor receptors to activation of p21ras.
Sasaoka T, etal., J Biol Chem. 1994 Dec 23;269(51):32621-5.
42.
mDia-interacting protein acts downstream of Rho-mDia and modifies Src activation and stress fiber formation.
Satoh S and Tominaga T, J Biol Chem. 2001 Oct 19;276(42):39290-4. Epub 2001 Aug 16.
43.
Gene dosage-dependent functions for phosphotyrosine-Grb2 signaling during mammalian tissue morphogenesis.
Saxton TM, etal., Curr Biol 2001 May 1;11(9):662-70.
44.
DISC1 regulates neurotrophin-induced axon elongation via interaction with Grb2.
Shinoda T, etal., J Neurosci. 2007 Jan 3;27(1):4-14.
45.
Insulin promotes proliferation, survival, and invasion in endometrial carcinoma by activating the MEK/ERK pathway.
Wang Y, etal., Cancer Lett. 2012 Sep 28;322(2):223-31. doi: 10.1016/j.canlet.2012.03.026. Epub 2012 Mar 27.
46.
Splicing isoforms of rat Ash/Grb2. Isolation and characterization of the cDNA and genomic DNA clones and implications for the physiological roles of the isoforms.
Watanabe K, etal., J Biol Chem 1995 Jun 9;270(23):13733-9.
47.
Selection of ligands by panning of domain libraries displayed on phage lambda reveals new potential partners of synaptojanin 1.
Zucconi A, etal., J Mol Biol. 2001 Apr 13;307(5):1329-39.
Grb2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 101,380,354 - 101,448,138 (-) NCBI GRCr8 mRatBN7.2 10 100,881,404 - 100,949,193 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 100,869,718 - 100,949,309 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 105,941,694 - 106,010,414 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 105,404,767 - 105,473,487 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 100,802,375 - 100,870,155 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 104,193,953 - 104,263,071 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 104,193,955 - 104,263,071 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 104,019,823 - 104,087,251 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Rnor_5.0 10 104,735,560 - 104,738,091 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 105,722,014 - 105,818,649 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 105,737,088 - 105,833,269 (-) NCBI Celera 10 99,455,840 - 99,524,352 (-) NCBI Celera Cytogenetic Map 10 q32.1 NCBI
GRB2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 17 75,318,076 - 75,405,678 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 17 75,318,076 - 75,405,709 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 17 73,314,157 - 73,401,759 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 17 70,825,752 - 70,913,385 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 17 70,825,752 - 70,913,329 NCBI Celera 17 69,906,645 - 69,994,307 (-) NCBI Celera Cytogenetic Map 17 q25.1 NCBI HuRef 17 68,724,752 - 68,824,731 (-) NCBI HuRef CHM1_1 17 73,378,804 - 73,466,430 (-) NCBI CHM1_1 T2T-CHM13v2.0 17 76,210,297 - 76,297,898 (-) NCBI T2T-CHM13v2.0
Grb2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 115,534,871 - 115,599,423 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 115,534,871 - 115,599,423 (-) Ensembl GRCm39 Ensembl GRCm38 11 115,644,045 - 115,708,597 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 115,644,045 - 115,708,597 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 115,505,444 - 115,569,911 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 115,460,220 - 115,524,687 (-) NCBI MGSCv36 mm8 Celera 11 127,412,389 - 127,476,946 (-) NCBI Celera Cytogenetic Map 11 E2 NCBI cM Map 11 80.91 NCBI
Grb2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955553 2,186,590 - 2,259,456 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955553 2,186,590 - 2,258,964 (-) NCBI ChiLan1.0 ChiLan1.0
GRB2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 19 91,357,798 - 91,445,600 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 17 96,180,874 - 96,268,408 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 17 69,265,307 - 69,352,835 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 17 74,817,471 - 74,904,022 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 17 74,817,471 - 74,903,796 (-) Ensembl panpan1.1 panPan2
GRB2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 9 5,108,128 - 5,182,091 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 9 5,117,164 - 5,180,296 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 9 5,787,497 - 5,861,309 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 9 5,778,347 - 5,852,258 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 9 5,778,263 - 5,852,254 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 9 5,817,381 - 5,891,089 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 9 5,927,508 - 6,001,301 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 9 5,988,590 - 6,061,075 (+) NCBI UU_Cfam_GSD_1.0
Grb2
GRB2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 12 5,940,647 - 6,010,835 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 12 5,940,723 - 6,009,095 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 12 5,860,464 - 5,928,885 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
GRB2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 16 46,264,818 - 46,346,426 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 16 46,264,825 - 46,347,156 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666077 17,032,097 - 17,115,635 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Grb2
.
