Symbol:
Cbl
Name:
Cbl proto-oncogene
RGD ID:
1561386
Description:
Enables several functions, including SH3 domain binding activity; phosphatidylinositol 3-kinase regulatory subunit binding activity; and protein tyrosine kinase binding activity. Involved in several processes, including cellular response to platelet-derived growth factor stimulus; mast cell degranulation; and protein ubiquitination. Located in focal adhesion; growth cone; and perinuclear region of cytoplasm. Used to study transient cerebral ischemia. Biomarker of congenital diaphragmatic hernia; hyperglycemia; and type 1 diabetes mellitus. Human ortholog(s) of this gene implicated in acute myeloid leukemia; congestive heart failure; juvenile myelomonocytic leukemia; lung non-small cell carcinoma; and myeloid neoplasm. Orthologous to human CBL (Cbl proto-oncogene); PARTICIPATES IN ephrin - ephrin receptor bidirectional signaling axis; epidermal growth factor/neuregulin signaling pathway; erythropoietin signaling pathway; INTERACTS WITH 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine; 3,4-methylenedioxymethamphetamine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
c-Cbl; Cas-Br-M (murine) ecotropic retroviral transforming sequence; Casitas B-lineage lymphoma; Cbl proto-oncogene, E3 ubiquitin protein ligase; E3 ubiquitin-protein ligase CBL; LOC500985; RGD1561386; similar to CBL E3 ubiquitin protein ligase (Signal transduction protein CBL); similar to CBL E3 ubiquitin protein ligase (Signal transduction protein CBL) (Proto-oncogene c-CBL) (Casitas B-lineage lymphoma proto-oncogene)
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
CBL (Cbl proto-oncogene) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Mus musculus (house mouse):
Cbl (Casitas B-lineage lymphoma) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Cbl (Cbl proto-oncogene) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
CBL (Cbl proto-oncogene) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
CBL (Cbl proto-oncogene) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Cbl (Cbl proto-oncogene) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
CBL (Cbl proto-oncogene) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
CBL (Cbl proto-oncogene) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Cbl (Cbl proto-oncogene) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
CBL (Cbl proto-oncogene)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Cbl (Casitas B-lineage lymphoma)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
cbl (Cbl proto-oncogene, E3 ubiquitin protein ligase)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Cbl
Alliance
DIOPT (Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
sli-1
Alliance
DIOPT (Hieranoid|InParanoid|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
cbl
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 53,384,656 - 53,468,067 (-) NCBI GRCr8 mRatBN7.2 8 44,487,824 - 44,571,620 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 44,489,410 - 44,571,176 (-) Ensembl mRatBN7.2 Ensembl Rnor_6.0 8 48,481,256 - 48,564,775 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 48,489,036 - 48,564,722 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 47,105,710 - 47,183,347 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 47,135,357 - 47,211,889 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 8 44,074,668 - 44,158,034 (-) NCBI Celera Cytogenetic Map 8 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Cbl Rat (S)-nicotine increases expression ISO CBL (Homo sapiens) 6480464 Nicotine results in increased expression of CBL mRNA CTD PMID:18247414 Cbl Rat 17alpha-ethynylestradiol increases expression ISO Cbl (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of CBL mRNA CTD PMID:17942748 Cbl Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of CBL mRNA CTD PMID:29097150 Cbl Rat 17alpha-ethynylestradiol multiple interactions ISO Cbl (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of CBL mRNA CTD PMID:17942748 Cbl Rat 17beta-estradiol increases expression ISO CBL (Homo sapiens) 6480464 Estradiol results in increased expression of CBL mRNA CTD PMID:23019147 Cbl Rat 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one increases expression ISO Cbl (Mus musculus) 6480464 Metribolone results in increased expression of CBL mRNA CTD PMID:16301331 Cbl Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Cbl (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of CBL mRNA CTD PMID:17942748 Cbl Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of CBL mRNA CTD PMID:33387578 Cbl Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of CBL mRNA CTD PMID:32109520 Cbl Rat 2,3,7,8-tetrachlorodibenzodioxine decreases phosphorylation EXP 6480464 Tetrachlorodibenzodioxin results in decreased phosphorylation of CBL protein CTD PMID:9918770 Cbl Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 CBL protein promotes the reaction [Tetrachlorodibenzodioxin promotes the reaction [GRB2 protein binds to SOS1 protein]] and CBL protein promotes the reaction [Tetrachlorodibenzodioxin promotes the reaction [SHC1 protein binds to [GRB2 protein binds to SOS1 protein]]] CTD PMID:9918770 Cbl Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Cbl (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of CBL mRNA CTD PMID:21570461 Cbl Rat 2-methylcholine affects expression ISO CBL (Homo sapiens) 6480464 beta-methylcholine affects the expression of CBL mRNA CTD PMID:21179406 Cbl Rat 2-naphthylamine increases expression ISO CBL (Homo sapiens) 6480464 2-Naphthylamine results in increased expression of CBL mRNA CTD PMID:18247414 Cbl Rat 3,4-methylenedioxymethamphetamine increases expression ISO Cbl (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of CBL mRNA CTD PMID:20188158 Cbl Rat 3,4-methylenedioxymethamphetamine decreases expression EXP 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of CBL mRNA CTD PMID:30071829 Cbl Rat acrolein multiple interactions ISO CBL (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of CBL mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in decreased expression of CBL mRNA CTD PMID:32699268 Cbl Rat aflatoxin B1 increases expression ISO Cbl (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of CBL mRNA CTD PMID:19770486 Cbl Rat aflatoxin B1 increases expression ISO CBL (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of