Symbol:
Sh3kbp1
Name:
SH3 domain-containing kinase-binding protein 1
RGD ID:
620904
Description:
Enables ubiquitin protein ligase binding activity. Predicted to be involved in several processes, including actin filament organization; positive regulation of B cell activation; and regulation of cell shape. Is active in GABA-ergic synapse; glutamatergic synapse; and postsynaptic density. Human ortholog(s) of this gene implicated in immunodeficiency 61. Orthologous to human SH3KBP1 (SH3 domain containing kinase binding protein 1); PARTICIPATES IN endocytosis pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
CIN85; regulator of ubiquitous kinase; ruk; Seta; SH3 domain-containing adapter protein; SH3-containing, expressed in tumorigenic astrocytes; SH3-domain kinase binding protein 1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 X 38,686,530 - 39,031,658 (-) NCBI GRCr8 mRatBN7.2 X 34,877,862 - 35,223,013 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl X 34,877,866 - 35,222,747 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx X 36,015,061 - 36,359,892 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 X 39,478,687 - 39,823,541 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 X 34,644,756 - 34,989,581 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 X 37,790,004 - 38,196,365 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl X 37,790,586 - 38,196,204 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 X 38,094,434 - 38,505,289 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 X 56,075,533 - 56,422,980 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 X 56,129,005 - 56,476,449 (-) NCBI Celera X 35,544,608 - 35,884,206 (-) NCBI Celera Cytogenetic Map X q14 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Sh3kbp1 Rat (+)-catechin multiple interactions ISO SH3KBP1 (Homo sapiens) 6480464 [Catechin co-treated with Grape Seed Proanthocyanidins] results in increased expression of SH3KBP1 mRNA CTD PMID:24763279 Sh3kbp1 Rat (S)-nicotine increases expression ISO SH3KBP1 (Homo sapiens) 6480464 Nicotine results in increased expression of SH3KBP1 mRNA CTD PMID:23825647 Sh3kbp1 Rat 1,2-dimethylhydrazine increases expression ISO Sh3kbp1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of SH3KBP1 mRNA CTD PMID:22206623 Sh3kbp1 Rat 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine affects expression ISO Sh3kbp1 (Mus musculus) 6480464 1-Methyl-4-phenyl-1 more ... CTD PMID:18535749 Sh3kbp1 Rat 1-nitropyrene increases expression ISO SH3KBP1 (Homo sapiens) 6480464 1-nitropyrene results in increased expression of SH3KBP1 mRNA CTD PMID:19041380 Sh3kbp1 Rat 17beta-estradiol multiple interactions ISO SH3KBP1 (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in increased expression of SH3KBP1 mRNA CTD PMID:30165855 Sh3kbp1 Rat 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO Sh3kbp1 (Mus musculus) 6480464 2 more ... CTD PMID:31388691 Sh3kbp1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of SH3KBP1 mRNA CTD PMID:20959002 Sh3kbp1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of SH3KBP1 mRNA CTD PMID:34747641 Sh3kbp1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Sh3kbp1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of SH3KBP1 mRNA CTD PMID:21570461 and PMID:26377647 Sh3kbp1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO SH3KBP1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of SH3KBP1 mRNA CTD PMID:23152189 Sh3kbp1 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of SH3KBP1 mRNA CTD PMID:21346803 Sh3kbp1 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO SH3KBP1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of SH3KBP1 mRNA more ... CTD PMID:28628672 Sh3kbp1 Rat 4,4'-sulfonyldiphenol multiple interactions ISO SH3KBP1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of SH3KBP1 