Predicted Target Of
Count of predictions: 248 Count of miRNA genes: 146 Interacting mature miRNAs: 182 Transcripts: ENSRNOT00000005347 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1354641 Bvd2 Brain ventricular dilatation QTL 2 6.36 0.001 brain ventricle morphology trait (VT:0000822) hydrocephalus severity score (CMO:0001881) 10 93223816 107057807 Rat 61449 Ciaa2 CIA Autoantibody QTL 2 7.1 blood autoantibody amount (VT:0003725) calculated serum anti-type 2 collagen antibody titer (CMO:0001279) 10 63221094 107211142 Rat 61325 Aia5 Adjuvant induced arthritis QTL 5 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1298078 Stresp5 Stress response QTL 5 2.99 0.00025 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 42045676 104670812 Rat 1549831 Bss6 Bone structure and strength QTL 6 4 lumbar vertebra strength trait (VT:0010574) vertebra ultimate force (CMO:0001678) 10 57576521 102576521 Rat 1579915 Bp280 Blood pressure QTL 280 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 90404397 107211142 Rat 2298548 Neuinf7 Neuroinflammation QTL 7 3.4 nervous system integrity trait (VT:0010566) spinal cord RT1-B protein level (CMO:0002132) 10 72224939 107211142 Rat 1302404 Cia27 Collagen induced arthritis QTL 27 2.6 0.0045 joint integrity trait (VT:0010548) experimental arthritis severity measurement (CMO:0001459) 10 76452683 107211142 Rat 2317754 Glom25 Glomerulus QTL 25 3.5 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 10 82685200 107211142 Rat 70168 Eae12 Experimental allergic encephalomyelitis QTL 12 0.0009 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 10 92238497 101012337 Rat 70171 Cari1 Carrageenan-induced inflammation QTL 1 4.9 0.0005 hypodermis integrity trait (VT:0010550) inflammatory exudate volume (CMO:0001429) 10 53797385 107211142 Rat 10450493 Bp382 Blood pressure QTL 382 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 94759759 107211142 Rat 1578672 Bmd16 Bone mineral density QTL 16 6.2 femur mineral mass (VT:0010011) compact volumetric bone mineral density (CMO:0001730) 10 96703043 107057807 Rat 61354 Pia10 Pristane induced arthritis QTL 10 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2313103 Bss80 Bone structure and strength QTL 80 2 0.0001 tibia strength trait (VT:1000284) tibia midshaft endosteal cross-sectional area (CMO:0001716) 10 62057807 107057807 Rat 2293646 Bss25 Bone structure and strength QTL 25 10.96 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 10 69738412 107211142 Rat 2303118 Mamtr7 Mammary tumor resistance QTL 7 0.003 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 9658275 104670812 Rat 2300172 Bmd57 Bone mineral density QTL 57 9.8 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 10 69738412 107211142 Rat 70193 Mcs7 Mammary carcinoma susceptibility QTL 7 2.38 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 10 72224939 107211142 Rat 2313105 Bss79 Bone structure and strength QTL 79 1.8 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 10 62057807 107057807 Rat 61363 Oia3 Oil induced arthritis QTL 3 0.001 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 87307617 107211142 Rat 2316949 Gluco60 Glucose level QTL 60 3.