CBL mRNA CTD PMID:21641981 Cbl Rat all-trans-retinoic acid increases expression ISO CBL (Homo sapiens) 6480464 Tretinoin results in increased expression of CBL mRNA CTD PMID:33167477 Cbl Rat alpha-pinene multiple interactions ISO CBL (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of CBL mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in decreased expression of CBL mRNA CTD PMID:32699268 Cbl Rat amphetamine decreases expression EXP 6480464 Amphetamine results in decreased expression of CBL mRNA CTD PMID:30779732 Cbl Rat arsenite(3-) increases phosphorylation ISO Cbl (Mus musculus) 6480464 arsenite results in increased phosphorylation of CBL protein CTD PMID:14511371 Cbl Rat arsenite(3-) multiple interactions ISO CBL (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to CBL mRNA] CTD PMID:32406909 Cbl Rat arsenite(3-) multiple interactions ISO Cbl (Mus musculus) 6480464 tyrphostin 25 inhibits the reaction [arsenite results in increased phosphorylation of CBL protein] CTD PMID:14511371 Cbl Rat arsenous acid multiple interactions ISO CBL (Homo sapiens) 6480464 [Bortezomib results in decreased activity of CBL protein] promotes the reaction [Arsenic Trioxide results in increased activity of AKT1 protein] CTD PMID:19457607 Cbl Rat arsenous acid increases expression ISO CBL (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of CBL protein CTD PMID:19457607 Cbl Rat benzo[a]pyrene increases expression ISO CBL (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of CBL mRNA CTD PMID:18247414 more ... Cbl Rat benzo[a]pyrene diol epoxide I decreases expression ISO CBL (Homo sapiens) 6480464 7 more ... CTD PMID:20018196 Cbl Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of CBL mRNA CTD PMID:25181051 Cbl Rat bisphenol A increases expression ISO CBL (Homo sapiens) 6480464 bisphenol A results in increased expression of CBL mRNA CTD PMID:33670352 Cbl Rat bisphenol A decreases expression ISO Cbl (Mus musculus) 6480464 bisphenol A results in decreased expression of CBL mRNA CTD PMID:38074096 Cbl Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of CBL mRNA CTD PMID:30816183 Cbl Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of CBL mRNA CTD PMID:29097150 Cbl Rat bisphenol A affects methylation ISO Cbl (Mus musculus) 6480464 bisphenol A affects the methylation of CBL promoter CTD PMID:27334623 Cbl Rat bisphenol AF increases expression EXP 6480464 bisphenol AF results in increased expression of CBL mRNA CTD PMID:27567155 Cbl Rat bisphenol F increases expression ISO Cbl (Mus musculus) 6480464 bisphenol F results in increased expression of CBL mRNA CTD PMID:38685157 Cbl Rat bortezomib multiple interactions ISO CBL (Homo sapiens) 6480464 [Bortezomib results in decreased activity of CBL protein] promotes the reaction [arsenic trioxide results in increased activity of AKT1 protein] CTD PMID:19457607 Cbl Rat cadmium atom multiple interactions ISO CBL (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of CBL mRNA CTD PMID:35301059 Cbl Rat cadmium dichloride multiple interactions ISO CBL (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of CBL mRNA CTD PMID:35301059 Cbl Rat carbamazepine affects expression ISO CBL (Homo sapiens) 6480464 Carbamazepine affects the expression of CBL mRNA CTD PMID:24752500 Cbl Rat carbon nanotube increases expression ISO Cbl (Mus musculus) 6480464 Nanotubes and Carbon results in increased expression of CBL mRNA CTD PMID:25554681 Cbl Rat CGP 52608 multiple interactions ISO CBL (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to CBL gene] CTD PMID:28238834 Cbl Rat chloroprene increases expression EXP 6480464 Chloroprene results in increased expression of CBL mRNA CTD PMID:23125180 Cbl Rat chlorpyrifos decreases expression ISO Cbl (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of CBL mRNA CTD PMID:37019170 Cbl Rat cisplatin decreases expression ISO CBL (Homo sapiens) 6480464 Cisplatin results in decreased expression of CBL mRNA CTD PMID:27594783 Cbl Rat copper(II) sulfate increases expression ISO CBL (Homo sapiens) 6480464 Copper Sulfate results in increased expression of CBL mRNA CTD PMID:19549813 Cbl Rat cyclosporin A increases expression ISO CBL (Homo sapiens) 6480464 Cyclosporine results in increased expression of CBL mRNA CTD PMID:25562108 Cbl Rat diarsenic trioxide multiple interactions ISO CBL (Homo sapiens) 6480464 [Bortezomib results in decreased activity of CBL protein] promotes the reaction [Arsenic Trioxide results in increased activity of AKT1 protein] CTD PMID:19457607 Cbl Rat diarsenic trioxide increases expression ISO CBL (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of CBL protein CTD PMID:19457607 Cbl Rat diclofenac affects expression ISO CBL (Homo sapiens) 6480464 Diclofenac affects the expression of CBL mRNA CTD PMID:24752500 Cbl Rat dicrotophos increases expression ISO CBL (Homo sapiens) 6480464 dicrotophos results in increased expression of CBL mRNA CTD PMID:28302478 Cbl Rat dieldrin decreases response to substance ISO CBL (Homo sapiens) 6480464 CBL gene mutant form results in decreased susceptibility to Dieldrin CTD PMID:32421776 Cbl Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of CBL mRNA CTD PMID:25152437 Cbl Rat dorsomorphin multiple interactions ISO CBL (Homo sapiens) 6480464 [NOG protein co-treated with methylmercuric chloride co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of CBL mRNA CTD PMID:27188386 Cbl Rat doxorubicin decreases expression ISO CBL (Homo sapiens) 6480464 Doxorubicin results in decreased expression of CBL mRNA CTD PMID:29803840 Cbl Rat enzyme inhibitor multiple interactions ISO CBL (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of CBL protein CTD PMID:23301498 Cbl Rat ethanol multiple interactions EXP 6480464 Ethanol inhibits the reaction [INS1 protein results in increased phosphorylation of and affects the localization of CBL protein] CTD PMID:16105861 Cbl Rat ethanol increases expression ISO Cbl (Mus musculus) 6480464 Ethanol results in increased expression of CBL mRNA CTD PMID:30319688 Cbl Rat fipronil increases expression EXP 6480464 fipronil results in increased expression of CBL mRNA CTD PMID:34044035 Cbl Rat flutamide affects expression ISO Cbl (Mus musculus) 6480464 Flutamide affects the expression of CBL mRNA CTD PMID:16301331 Cbl Rat flutamide multiple interactions ISO Cbl (Mus musculus) 6480464 [CBL protein affects the