mRNA CTD PMID:28628672 Sh3kbp1 Rat 4-hydroxyphenyl retinamide decreases expression ISO Sh3kbp1 (Mus musculus) 6480464 Fenretinide results in decreased expression of SH3KBP1 mRNA CTD PMID:28973697 Sh3kbp1 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of SH3KBP1 mRNA CTD PMID:24780913 Sh3kbp1 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of SH3KBP1 mRNA CTD PMID:31881176 Sh3kbp1 Rat acrylamide increases expression ISO SH3KBP1 (Homo sapiens) 6480464 Acrylamide results in increased expression of SH3KBP1 mRNA CTD PMID:32763439 Sh3kbp1 Rat aflatoxin B1 decreases expression ISO Sh3kbp1 (Mus musculus) 6480464 Aflatoxin B1 results in decreased expression of SH3KBP1 mRNA CTD PMID:19770486 Sh3kbp1 Rat Aflatoxin B2 alpha decreases methylation ISO SH3KBP1 (Homo sapiens) 6480464 aflatoxin B2 results in decreased methylation of SH3KBP1 intron CTD PMID:30157460 Sh3kbp1 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of SH3KBP1 mRNA CTD PMID:38685447 Sh3kbp1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of SH3KBP1 mRNA CTD PMID:16483693 Sh3kbp1 Rat aristolochic acid A decreases expression ISO SH3KBP1 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of SH3KBP1 mRNA CTD PMID:33212167 Sh3kbp1 Rat arsane affects methylation ISO SH3KBP1 (Homo sapiens) 6480464 Arsenic affects the methylation of SH3KBP1 gene CTD PMID:25304211 Sh3kbp1 Rat arsenic atom affects methylation ISO SH3KBP1 (Homo sapiens) 6480464 Arsenic affects the methylation of SH3KBP1 gene CTD PMID:25304211 Sh3kbp1 Rat arsenite(3-) multiple interactions ISO SH3KBP1 (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to SH3KBP1 mRNA] CTD PMID:32406909 Sh3kbp1 Rat atrazine affects methylation EXP 6480464 Atrazine affects the methylation of SH3KBP1 gene CTD PMID:35440735 Sh3kbp1 Rat Azoxymethane multiple interactions ISO Sh3kbp1 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of SH3KBP1 mRNA CTD PMID:29950665 Sh3kbp1 Rat benzo[a]pyrene decreases expression ISO Sh3kbp1 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of SH3KBP1 mRNA CTD PMID:19770486 more ... Sh3kbp1 Rat benzo[a]pyrene affects methylation ISO SH3KBP1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of SH3KBP1 exon more ... CTD PMID:27901495 and PMID:30157460 Sh3kbp1 Rat benzo[a]pyrene increases methylation ISO SH3KBP1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of SH3KBP1 3' UTR CTD PMID:27901495 Sh3kbp1 Rat benzo[a]pyrene decreases expression ISO SH3KBP1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of SH3KBP1 mRNA CTD PMID:20064835 more ... Sh3kbp1 Rat benzo[a]pyrene diol epoxide I decreases expression ISO SH3KBP1 (Homo sapiens) 6480464 7 more ... CTD PMID:20018196 and PMID:26238291 Sh3kbp1 Rat bis(2-ethylhexyl) phthalate increases expression ISO SH3KBP1 (Homo sapiens) 6480464 Diethylhexyl Phthalate results in increased expression of SH3KBP1 mRNA CTD PMID:31163220 Sh3kbp1 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of SH3KBP1 mRNA CTD PMID:25181051 Sh3kbp1 Rat bisphenol A decreases expression ISO SH3KBP1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of SH3KBP1 protein CTD PMID:34186270 Sh3kbp1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of SH3KBP1 mRNA CTD PMID:31771501 Sh3kbp1 Rat bisphenol A decreases methylation ISO SH3KBP1 (Homo sapiens) 6480464 bisphenol A results in decreased methylation of SH3KBP1 gene CTD PMID:31601247 Sh3kbp1 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of SH3KBP1 gene CTD PMID:28505145 Sh3kbp1 Rat bisphenol A increases methylation ISO Sh3kbp1 (Mus musculus) 6480464 bisphenol A results in increased methylation of SH3KBP1 promoter CTD PMID:27312807 Sh3kbp1 Rat bisphenol A multiple interactions ISO SH3KBP1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of SH3KBP1 mRNA CTD PMID:28628672 Sh3kbp1 Rat bisphenol AF increases expression ISO SH3KBP1 (Homo sapiens) 6480464 bisphenol AF results in increased expression of SH3KBP1 protein CTD PMID:34186270 Sh3kbp1 Rat Bisphenol B increases expression ISO SH3KBP1 (Homo sapiens) 6480464 bisphenol B results in increased expression of SH3KBP1 protein CTD PMID:34186270 Sh3kbp1 Rat bisphenol F multiple interactions ISO SH3KBP1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of SH3KBP1 mRNA CTD PMID:28628672 Sh3kbp1 Rat buta-1,3-diene decreases expression ISO Sh3kbp1 (Mus musculus) 6480464 1 and 3-butadiene results in decreased expression of SH3KBP1 mRNA CTD PMID:29038090 Sh3kbp1 Rat butan-1-ol multiple interactions ISO SH3KBP1 (Homo sapiens) 6480464 [[Gasoline co-treated with 1-Butanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in increased expression of SH3KBP1 mRNA CTD PMID:29432896 Sh3kbp1 Rat butanal increases expression ISO SH3KBP1 (Homo sapiens) 6480464 butyraldehyde results in increased expression of SH3KBP1 mRNA CTD PMID:26079696 Sh3kbp1 Rat cadmium atom multiple interactions ISO SH3KBP1 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of SH3KBP1 mRNA CTD PMID:35301059 Sh3kbp1 Rat cadmium dichloride increases expression ISO SH3KBP1 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of SH3KBP1 mRNA CTD PMID:38568856 Sh3kbp1 Rat cadmium dichloride multiple interactions ISO SH3KBP1 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of SH3KBP1 mRNA CTD PMID:35301059 Sh3kbp1 Rat caffeine affects phosphorylation ISO SH3KBP1 (Homo sapiens) 6480464 Caffeine affects the phosphorylation of SH3KBP1 protein CTD PMID:35688186 Sh3kbp1 Rat calcitriol increases expression ISO SH3KBP1 (Homo sapiens) 6480464 Calcitriol results in increased expression of SH3KBP1 mRNA CTD PMID:16002434 Sh3kbp1 Rat capsaicin increases expression EXP 6480464 Capsaicin results in increased expression of SH3KBP1 mRNA CTD PMID:16278290 Sh3kbp1 Rat CGP 52608 multiple interactions ISO SH3KBP1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to SH3KBP1 gene] CTD PMID:28238834 Sh3kbp1 Rat chloroprene decreases expression ISO Sh3kbp1 (Mus musculus) 6480464 Chloroprene results in decreased expression of SH3KBP1 mRNA CTD PMID:23125180 Sh3kbp1 Rat chlorpyrifos decreases expression EXP 6480464 Chlorpyrifos results in decreased expression of SH3KBP1 mRNA CTD PMID:18668222 Sh3kbp1 Rat choline multiple interactions ISO Sh3kbp1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of SH3KBP1 mRNA CTD PMID:20938992 Sh3kbp1 Rat cisplatin increases expression ISO Sh3kbp1 (Mus musculus) 6480464 Cisplatin results in increased expression of SH3KBP1 mRNA CTD PMID:21151649 Sh3kbp1 Rat cisplatin decreases expression EXP 6480464 Cisplatin results in decreased expression of SH3KBP1 mRNA CTD PMID:22023808 Sh3kbp1 Rat clozapine increases expression ISO SH3KBP1 (Homo sapiens) 6480464 Clozapine results in increased expression of SH3KBP1 protein CTD PMID:34122009 Sh3kbp1 Rat copper(II) chloride increases expression ISO SH3KBP1 (Homo sapiens) 6480464 cupric chloride results in increased expression of SH3KBP1 mRNA CTD PMID:38568856 Sh3kbp1 Rat copper(II) sulfate increases expression ISO SH3KBP1 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of SH3KBP1 mRNA CTD PMID:19549813 Sh3kbp1 Rat coumarin increases phosphorylation ISO SH3KBP1 (Homo sapiens) 6480464 coumarin results in increased phosphorylation of SH3KBP1 protein CTD PMID:35688186 Sh3kbp1 Rat coumestrol multiple interactions ISO SH3KBP1 (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in decreased expression of SH3KBP1 mRNA CTD PMID:19167446 Sh3kbp1 Rat crocidolite asbestos decreases expression ISO Sh3kbp1 (Mus musculus) 6480464 Asbestos and Crocidolite results in decreased expression of SH3KBP1 mRNA CTD PMID:29279043 Sh3kbp1 Rat Cuprizon multiple interactions ISO SH3KBP1 (Homo sapiens) 6480464 [Cuprizone co-treated with Haloperidol] results in