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 14487011 107057807 Rat 724530 Bp149 Blood pressure QTL 149 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 90627439 107211142 Rat 1300137 Bp186 Blood pressure QTL 186 3.57 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 10 90627439 107057807 Rat 2293663 Bss33 Bone structure and strength QTL 33 9.34 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 10 69738412 107211142 Rat 1578663 Bss18 Bone structure and strength QTL 18 3.6 femur width (VT:1000666) femoral neck width (CMO:0001695) 10 96703043 107057807 Rat 7387312 Bw125 Body weight QTL 125 3 0.0047 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight (CMO:0000356) 10 64890616 107211142 Rat 2312672 Insul15 Insulin level QTL 15 0.01 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 10 57134272 102134272 Rat 6893357 Bw102 Body weight QTL 102 0.5 0.36 body mass (VT:0001259) body weight (CMO:0000012) 10 80515287 101325465 Rat 12880384 Cm107 Cardiac mass QTL 107 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 90404397 107211142 Rat 12880385 Cm108 Cardiac mass QTL 108 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 90404397 107211142 Rat 2317029 Aia19 Adjuvant induced arthritis QTL 19 2.98 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 10 66978955 107211142 Rat 2303589 Bw87 Body weight QTL 87 2 body mass (VT:0001259) body weight (CMO:0000012) 10 81285008 107211142 Rat 12880396 Am13 Aortic mass QTL 13 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 10 90404397 107211142 Rat 12880398 Kidm67 Kidney mass QTL 67 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 10 90404397 107211142 Rat 61387 Bp1 Blood pressure QTL 1 5.1 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 10 51770177 107211142 Rat 2317039 Aia6 Adjuvant induced arthritis QTL 6 4.31 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 10 66978955 107211142 Rat 12880395 Cm109 Cardiac mass QTL 109 0.001 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 10 90404397 107211142 Rat 61396 Bp9 Blood pressure QTL 9 4.8 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 68420376 107211142 Rat 634320 Niddm49 Non-insulin dependent diabetes mellitus QTL 49 4.41 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 10 88539139 107211142 Rat 1331791 Cm31 Cardiac mass QTL 31 3.84606 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 29299504 107211142 Rat 10450498 Bp384 Blood pressure QTL 384 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 67750049 107211142 Rat 4889492 Pancm2 Pancreatic morphology QTL 2 3.2 pancreatic beta cell morphology trait (VT:0005217) ratio of insulin-positive cell area to total area of splenic region of pancreas (CMO:0001814) 10 76748906 107211142 Rat 6893366 Bw106 Body weight QTL 106 0.3 0.47 body mass (VT:0001259) body weight (CMO:0000012) 10 70199100 107211142 Rat 2293698 Bss43 Bone structure and strength QTL 43 5.33 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 10 59209888 104209888 Rat 1576313 Pia25 Pristane induced arthritis QTL 25 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 96120911 104060283 Rat 631267 Cia20 Collagen induced arthritis QTL 20 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1576307 Cia28 Collagen induced arthritis QTL 28 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 96120911 104060283 Rat 1576308 Schws1 Schwannoma susceptibility QTL 1 0.0041 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 10 40035094 102359817 Rat 631269 Cia22 Collagen induced arthritis QTL 22 8.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 631268 Cia21 Collagen induced arthritis QTL 21 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 14487011 104060283 Rat 631270 Cia23 Collagen induced arthritis QTL 23 3.