susceptibility to Flutamide] which affects the expression of BIRC3 mRNA more ... CTD PMID:16301331 Cbl Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of CBL mRNA CTD PMID:16301331 Cbl Rat flutamide multiple interactions EXP 6480464 Flutamide results in decreased expression of and results in decreased phosphorylation of CBL protein CTD PMID:16301331 Cbl Rat FR900359 decreases phosphorylation ISO CBL (Homo sapiens) 6480464 FR900359 results in decreased phosphorylation of CBL protein CTD PMID:37730182 Cbl Rat geldanamycin increases expression ISO CBL (Homo sapiens) 6480464 geldanamycin results in increased expression of CBL mRNA CTD PMID:26705709 Cbl Rat ivermectin decreases expression ISO CBL (Homo sapiens) 6480464 Ivermectin results in decreased expression of CBL protein CTD PMID:32959892 Cbl Rat lead diacetate multiple interactions EXP 6480464 CBL protein affects the reaction [lead acetate results in decreased expression of PDGFRA protein] CTD PMID:17298174 Cbl Rat lead diacetate increases phosphorylation EXP 6480464 lead acetate results in increased phosphorylation of CBL protein CTD PMID:17298174 Cbl Rat lead(0) multiple interactions EXP 6480464 CBL protein affects the reaction [Lead results in decreased expression of PDGFRA protein] CTD PMID:17298174 Cbl Rat lead(0) increases phosphorylation EXP 6480464 Lead results in increased phosphorylation of CBL protein CTD PMID:17298174 Cbl Rat mercury dichloride multiple interactions ISO Cbl (Mus musculus) 6480464 Mercuric Chloride promotes the reaction [HCK protein results in increased phosphorylation of CBL protein] CTD PMID:10092522 Cbl Rat mercury dichloride decreases expression ISO CBL (Homo sapiens) 6480464 Mercuric Chloride results in decreased expression of CBL mRNA CTD PMID:27188386 Cbl Rat methylmercury chloride increases expression ISO CBL (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of CBL mRNA CTD PMID:23179753 and PMID:26272509 Cbl Rat methylmercury chloride multiple interactions ISO CBL (Homo sapiens) 6480464 [NOG protein co-treated with methylmercuric chloride co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of CBL mRNA CTD PMID:27188386 Cbl Rat nicotine increases expression ISO CBL (Homo sapiens) 6480464 Nicotine results in increased expression of CBL mRNA CTD PMID:18247414 Cbl Rat nitrofen decreases expression EXP 6480464 nitrofen results in decreased expression of CBL mRNA and nitrofen results in decreased expression of CBL protein CTD PMID:23143077 Cbl Rat ozone multiple interactions ISO CBL (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of CBL mRNA more ... CTD PMID:32699268 Cbl Rat p-menthan-3-ol decreases expression ISO CBL (Homo sapiens) 6480464 Menthol results in decreased expression of CBL mRNA CTD PMID:26760959 Cbl Rat paracetamol increases expression ISO CBL (Homo sapiens) 6480464 Acetaminophen results in increased expression of CBL mRNA CTD PMID:22230336 and PMID:29067470 Cbl Rat paraquat multiple interactions EXP 6480464 CBL protein affects the reaction [Paraquat results in decreased expression of PDGFRA protein] CTD PMID:17298174 Cbl Rat paraquat increases phosphorylation EXP 6480464 Paraquat results in increased phosphorylation of CBL protein CTD PMID:17298174 Cbl Rat phenobarbital decreases expression ISO Cbl (Mus musculus) 6480464 Phenobarbital results in decreased expression of CBL mRNA CTD PMID:23091169 Cbl Rat phosphane affects expression EXP 6480464 phosphine affects the expression of CBL mRNA CTD PMID:34427094 Cbl Rat resveratrol decreases expression ISO CBL (Homo sapiens) 6480464 resveratrol results in decreased expression of CBL mRNA CTD PMID:25667456 Cbl Rat retinyl acetate increases expression ISO Cbl (Mus musculus) 6480464 retinol acetate results in increased expression of CBL mRNA CTD PMID:16772331 Cbl Rat SB 431542 multiple interactions ISO CBL (Homo sapiens) 6480464 [NOG protein co-treated with methylmercuric chloride co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of CBL mRNA CTD PMID:27188386 Cbl Rat silver atom decreases expression ISO Cbl (Mus musculus) 6480464 Silver results in decreased expression of CBL mRNA CTD PMID:27131904 Cbl Rat silver(0) decreases expression ISO Cbl (Mus musculus) 6480464 Silver results in decreased expression of CBL mRNA CTD PMID:27131904 Cbl Rat sodium arsenate increases expression ISO Cbl (Mus musculus) 6480464 sodium arsenate results in increased expression of CBL mRNA CTD PMID:21795629 Cbl Rat sodium arsenate decreases expression ISO Cbl (Mus musculus) 6480464 sodium arsenate results in decreased expression of CBL mRNA CTD PMID:21795629 Cbl Rat sodium arsenite increases expression ISO CBL (Homo sapiens) 6480464 sodium arsenite results in increased expression of CBL mRNA CTD PMID:38568856 Cbl Rat thimerosal decreases expression ISO CBL (Homo sapiens) 6480464 Thimerosal results in decreased expression of CBL mRNA CTD PMID:27188386 Cbl Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of CBL mRNA CTD PMID:23411599 and PMID:34492290 Cbl Rat titanium dioxide increases methylation ISO Cbl (Mus musculus) 6480464 titanium dioxide results in increased methylation of CBL gene CTD PMID:35295148 Cbl Rat torcetrapib increases expression ISO CBL (Homo sapiens) 6480464 torcetrapib results in increased expression of CBL mRNA CTD PMID:23228038 Cbl Rat trimellitic anhydride increases expression ISO Cbl (Mus musculus) 6480464 trimellitic anhydride results in increased expression of CBL mRNA CTD PMID:19042947 Cbl Rat troglitazone decreases expression ISO Cbl (Mus musculus) 6480464 troglitazone results in decreased expression of CBL mRNA CTD PMID:28973697 Cbl Rat tungsten decreases expression ISO Cbl (Mus musculus) 6480464 Tungsten results in decreased expression of CBL mRNA CTD PMID:30912803 Cbl Rat urethane increases expression ISO CBL (Homo sapiens) 6480464 Urethane results in increased expression of CBL mRNA CTD PMID:28818685 Cbl Rat valproic acid decreases expression EXP 6480464 Valproic Acid results in decreased expression of CBL mRNA CTD PMID:29427782 Cbl Rat valproic acid affects splicing EXP 6480464 Valproic Acid affects the splicing of CBL mRNA CTD PMID:29427782 Cbl Rat vorinostat decreases expression ISO CBL (Homo sapiens) 6480464 vorinostat results in decreased expression of CBL mRNA CTD PMID:27188386