increased expression of SH3KBP1 protein CTD PMID:34122009 Sh3kbp1 Rat cyclosporin A increases expression ISO SH3KBP1 (Homo sapiens) 6480464 Cyclosporine results in increased expression of SH3KBP1 mRNA CTD PMID:20106945 Sh3kbp1 Rat DDE decreases expression ISO SH3KBP1 (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of SH3KBP1 mRNA CTD PMID:38568856 Sh3kbp1 Rat deoxynivalenol increases phosphorylation ISO Sh3kbp1 (Mus musculus) 6480464 deoxynivalenol results in increased phosphorylation of SH3KBP1 protein CTD PMID:23811945 Sh3kbp1 Rat dexamethasone multiple interactions ISO SH3KBP1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of SH3KBP1 mRNA more ... CTD PMID:28628672 Sh3kbp1 Rat dextran sulfate multiple interactions ISO Sh3kbp1 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of SH3KBP1 mRNA CTD PMID:29950665 Sh3kbp1 Rat diazinon affects expression EXP 6480464 Diazinon affects the expression of SH3KBP1 mRNA CTD PMID:22546817 Sh3kbp1 Rat Dibutyl phosphate affects expression ISO SH3KBP1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of SH3KBP1 mRNA CTD PMID:37042841 Sh3kbp1 Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of SH3KBP1 mRNA CTD PMID:21266533 Sh3kbp1 Rat disodium selenite increases expression ISO SH3KBP1 (Homo sapiens) 6480464 Sodium Selenite results in increased expression of SH3KBP1 mRNA CTD PMID:18175754 and PMID:24383545 Sh3kbp1 Rat dorsomorphin multiple interactions ISO SH3KBP1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Sh3kbp1 Rat doxorubicin decreases expression ISO Sh3kbp1 (Mus musculus) 6480464 Doxorubicin results in decreased expression of SH3KBP1 mRNA CTD PMID:25896364 Sh3kbp1 Rat Enterolactone multiple interactions ISO SH3KBP1 (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in decreased expression of SH3KBP1 mRNA CTD PMID:19167446 Sh3kbp1 Rat entinostat increases expression ISO SH3KBP1 (Homo sapiens) 6480464 entinostat results in increased expression of SH3KBP1 mRNA CTD PMID:26272509 Sh3kbp1 Rat entinostat multiple interactions ISO SH3KBP1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SH3KBP1 mRNA CTD PMID:27188386 Sh3kbp1 Rat folic acid multiple interactions ISO Sh3kbp1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of SH3KBP1 mRNA CTD PMID:20938992 Sh3kbp1 Rat folic acid decreases expression ISO Sh3kbp1 (Mus musculus) 6480464 Folic Acid results in decreased expression of SH3KBP1 mRNA CTD PMID:25629700 Sh3kbp1 Rat formaldehyde increases expression ISO SH3KBP1 (Homo sapiens) 6480464 Formaldehyde results in increased expression of SH3KBP1 mRNA CTD PMID:27664576 Sh3kbp1 Rat FR900359 affects phosphorylation ISO SH3KBP1 (Homo sapiens) 6480464 FR900359 affects the phosphorylation of SH3KBP1 protein CTD PMID:37730182 Sh3kbp1 Rat furan increases expression EXP 6480464 furan results in increased expression of SH3KBP1 mRNA CTD PMID:27387713 Sh3kbp1 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of SH3KBP1 mRNA CTD PMID:22061828 Sh3kbp1 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of SH3KBP1 mRNA CTD PMID:33387578 Sh3kbp1 Rat glycidyl methacrylate increases expression ISO SH3KBP1 (Homo sapiens) 6480464 glycidyl methacrylate results in increased expression of SH3KBP1 protein CTD PMID:36641056 Sh3kbp1 Rat gold atom increases expression ISO SH3KBP1 (Homo sapiens) 6480464 Gold results in increased expression of SH3KBP1 mRNA CTD PMID:29705079 Sh3kbp1 Rat gold(0) increases expression ISO SH3KBP1 (Homo sapiens) 6480464 Gold results in increased expression of SH3KBP1 mRNA CTD PMID:29705079 Sh3kbp1 Rat haloperidol multiple interactions ISO SH3KBP1 (Homo sapiens) 6480464 [Cuprizone co-treated with Haloperidol] results in increased expression of SH3KBP1 protein CTD PMID:34122009 Sh3kbp1 Rat hydrogen peroxide affects expression ISO SH3KBP1 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of SH3KBP1 