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 2292438 Bp311 Blood pressure QTL 311 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 76246085 107211142 Rat 2312662 Slep8 Serum leptin concentration QTL 8 0.05 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 10 57134272 102134272 Rat 2292436 Bp310 Blood pressure QTL 310 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 94759759 107211142 Rat 1600367 Mcs15 Mammary carcinoma susceptibility QTL 15 4.5 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 10 85565469 103884409 Rat 631539 Oia6 Oil induced arthritis QTL 6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 97010147 104670812 Rat 631538 Oia5 Oil induced arthritis QTL 5 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 87055121 107211142 Rat 61436 Cia5 Collagen induced arthritis QTL 5 4.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 91228102 104060283 Rat 1642980 Bp300 Blood pressure QTL 300 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 68383129 107211142 Rat 2312668 Scl65 Serum cholesterol level QTL 65 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 10 57134272 102134272 Rat
RH133824
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 100,882,910 - 100,883,103 (+) MAPPER mRatBN7.2 Rnor_6.0 10 105,068,742 - 105,068,932 NCBI Rnor6.0 Rnor_6.0 10 104,195,460 - 104,195,652 NCBI Rnor6.0 Rnor_5.0 10 104,085,552 - 104,085,744 UniSTS Rnor5.0 Rnor_5.0 10 104,737,067 - 104,737,257 UniSTS Rnor5.0 RGSC_v3.4 10 105,723,521 - 105,723,713 UniSTS RGSC3.4 Celera 10 99,457,347 - 99,457,539 UniSTS Cytogenetic Map 10 q32.3 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000005347 ⟹ ENSRNOP00000005347
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 100,881,416 - 100,939,377 (-) Ensembl Rnor_6.0 Ensembl 10 104,193,955 - 104,263,071 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000095127 ⟹ ENSRNOP00000080275
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 100,881,962 - 100,949,309 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000111297 ⟹ ENSRNOP00000083430
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 100,869,718 - 100,949,269 (-) Ensembl
RefSeq Acc Id:
NM_030846 ⟹ NP_110473
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 101,380,354 - 101,448,138 (-) NCBI mRatBN7.2 10 100,881,404 - 100,949,193 (-) NCBI Rnor_6.0 10 104,193,953 - 104,263,071 (-) NCBI Rnor_5.0 10 104,735,560 - 104,738,091 (-) NCBI RGSC_v3.4 10 105,722,014 - 105,818,649 (-) RGD Celera 10 99,455,840 - 99,524,352 (-) RGD
Sequence:
CGGCCGCGGGCGGCAGCACAAGGCGGGCCAGGCCGGGTGAGGGAGCGGACGGCACGTCGCGGGTGGCATTGTGTGTCCCAGTGTGCAAGAATAGCCCCAGAAGAGGAAAGGCTGAGCCCAGAGCGCTT
hide sequence
RefSeq Acc Id:
NP_110473 ⟸ NM_030846
- UniProtKB:
Q5BKA7 (UniProtKB/Swiss-Prot), P62994 (UniProtKB/Swiss-Prot), A6HKQ4 (UniProtKB/TrEMBL), A0A8L2Q1H5 (UniProtKB/TrEMBL)
- Sequence:
MEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYIEMKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSL
hide sequence
Ensembl Acc Id:
ENSRNOP00000005347 ⟸ ENSRNOT00000005347
Ensembl Acc Id:
ENSRNOP00000083430 ⟸ ENSRNOT00000111297
Ensembl Acc Id:
ENSRNOP00000080275 ⟸ ENSRNOT00000095127
RGD ID: 13697894 Promoter ID: EPDNEW_R8418 Type: initiation region Name: Grb2_1 Description: growth factor receptor bound protein 2 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 10 104,263,169 - 104,263,229 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2021-03-09
Grb2
growth factor receptor bound protein 2
LOC103690155
uncharacterized LOC103690155
Data merged from RGD:9320652
737654 PROVISIONAL
2014-08-25
LOC103690155
uncharacterized LOC103690155
Symbol and Name status set to provisional
70820 PROVISIONAL
2005-01-20
Grb2
growth factor receptor bound protein 2
Symbol and Name status set to approved
1299863 APPROVED
2002-08-07
Grb2
growth factor receptor bound protein 2
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_homology
mammalian homolog of C. elegans Sem-5
728541