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(S)-nicotine (ISO) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (ISO) 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-methylcholine (ISO) 2-naphthylamine (ISO) 3,4-methylenedioxymethamphetamine (EXP,ISO) acrolein (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) alpha-pinene (ISO) amphetamine (EXP) arsenite(3-) (ISO) arsenous acid (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bisphenol A (EXP,ISO) bisphenol AF (EXP) bisphenol F (ISO) bortezomib (ISO) cadmium atom (ISO) cadmium dichloride (ISO) carbamazepine (ISO) carbon nanotube (ISO) CGP 52608 (ISO) chloroprene (EXP) chlorpyrifos (ISO) cisplatin (ISO) copper(II) sulfate (ISO) cyclosporin A (ISO) diarsenic trioxide (ISO) diclofenac (ISO) dicrotophos (ISO) dieldrin (ISO) diuron (EXP) dorsomorphin (ISO) doxorubicin (ISO) enzyme inhibitor (ISO) ethanol (EXP,ISO) fipronil (EXP) flutamide (EXP,ISO) FR900359 (ISO) geldanamycin (ISO) ivermectin (ISO) lead diacetate (EXP) lead(0) (EXP) mercury dichloride (ISO) methylmercury chloride (ISO) nicotine (ISO) nitrofen (EXP) ozone (ISO) p-menthan-3-ol (ISO) paracetamol (ISO) paraquat (EXP) phenobarbital (ISO) phosphane (EXP) resveratrol (ISO) retinyl acetate (ISO) SB 431542 (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenate (ISO) sodium arsenite (ISO) thimerosal (ISO) thioacetamide (EXP) titanium dioxide (ISO) torcetrapib (ISO) trimellitic anhydride (ISO) troglitazone (ISO) tungsten (ISO) urethane (ISO) valproic acid (EXP) vorinostat (ISO)
Biological Process
cell surface receptor signaling pathway (IEA) cellular response to hypoxia (IEP) cellular response to nerve growth factor stimulus (IEP) cellular response to platelet-derived growth factor stimulus (IEP) DNA damage response (IEP) male gonad development (IEP) mast cell degranulation (IEP) negative regulation of apoptotic process (IEA,IMP,ISO) negative regulation of epidermal growth factor receptor signaling pathway (IBA,IEA,ISO) positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction (IEA,ISO) positive regulation of receptor-mediated endocytosis (IEA,ISO) protein autoubiquitination (IDA) protein monoubiquitination (IMP) protein polyubiquitination (IDA) protein ubiquitination (IEA,ISO) regulation of platelet-derived growth factor receptor-alpha signaling pathway (IEA,ISO) regulation of Rap protein signal transduction (IEA,ISO) regulation of signaling (IEA) response to activity (IEP) response to ethanol (IEP) response to gamma radiation (IEP) response to starvation (IEP) response to testosterone (IEP) signal transduction (IBA) ubiquitin-dependent endocytosis (IEA,ISO) ubiquitin-dependent protein catabolic process (IEA,ISO)
1.
Intraarticular interferon-beta gene therapy ameliorates adjuvant arthritis in rats.
Adriaansen J, etal., Hum Gene Ther. 2006 Oct;17(10):985-96.
2.
CBL mutations in myeloproliferative neoplasms are also found in the gene's proline-rich domain and in patients with the V617FJAK2.
Aranaz P, etal., Haematologica. 2012 Aug;97(8):1234-41. doi: 10.3324/haematol.2011.052605. Epub 2012 Feb 7.
3.
Exercise training increases components of the c-Cbl-associated protein/c-Cbl signaling cascade in muscle of obese Zucker rats.
Bernard JR, etal., Metabolism. 2008 Jun;57(6):858-66. doi: 10.1016/j.metabol.2008.01.035.
4.
SETA is a multifunctional adapter protein with three SH3 domains that binds Grb2, Cbl, and the novel SB1 proteins.
Borinstein SC, etal., Cell Signal 2000 Dec;12(11-12):769-79.
5.
Loss of c-Cbl expression correlates with de-differentiation status and lymphatic metastasis in gastric cancer.
Chen C, etal., Indian J Pathol Microbiol. 2019 Oct-Dec;62(4):549-555. doi: 10.4103/IJPM.IJPM_824_18.
6.
EGF-ERBB signalling: towards the systems level.
Citri A and Yarden Y, Nat Rev Mol Cell Biol. 2006 Jul;7(7):505-16.
7.
Androgen-dependent apoptosis in male germ cells is regulated through the proto-oncoprotein Cbl.
El Chami N, etal., J Cell Biol. 2005 Nov 21;171(4):651-61.
8.
[Expression down-regulation of c-Cbl and Cbl-b genes in peripheral blood mononuclear cells from multiple myeloma patients].
Fang S, etal., Xi Bao Yu Fen Zi Mian Yi Xue Za Zhi. 2013 Aug;29(8):842-5.
9.
Decreased pulmonary c-Cbl expression and tyrosine phosphorylation in the nitrofen-induced rat model of congenital diaphragmatic hernia.
Friedmacher F, etal., Pediatr Surg Int. 2013 Jan;29(1):19-24. doi: 10.1007/s00383-012-3191-6.
10.
Syk-dependent regulation of Hrs phosphorylation and ubiquitination upon FcepsilonRI engagement: impact on Hrs membrane/cytosol localization.
Gasparrini F, etal., Eur J Immunol. 2012 Oct;42(10):2744-53. doi: 10.1002/eji.201142278. Epub 2012 Jul 25.
11.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
12.
The Met tyrosine kinase receptor in development and cancer.
Gentile A, etal., Cancer Metastasis Rev. 2008 Mar;27(1):85-94.
13.
Evidence of a functional role for mast cells in the development of type 1 diabetes mellitus in the BioBreeding rat.
Geoffrey R, etal., J Immunol. 2006 Nov 15;177(10):7275-86.
14.
Frequent CBL mutations associated with 11q acquired uniparental disomy in myeloproliferative neoplasms.
Grand FH, etal., Blood. 2009 Jun 11;113(24):6182-92. doi: 10.1182/blood-2008-12-194548. Epub 2009 Apr 22.
15.
Recruitment of Pyk2 and Cbl to lipid rafts mediates signals important for actin reorganization in growing neurites.
Haglund K, etal., J Cell Sci. 2004 May 15;117(Pt 12):2557-68. Epub 2004 May 5.
16.
Phosphorylation of cbl after stimulation of Nb2 cells with prolactin and its association with phosphatidylinositol 3-kinase.
Hunter S, etal., Mol Endocrinol. 1997 Aug;11(9):1213-22.
17.
Evidence for functional roles of Crk-II in insulin and epidermal growth factor signaling in Rat-1 fibroblasts overexpressing insulin receptors.
Ishiki M, etal., Endocrinology. 1997 Nov;138(11):4950-8.
18.
Increased expression of the Cbl family of E3 ubiquitin ligases decreases Interleukin-2 production in a rat model of peripheral neuropathy.
Jeong JS, etal., BMC Anesthesiol. 2018 Jul 18;18(1):87. doi: 10.1186/s12871-018-0555-z.
19.
A high occurrence of acquisition and/or expansion of C-CBL mutant clones in the progression of high-risk myelodysplastic syndrome to acute myeloid leukemia.
Kao HW, etal., Neoplasia. 2011 Nov;13(11):1035-42.
20.
Full spectrum of clonal haematopoiesis-driver mutations in chronic heart failure and their associations with mortality.
Kiefer KC, etal., ESC Heart Fail. 2021 Jun;8(3):1873-1884. doi: 10.1002/ehf2.13297. Epub 2021 Mar 28.