mRNA CTD PMID:21179406 Sh3kbp1 Rat hydroquinone increases expression ISO SH3KBP1 (Homo sapiens) 6480464 hydroquinone results in increased expression of SH3KBP1 mRNA CTD PMID:31256213 Sh3kbp1 Rat indometacin multiple interactions ISO SH3KBP1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of SH3KBP1 mRNA more ... CTD PMID:28628672 Sh3kbp1 Rat isoflurane decreases methylation ISO Sh3kbp1 (Mus musculus) 6480464 Isoflurane results in decreased methylation of SH3KBP1 mRNA CTD PMID:35249202 Sh3kbp1 Rat isoprenaline decreases expression ISO Sh3kbp1 (Mus musculus) 6480464 Isoproterenol results in decreased expression of SH3KBP1 mRNA CTD PMID:20003209 Sh3kbp1 Rat L-methionine multiple interactions ISO Sh3kbp1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of SH3KBP1 mRNA CTD PMID:20938992 Sh3kbp1 Rat lead(0) decreases expression ISO SH3KBP1 (Homo sapiens) 6480464 Lead results in decreased expression of SH3KBP1 mRNA CTD PMID:19921347 Sh3kbp1 Rat lead(0) affects splicing ISO SH3KBP1 (Homo sapiens) 6480464 Lead affects the splicing of SH3KBP1 mRNA CTD PMID:28903495 Sh3kbp1 Rat methyl methanesulfonate decreases expression ISO SH3KBP1 (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of SH3KBP1 mRNA CTD PMID:23649840 Sh3kbp1 Rat N,N-diethyl-m-toluamide multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in increased methylation of SH3KBP1 gene CTD PMID:33148267 Sh3kbp1 Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal multiple interactions ISO Sh3kbp1 (Mus musculus) 6480464 MYBPC3 protein affects the reaction [benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in decreased expression of SH3KBP1 mRNA] CTD PMID:25566086 Sh3kbp1 Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal decreases expression ISO Sh3kbp1 (Mus musculus) 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in decreased expression of SH3KBP1 mRNA CTD PMID:25566086 Sh3kbp1 Rat N-methyl-4-phenylpyridinium affects expression ISO SH3KBP1 (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium affects the expression of SH3KBP1 mRNA CTD PMID:24810058 Sh3kbp1 Rat N-methyl-4-phenylpyridinium increases expression ISO SH3KBP1 (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium results in increased expression of SH3KBP1 mRNA and 1-Methyl-4-phenylpyridinium results in increased expression of SH3KBP1 protein CTD PMID:18535749 Sh3kbp1 Rat nickel dichloride affects expression EXP 6480464 nickel chloride affects the expression of SH3KBP1 mRNA CTD PMID:22546817 Sh3kbp1 Rat nicotine increases expression ISO SH3KBP1 (Homo sapiens) 6480464 Nicotine results in increased expression of SH3KBP1 mRNA CTD PMID:23825647 Sh3kbp1 Rat oxidopamine increases expression ISO SH3KBP1 (Homo sapiens) 6480464 Oxidopamine results in increased expression of SH3KBP1 mRNA CTD PMID:18535749 Sh3kbp1 Rat panobinostat multiple interactions ISO SH3KBP1 (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SH3KBP1 mRNA CTD PMID:27188386 Sh3kbp1 Rat panobinostat increases expression ISO SH3KBP1 (Homo sapiens) 6480464 panobinostat results in increased expression of SH3KBP1 mRNA CTD PMID:26272509 Sh3kbp1 Rat paracetamol increases expression ISO SH3KBP1 (Homo sapiens) 6480464 Acetaminophen results in increased expression of SH3KBP1 mRNA CTD PMID:29067470 Sh3kbp1 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of SH3KBP1 mRNA CTD PMID:33387578 Sh3kbp1 Rat permethrin multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in increased methylation of SH3KBP1 gene CTD PMID:33148267 Sh3kbp1 Rat PhIP increases expression EXP 6480464 2-amino-1-methyl-6-phenylimidazo(4 and 5-b)pyridine results in increased expression of SH3KBP1 mRNA CTD PMID:15059925 Sh3kbp1 Rat pirinixic acid decreases expression EXP 6480464 pirinixic acid results in decreased expression of SH3KBP1 mRNA CTD PMID:19162173 Sh3kbp1 Rat pregnenolone 