21.
c-Cbl Expression Correlates with Human Colorectal Cancer Survival and Its Wnt/β-Catenin Suppressor Function Is Regulated by Tyr371 Phosphorylation.
Kumaradevan S, etal., Am J Pathol. 2018 Aug;188(8):1921-1933. doi: 10.1016/j.ajpath.2018.05.007. Epub 2018 Jul 17.
22.
An E3 ubiquitin ligase: c-Cbl: a new therapeutic target of lung cancer.
Lo FY, etal., Cancer. 2011 Dec 1;117(23):5344-50. doi: 10.1002/cncr.26153. Epub 2011 May 23.
23.
Mutations in CBL occur frequently in juvenile myelomonocytic leukemia.
Loh ML, etal., Blood. 2009 Aug 27;114(9):1859-63. doi: 10.1182/blood-2009-01-198416. Epub 2009 Jul 1.
24.
Evidence for a role of the ubiquitin-proteasome pathway in pancreatic islets.
López-Avalos MD, etal., Diabetes. 2006 May;55(5):1223-31.
25.
Is the c-Cbl proto-oncogene involved in chronic lymphocytic leukemia?
Mankai A, etal., Ann N Y Acad Sci. 2007 Jun;1107:193-205.
26.
Phosphorylation of c-Cbl protooncogene product following ethanol administration in rat cerebellum: possible involvement of Fyn kinase.
Nishio H, etal., Brain Res 2002 Sep 20;950(1-2):203-9.
27.
The leukocyte receptor CD84 inhibits Fc epsilon RI-mediated signaling through homophilic interaction in transfected RBL-2H3 cells.
Oliver-Vila I, etal., Mol Immunol. 2008 Apr;45(8):2138-49. doi: 10.1016/j.molimm.2007.12.006. Epub 2008 Feb 19.
28.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
29.
Characterization of Cbl tyrosine phosphorylation and a Cbl-Syk complex in RBL-2H3 cells.
Ota Y, etal., J Exp Med. 1996 Nov 1;184(5):1713-23.
30.
RAFTK/Pyk2 regulates EGF-induced PC12 cell spreading and movement.
Park SY, etal., Cell Signal. 2007 Feb;19(2):289-300. Epub 2006 Aug 30.
31.
The adaptor molecule CIN85 regulates Syk tyrosine kinase level by activating the ubiquitin-proteasome degradation pathway.
Peruzzi G, etal., J Immunol. 2007 Aug 15;179(4):2089-96.
32.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
33.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
34.
c-Cbl inhibition improves cardiac function and survival in response to myocardial ischemia.
Rafiq K, etal., Circulation. 2014 May 20;129(20):2031-43. doi: 10.1161/CIRCULATIONAHA.113.007004. Epub 2014 Feb 28.
35.
c-Cbl ubiquitin ligase regulates focal adhesion protein turnover and myofibril degeneration induced by neutrophil protease cathepsin G.
Rafiq K, etal., J Biol Chem. 2012 Feb 17;287(8):5327-39. doi: 10.1074/jbc.M111.307009. Epub 2011 Dec 27.
36.
c-Cbl deficiency leads to diminished lymphocyte development and functions in an age-dependent manner.
Rathinam C and Flavell RA, Proc Natl Acad Sci U S A. 2010 May 4;107(18):8316-21. doi: 10.1073/pnas.0914496107. Epub 2010 Apr 19.
37.
Myeloid leukemia development in c-Cbl RING finger mutant mice is dependent on FLT3 signaling.
Rathinam C, etal., Cancer Cell. 2010 Oct 19;18(4):341-52. doi: 10.1016/j.ccr.2010.09.008.
38.
GOA pipeline
RGD automated data pipeline
39.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
40.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
41.
Activation of atypical protein kinase Czeta toward TC10 is regulated by high-fat diet and aerobic exercise in skeletal muscle.
Saito M, etal., Metabolism. 2008 Sep;57(9):1173-80. doi: 10.1016/j.metabol.2008.03.023.
42.
Rho GTPases in insulin-stimulated glucose uptake.
Satoh T Small GTPases. 2014;5:e28102. doi: 10.4161/sgtp.28102. Epub 2014 Mar 10.
43.
Decreased insulin-dependent glucose transport by chronic ethanol feeding is associated with dysregulation of the Cbl/TC10 pathway in rat adipocytes.
Sebastian BM and Nagy LE, Am J Physiol Endocrinol Metab. 2005 Dec;289(6):E1077-84. Epub 2005 Aug 16.
44.
Cbl negatively regulates JNK activation and cell death.
Sproul AA, etal., Cell Res. 2009 Aug;19(8):950-61. doi: 10.1038/cr.2009.74.
45.
Abrogating Cbl-b in effector CD8(+) T cells improves the efficacy of adoptive therapy of leukemia in mice.
Stromnes IM, etal., J Clin Invest. 2010 Oct;120(10):3722-34. doi: 10.1172/JCI41991. Epub 2010 Sep 20.
46.
Targeting the E3 ubiquitin casitas B-lineage lymphoma decreases osteosarcoma cell growth and survival and reduces tumorigenesis.
Sévère N, etal., J Bone Miner Res. 2012 Oct;27(10):2108-17. doi: 10.1002/jbmr.1667.
47.
CBL is frequently altered in lung cancers: its relationship to mutations in MET and EGFR tyrosine kinases.
Tan YH, etal., PLoS One. 2010 Jan 29;5(1):e8972. doi: 10.1371/journal.pone.0008972.
48.
Suppression of c-Cbl tyrosine phosphorylation inhibits neointimal formation in balloon-injured rat arteries.
Tang Z, etal., Circulation. 2008 Aug 12;118(7):764-72. doi: 10.1161/CIRCULATIONAHA.107.761932. Epub 2008 Jul 28.
49.
Regulation of Cbl-associated protein/Cbl pathway in muscle and adipose tissues of two animal models of insulin resistance.
Thirone AC, etal., Endocrinology. 2004 Jan;145(1):281-93. Epub 2003 Oct 2.
50.
Dual inhibitory roles of geldanamycin on the c-Jun NH2-terminal kinase 3 signal pathway through suppressing the expression of mixed-lineage kinase 3 and attenuating the activation of apoptosis signal-regulating kinase 1 via facilitating the activation of Akt in ischemic brain injury.
Wen XR, etal., Neuroscience. 2008 Oct 15;156(3):483-97. Epub 2008 Aug 12.
51.
Peritumoral Cbl is a strong independent prognostic marker after curative resection of hepatocellular carcinoma.
Zhang JB, etal., Oncotarget. 2015 Nov 24;6(37):40223-34. doi: 10.18632/oncotarget.5540.
52.
Cbl-b and PI3K/Akt pathway are differently involved in oxygen-glucose deprivation preconditioning in PC12 cells.
Zhang W, etal., Chin Med J (Engl). 2013 Nov;126(21):4132-8.
Cbl Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 53,384,656 - 53,468,067 (-) NCBI GRCr8 mRatBN7.2 8 44,487,824 - 44,571,620 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 44,489,410 - 44,571,176 (-) Ensembl mRatBN7.2 Ensembl Rnor_6.0 8 48,481,256 - 48,564,775 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 48,489,036 - 48,564,722 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 47,105,710 - 47,183,347 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 47,135,357 - 47,211,889 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 8 44,074,668 - 44,158,034 (-) NCBI Celera Cytogenetic Map 8 q22 NCBI
CBL Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 11 119,206,339 - 119,308,149 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 11 119,206,298 - 119,313,926 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 11 119,077,049 - 119,178,859 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 11 118,582,200 - 118,684,069 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 11 118,582,199 - 118,684,068 NCBI Celera 11 116,236,024 - 116,339,059 (+) NCBI Celera Cytogenetic Map 11 q23.3 NCBI HuRef 11 115,017,373 - 115,119,562 (+) NCBI HuRef CHM1_1 11 118,963,252 - 119,065,411 (+) NCBI CHM1_1 T2T-CHM13v2.0 11 119,226,712 - 119,328,785 (+) NCBI T2T-CHM13v2.0
Cbl Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 9 44,054,273 - 44,145,556 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 9 44,054,273 - 44,145,346 (-) Ensembl GRCm39 Ensembl GRCm38 9 44,142,976 - 44,234,259 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 9 44,142,976 - 44,234,049 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 9 43,957,345 - 44,042,129 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 9 43,900,257 - 43,985,041 (-) NCBI MGSCv36 mm8 Celera 9 41,406,821 - 41,486,735 (-) NCBI Celera Cytogenetic Map 9 A5.1- A5.2 NCBI cM Map 9 24.72 NCBI
Cbl Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955412 20,307,011 - 20,388,539 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955412 20,307,011 - 20,388,539 (+) NCBI ChiLan1.0 ChiLan1.0
CBL Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 9 119,911,371 - 120,015,890 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 11 121,015,030 - 121,119,390 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 11 114,044,996 - 114,149,204 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 11 117,973,187 - 118,076,459 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 11 117,973,187 - 118,074,671 (+) Ensembl panpan1.1 panPan2
CBL Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 5 14,600,409 - 14,676,974 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 5 14,607,013 - 14,676,956 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 5 14,653,516 - 14,730,936 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 5 14,543,644 - 14,621,193 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 5 14,549,582 - 14,620,322 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 5 14,681,808 - 14,759,290 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 5 14,585,944 - 14,663,491 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 5 14,626,100 - 14,703,693 (-) NCBI UU_Cfam_GSD_1.0
Cbl Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404947 101,214,875 - 101,314,342 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936542 4,136,511 - 4,228,288 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936542 4,136,389 - 4,235,746 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
CBL Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 9 46,416,938 - 46,512,834 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 9 46,416,937 - 46,512,855 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 9 51,452,262 - 51,549,181 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
CBL Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 1 110,581,049 - 110,679,284 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 1 110,581,143 - 110,674,481 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666043 15,352,300 - 15,453,239 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Cbl
.
Predicted Target Of
Count of predictions: 36 Count of miRNA genes: 36 Interacting mature miRNAs: 36 Transcripts: ENSRNOT00000067902 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1298065 Scl16 Serum cholesterol level QTL 16 3.8 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 8 30856404 75856404 Rat 1554321 Bmd3 Bone mineral density QTL 3 7.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 40952565 123900184 Rat 1578769 Uae31 Urinary albumin excretion QTL 31 3.3 0.001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 30848154 101699754 Rat 1298079 Activ2 Activity QTL 2 9.5 0.000001 voluntary movement trait (VT:0003491) rearing measurement (CMO:0001515) 8 41866876 86866876 Rat 11556286 Cm81 Cardiac mass QTL 81 0.01 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 30848154 61290444 Rat 70161 Bp62 Blood pressure QTL 62 2.9 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 42692684 90165460 Rat 1578765 Klgr1 Kidney lesion grade QTL 1 3.3 0.0001 kidney morphology trait (VT:0002135) organ lesion measurement (CMO:0000677) 8 30848154 101699754 Rat 1582222 Epfw2 Epididymal fat weight QTL 2 3.2 0.0005 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 8 31737729 76737729 Rat 1354627 Despr14 Despair related QTL 14 0.0056 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 8 7688955 52688955 Rat 61464 Niddm11 Non-insulin dependent diabetes mellitus QTL 11 3.1 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 8 35582032 80582032 Rat 1578755 Pur5 Proteinuria QTL 5 3.3 0.0001 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 8 30848154 101699754 Rat 1300146 Rf17 Renal function QTL 17 2.9 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 8 28242912 73242912 Rat 8662823 Vetf5 Vascular elastic tissue fragility QTL 5 1.9 artery integrity trait (VT:0010639) patent ductus arteriosus score (CMO:0002566) 8 28242912 99525068 Rat 2313088 Bss75 Bone structure and strength QTL 75 3.1 0.0001 body length (VT:0001256) body length, nose to rump (CMO:0000079) 8 30848154 82460899 Rat 1358896 Bp262 Blood pressure QTL 262 2.89 