16alpha-carbonitrile increases expression EXP 6480464 Pregnenolone Carbonitrile results in increased expression of SH3KBP1 mRNA CTD PMID:19162173 Sh3kbp1 Rat progesterone increases expression EXP 6480464 Progesterone results in increased expression of SH3KBP1 mRNA CTD PMID:20726854 Sh3kbp1 Rat quercetin increases phosphorylation ISO SH3KBP1 (Homo sapiens) 6480464 Quercetin results in increased phosphorylation of SH3KBP1 protein CTD PMID:35688186 Sh3kbp1 Rat SB 431542 multiple interactions ISO SH3KBP1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Sh3kbp1 Rat silver atom decreases expression ISO Sh3kbp1 (Mus musculus) 6480464 Silver results in decreased expression of SH3KBP1 mRNA CTD PMID:27131904 Sh3kbp1 Rat silver(0) decreases expression ISO Sh3kbp1 (Mus musculus) 6480464 Silver results in decreased expression of SH3KBP1 mRNA CTD PMID:27131904 Sh3kbp1 Rat sodium arsenite increases expression ISO SH3KBP1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of SH3KBP1 mRNA CTD PMID:38568856 Sh3kbp1 Rat sodium dichromate decreases expression ISO Sh3kbp1 (Mus musculus) 6480464 sodium bichromate results in decreased expression of SH3KBP1 mRNA CTD PMID:22561333 Sh3kbp1 Rat sodium dichromate increases expression EXP 6480464 sodium bichromate results in increased expression of SH3KBP1 mRNA CTD PMID:22561333 Sh3kbp1 Rat sodium fluoride decreases expression ISO Sh3kbp1 (Mus musculus) 6480464 Sodium Fluoride results in decreased expression of SH3KBP1 protein CTD PMID:28918527 Sh3kbp1 Rat sunitinib increases expression ISO SH3KBP1 (Homo sapiens) 6480464 Sunitinib results in increased expression of SH3KBP1 mRNA CTD PMID:31533062 Sh3kbp1 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of SH3KBP1 mRNA CTD PMID:31150632 Sh3kbp1 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of SH3KBP1 mRNA CTD PMID:34492290 Sh3kbp1 Rat thiram increases expression ISO SH3KBP1 (Homo sapiens) 6480464 Thiram results in increased expression of SH3KBP1 mRNA CTD PMID:38568856 Sh3kbp1 Rat titanium dioxide multiple interactions ISO Sh3kbp1 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of SH3KBP1 mRNA CTD PMID:29950665 Sh3kbp1 Rat titanium dioxide decreases methylation ISO Sh3kbp1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of SH3KBP1 gene and titanium dioxide results in decreased methylation of SH3KBP1 promoter CTD PMID:35295148 Sh3kbp1 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of SH3KBP1 mRNA CTD PMID:33387578 Sh3kbp1 Rat trichostatin A increases expression ISO SH3KBP1 (Homo sapiens) 6480464 trichostatin A results in increased expression of SH3KBP1 mRNA CTD PMID:24935251 and PMID:26272509 Sh3kbp1 Rat trichostatin A multiple interactions ISO SH3KBP1 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SH3KBP1 mRNA CTD PMID:27188386 Sh3kbp1 Rat triclosan decreases expression ISO SH3KBP1 (Homo sapiens) 6480464 Triclosan results in decreased expression of SH3KBP1 mRNA CTD PMID:30510588 Sh3kbp1 Rat triphenyl phosphate affects expression ISO SH3KBP1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of SH3KBP1 mRNA CTD PMID:37042841 Sh3kbp1 Rat tungsten decreases expression ISO Sh3kbp1 (Mus musculus) 6480464 Tungsten results in decreased expression of SH3KBP1 mRNA CTD PMID:30912803 Sh3kbp1 Rat tunicamycin increases expression ISO SH3KBP1 (Homo sapiens) 6480464 Tunicamycin results in increased expression of SH3KBP1 mRNA CTD PMID:29453283 Sh3kbp1 Rat valproic acid affects expression ISO SH3KBP1 (Homo sapiens) 6480464 Valproic Acid affects the expression of SH3KBP1 mRNA CTD PMID:25979313 Sh3kbp1 Rat valproic acid multiple interactions ISO SH3KBP1 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SH3KBP1 mRNA CTD PMID:27188386 Sh3kbp1 Rat valproic acid increases expression ISO SH3KBP1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of SH3KBP1 mRNA CTD PMID:19101580 more ...