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 27205715 99103503 Rat 731182 Uae24 Urinary albumin excretion QTL 24 6.4 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 19331152 93965294 Rat 724514 Uae15 Urinary albumin excretion QTL 15 2.9 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 29502665 70386295 Rat 61353 Bp35 Blood pressure QTL 35 0.001 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 8 30848154 61290444 Rat 631842 Inf1 Infertility severity QTL 1 4.1 0.001 seminal gland mass (VT:0010524) seminal vesicle wet weight (CMO:0001603) 8 22662330 67662330 Rat 737824 Hcar10 Hepatocarcinoma resistance QTL 10 2.9 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 8 40713066 82925667 Rat 1359033 Bp273 Blood pressure QTL 273 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 30848154 61290444 Rat 1331769 Rf39 Renal function QTL 39 3.871 urine output (VT:0003620) timed urine volume (CMO:0000260) 8 41866876 75097878 Rat 61358 Bp39 Blood pressure QTL 39 2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 35551938 80551938 Rat 1358906 Bp253 Blood pressure QTL 253 4 0.0004 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 40713066 93965294 Rat 1358907 Cm40 Cardiac mass QTL 40 1.89 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 27205715 99103503 Rat 1331744 Bp217 Blood pressure QTL 217 3.398 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 30848154 58482492 Rat 2316950 Scl66 Serum cholesterol level QTL 66 4.1 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 8 30848259 105647037 Rat 1358892 Kidm26 Kidney mass QTL 26 3.69 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 8 27205715 99103503 Rat 1359021 Bp271 Blood pressure QTL 271 1.8 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 26644912 46711092 Rat 631216 Stl9 Serum triglyceride level QTL 9 4.71 0.0001 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 8 41867010 70386132 Rat 61373 Mcs4 Mammary carcinoma susceptibility QTL 4 1.1 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 8 16290444 61290444 Rat 2313057 Bss76 Bone structure and strength QTL 76 3 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 8 30848154 82460899 Rat 12879878 Bw183 Body weight QTL 183 0.001 body mass (VT:0001259) body weight (CMO:0000012) 8 43296169 98968765 Rat 1549908 Neudeg1 Neurodegradation QTL 1 5.5 0 nervous system integrity trait (VT:0010566) logarithm of the ratio of the lesioned side motor neuron count to contralateral side motor neuron count (CMO:0001986) 8 30188867 94457446 Rat 12879879 Cm99 Cardiac mass QTL 99 0.001 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 43296169 98968765 Rat 2317030 Wbc5 White blood cell count QTL 5 3.21 0.005 leukocyte quantity (VT:0000217) white blood cell count (CMO:0000027) 8 8736635 53736635 Rat 1331804 Cm30 Cardiac mass QTL 30 3.77443 heart mass (VT:0007028) heart wet weight (CMO:0000069) 8 28242912 53961020 Rat 2313067 Bss77 Bone structure and strength QTL 77 3.1 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 8 30848154 82460899 Rat 2317032 Ginf2 Gastrointestinal inflammation QTL 2 3.21 0.005 liver integrity trait (VT:0010547) liver granuloma severity score (CMO:0002157) 8 4705810 49705810 Rat 2301416 Bp315 Blood pressure QTL 315 0.008 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 7670578 52670578 Rat 12879880 Cm100 Cardiac mass QTL 100 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 8 43296169 98968765 Rat 12879881 Cm101 Cardiac mass QTL 101 0.001 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 8 43296169 98968765 Rat 12879882 Am8 Aortic mass QTL 8 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 8 43296169 98968765 Rat 2317036 Livw3 Liver weight QTL 3 2.43 0.01 liver mass (VT:0003402) liver weight to body weight ratio (CMO:0000633) 8 4705810 49705810 Rat 12879883 Kidm65 Kidney mass QTL 65 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 8 43296169 98968765 Rat 12880023 Bw184 Body weight QTL 184 0.001 body mass (VT:0001259) body weight (CMO:0000012) 8 2097640 47097640 Rat 5684993 Bmd84 Bone mineral density QTL 84 4.1 tibia mineral mass (VT:1000283) bone mineral content (CMO:0001554) 8 42692684 50095447 Rat 12880028 Cm103 Cardiac mass QTL 103 0.02 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 8 2097640 47097640 Rat 2317051 Aia18 Adjuvant induced arthritis QTL 18 2.42 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 8 8736635 53736635 Rat 2317048 Ginf1 Gastrointestinal inflammation QTL 1 3.52 0.005 cecum mucosa thickness (VT:0010234) enterocolitis severity score (CMO:0002138) 8 4705810 49705810 Rat 12880025 Cm102 Cardiac mass QTL 102 0.044 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 8 2097640 47097640 Rat 1558646 Swd5 Spike wave discharge measurement QTL 5 3.45 0.00036 brain electrophysiology trait (VT:0010557) brain spike-and-wave discharge frequency (CMO:0001742) 8 14906751 59906751 Rat 2302278 Gluco36 Glucose level QTL 36 4.2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 8 29502665 50095447 Rat 12880044 Am9 Aortic mass QTL 9 0.007 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 8 2097640 47097640 Rat 631648 Stl5 Serum triglyceride level QTL 5 4 0.0003 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 8 27205715 54998217 Rat 1331838 Niddm61 Non-insulin dependent diabetes mellitus QTL 61 3.53 0.0004 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 8 36469535 99083736 Rat 631650 Stl6 Serum triglyceride level QTL 6 4 0.0019 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 8 10378157 112202585 Rat 1581557 Eae16 Experimental allergic encephalomyelitis QTL 16 3.8 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 8 8462195 110921472 Rat 631271 Lecl1 Lens clarity QTL 1 0.001 lens clarity trait (VT:0001304) age of onset/diagnosis of cataract (CMO:0001584) 8 18984168 84531599 Rat 2303564 Gluco43 Glucose level QTL 43 3 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 8 26130187 71130187 Rat 1598824 Memor4 Memory QTL 4 2.5 exploratory behavior trait (VT:0010471) total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443) 8 9712220 53356647 Rat 2313046 Bss78 Bone structure and strength QTL 78 3.5 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 8 30848154 82460899 Rat 1354595 Despr4 Despair related QTL 4 2.16 0.0036 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 8 7688955 52688955 Rat 2303572 Insul13 Insulin level QTL 13 2 blood insulin amount (VT:0001560) blood insulin level (CMO:0000349) 8 26130187 71130187 Rat
D8Got62
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 44,531,430 - 44,531,654 (+) MAPPER mRatBN7.2 Rnor_6.0 8 48,524,940 - 48,525,163 NCBI Rnor6.0 Rnor_5.0 8 47,143,390 - 47,143,613 UniSTS Rnor5.0 RGSC_v3.4 8 47,171,833 - 47,172,057 RGD RGSC3.4 RGSC_v3.4 8 47,171,834 - 47,172,057 UniSTS RGSC3.4 RGSC_v3.1 8 47,180,600 - 47,180,823 RGD Celera 8 44,118,223 - 44,118,440 UniSTS RH 3.4 Map 8 430.8 UniSTS RH 3.4 Map 8 430.8 RGD RH 2.0 Map 8 335.4 RGD Cytogenetic Map 8 q22 UniSTS
D8Got63
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 44,509,806 - 44,509,994 (+) MAPPER mRatBN7.2 Rnor_6.0 8 48,503,237 - 48,503,424 NCBI Rnor6.0 Rnor_5.0 8 47,121,863 - 47,122,050 UniSTS Rnor5.0 RGSC_v3.4 8 47,150,172 - 47,150,360 RGD RGSC3.4 RGSC_v3.4 8 47,150,173 - 47,150,360 UniSTS RGSC3.4 RGSC_v3.1 8 47,158,939 - 47,159,126 RGD Celera 8 44,096,649 - 44,096,836 UniSTS RH 3.4 Map 8 440.2 RGD RH 3.4 Map 8 440.2 UniSTS Cytogenetic Map 8 q22 UniSTS
RH142755
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 44,494,096 - 44,494,238 (+) MAPPER mRatBN7.2 Rnor_6.0 8 48,487,526 - 48,487,667 NCBI Rnor6.0 Rnor_5.0 8 47,106,152 - 47,106,293 UniSTS Rnor5.0 RGSC_v3.4 8 47,134,458 - 47,134,599 UniSTS RGSC3.4 Celera 8 44,080,939 - 44,081,080 UniSTS RH 3.4 Map 8 428.9 UniSTS Cytogenetic Map 8 q22 UniSTS
RH139032
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 44,495,380 - 44,495,535 (+) MAPPER mRatBN7.2 Rnor_6.0 8 48,488,810 - 48,488,964 NCBI Rnor6.0 Rnor_5.0 8 47,107,436 - 47,107,590 UniSTS Rnor5.0 RGSC_v3.4 8 47,135,742 - 47,135,896 UniSTS RGSC3.4 Celera 8 44,082,223 - 44,082,377 UniSTS RH 3.4 Map 8 426.0 UniSTS Cytogenetic Map 8 q22 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000067902 ⟹ ENSRNOP00000063226
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 44,489,410 - 44,571,176 (-) Ensembl Rnor_6.0 Ensembl 8 48,489,036 - 48,564,722 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000101607 ⟹ ENSRNOP00000079790
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 44,493,655 - 44,571,176 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000107395 ⟹ ENSRNOP00000092398
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 44,493,647 - 44,571,176 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000113140 ⟹ ENSRNOP00000095952
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 44,493,655 - 44,571,176 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000113781 ⟹ ENSRNOP00000082958
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 44,493,655 - 44,571,176 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000117376 ⟹ ENSRNOP00000083557
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 44,493,655 - 44,571,176 (-) Ensembl
RefSeq Acc Id:
NM_001419955 ⟹ NP_001406884
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 53,384,656 - 53,468,067 (-) NCBI mRatBN7.2 8 44,487,824 - 44,571,244 (-) NCBI
RefSeq Acc Id:
XM_006242965 ⟹ XP_006243027
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 53,384,658 - 53,467,959 (-) NCBI mRatBN7.2 8 44,487,824 - 44,571,620 (-) NCBI Rnor_6.0 8 48,481,256 - 48,564,775 (-) NCBI Rnor_5.0 8 47,105,710 - 47,183,347 (-) NCBI
Sequence:
CGCGCCCGCGCAGGGGCGCGCCTCAGGGCGGGCGCCTCCCTCTCACTCCCTCGGCTGTGAGCGCCGGCGGTGGCTGCCGGAGAGGCCCCTCCTTCTCGCCCCGCTCCATTCCCTCGCTCGCGGCCGAG
hide sequence
RefSeq Acc Id:
XM_039082332 ⟹ XP_038938260
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 53,384,658 - 53,467,595 (-) NCBI mRatBN7.2 8 44,487,824 - 44,570,767 (-) NCBI
RefSeq Acc Id:
XP_006243027 ⟸ XM_006242965
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6G861 (UniProtKB/TrEMBL), A0A0U1ZFN5 (UniProtKB/TrEMBL)
- Sequence:
MAGNVKKSSGAGGSGSGGSGAGGLIGLMKDAFQPHHHHHHHLSPHPPCTVDKKMVEKCWKLMDKVVRLCQNPKLALKNSPPYILDLLPDTYQHLRTVLSRYEGKMETLGENEYFRVFMENLMKKTKQT
hide sequence
Ensembl Acc Id:
ENSRNOP00000063226 ⟸ ENSRNOT00000067902
RefSeq Acc Id:
XP_038938260 ⟸ XM_039082332
- Peptide Label:
isoform X2
- UniProtKB:
A6J3W2 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000082958 ⟸ ENSRNOT00000113781
Ensembl Acc Id:
ENSRNOP00000092398 ⟸ ENSRNOT00000107395
Ensembl Acc Id:
ENSRNOP00000083557 ⟸ ENSRNOT00000117376
Ensembl Acc Id:
ENSRNOP00000079790 ⟸ ENSRNOT00000101607
Ensembl Acc Id:
ENSRNOP00000095952 ⟸ ENSRNOT00000113140
RefSeq Acc Id:
NP_001406884 ⟸ NM_001419955
- UniProtKB:
A0A8I6G3R2 (UniProtKB/TrEMBL), A0A0U1ZFN5 (UniProtKB/TrEMBL)
RGD ID: 13695886 Promoter ID: EPDNEW_R6409 Type: initiation region Name: Cbl_1 Description: Cbl proto-oncogene SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 8 48,564,731 - 48,564,791 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-05-05
Cbl
Cbl proto-oncogene
Cbl
Casitas B-lineage lymphoma
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2016-05-04
Cbl
Casitas B-lineage lymphoma
Cbl
Cbl proto-oncogene, E3 ubiquitin protein ligase
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2012-07-13
Cbl
Cbl proto-oncogene, E3 ubiquitin protein ligase
Cbl
Cas-Br-M (murine) ecotropic retroviral transforming sequence
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-09-18
Cbl
Cas-Br-M (murine) ecotropic retroviral transforming sequence
Cbl
Casitas B-lineage lymphoma
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-02-29
Cbl
Casitas B-lineage lymphoma
RGD1561386_predicted
similar to CBL E3 ubiquitin protein ligase (Signal transduction protein CBL) (predicted)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-03-10
RGD1561386_predicted
similar to CBL E3 ubiquitin protein ligase (Signal transduction protein CBL) (predicted)
similar to CBL E3 ubiquitin protein ligase (Signal transduction protein CBL) (Proto-oncogene c-CBL) (Casitas B-lineage lymphoma proto-oncogene) (predicted)
Name updated
1299863 APPROVED
2006-03-07
RGD1561386_predicted
similar to CBL E3 ubiquitin protein ligase (Signal transduction protein CBL) (Proto-oncogene c-CBL) (Casitas B-lineage lymphoma proto-oncogene) (predicted)
LOC500985
similar to CBL E3 ubiquitin protein ligase (Signal transduction protein CBL) (Proto-oncogene c-CBL) (Casitas B-lineage lymphoma proto-oncogene)
Symbol and Name status set to approved
1299863 APPROVED
2006-02-09
LOC500985
similar to CBL E3 ubiquitin protein ligase (Signal transduction protein CBL) (Proto-oncogene c-CBL) (Casitas B-lineage lymphoma proto-oncogene)
Symbol and Name status set to provisional
70820 PROVISIONAL