Imported Annotations - KEGG (archival)
(+)-catechin (ISO) (S)-nicotine (ISO) 1,2-dimethylhydrazine (ISO) 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (ISO) 1-nitropyrene (ISO) 17beta-estradiol (ISO) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) acrylamide (ISO) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) amitrole (EXP) ammonium chloride (EXP) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) atrazine (EXP) Azoxymethane (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) buta-1,3-diene (ISO) butan-1-ol (ISO) butanal (ISO) cadmium atom (ISO) cadmium dichloride (ISO) caffeine (ISO) calcitriol (ISO) capsaicin (EXP) CGP 52608 (ISO) chloroprene (ISO) chlorpyrifos (EXP) choline (ISO) cisplatin (EXP,ISO) clozapine (ISO) copper(II) chloride (ISO) copper(II) sulfate (ISO) coumarin (ISO) coumestrol (ISO) crocidolite asbestos (ISO) Cuprizon (ISO) cyclosporin A (ISO) DDE (ISO) deoxynivalenol (ISO) dexamethasone (ISO) dextran sulfate (ISO) diazinon (EXP) Dibutyl phosphate (ISO) dibutyl phthalate (EXP) disodium selenite (ISO) dorsomorphin (ISO) doxorubicin (ISO) Enterolactone (ISO) entinostat (ISO) folic acid (ISO) formaldehyde (ISO) FR900359 (ISO) furan (EXP) gentamycin (EXP) glycidyl methacrylate (ISO) gold atom (ISO) gold(0) (ISO) haloperidol (ISO) hydrogen peroxide (ISO) hydroquinone (ISO) indometacin (ISO) isoflurane (ISO) isoprenaline (ISO) L-methionine (ISO) lead(0) (ISO) methyl methanesulfonate (ISO) N,N-diethyl-m-toluamide (EXP) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO) N-methyl-4-phenylpyridinium (ISO) nickel dichloride (EXP) nicotine (ISO) oxidopamine (ISO) panobinostat (ISO) paracetamol (EXP,ISO) permethrin (EXP) PhIP (EXP) pirinixic acid (EXP) pregnenolone 16alpha-carbonitrile (EXP) progesterone (EXP) quercetin (ISO) SB 431542 (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenite (ISO) sodium dichromate (EXP,ISO) sodium fluoride (ISO) sunitinib (ISO) tetrachloromethane (EXP) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) trichloroethene (EXP) trichostatin A (ISO) triclosan (ISO) triphenyl phosphate (ISO) tungsten (ISO) tunicamycin (ISO) valproic acid (ISO)
1.
SETA: a novel SH3 domain-containing adapter molecule associated with malignancy in astrocytes.
Bogler O, etal., Neuro-oncol 2000 Jan;2(1):6-15.
2.
SETA is a multifunctional adapter protein with three SH3 domains that binds Grb2, Cbl, and the novel SB1 proteins.
Borinstein SC, etal., Cell Signal 2000 Dec;12(11-12):769-79.
3.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
5.
Negative regulation of PI 3-kinase by Ruk, a novel adaptor protein.
Gout I, etal., EMBO J 2000 Aug 1;19(15):4015-25.
6.
CIN85 is localized at synapses and forms a complex with S-SCAM via dendrin.
Kawata A, etal., J Biochem. 2006 May;139(5):931-9.
7.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
8.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
9.
Intersectin 1 forms a complex with adaptor protein Ruk/CIN85 in vivo independently of epidermal growth factor stimulation.
Nikolaienko O, etal., Cell Signal. 2009 May;21(5):753-9. doi: 10.1016/j.cellsig.2009.01.013. Epub 2009 Jan 8.
10.
The adaptor molecule CIN85 regulates Syk tyrosine kinase level by activating the ubiquitin-proteasome degradation pathway.
Peruzzi G, etal., J Immunol. 2007 Aug 15;179(4):2089-96.
11.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
12.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
13.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
14.
Identification and characterization of a novel Rho GTPase activating protein implicated in receptor-mediated endocytosis.
Sakakibara T, etal., FEBS Lett 2004 May 21;566(1-3):294-300.
15.
CIN85 regulates dopamine receptor endocytosis and governs behaviour in mice.
Shimokawa N, etal., EMBO J. 2010 Jul 21;29(14):2421-32. doi: 10.1038/emboj.2010.120. Epub 2010 Jun 15.
16.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
Sh3kbp1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 X 38,686,530 - 39,031,658 (-) NCBI GRCr8 mRatBN7.2 X 34,877,862 - 35,223,013 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl X 34,877,866 - 35,222,747 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx X 36,015,061 - 36,359,892 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 X 39,478,687 - 39,823,541 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 X 34,644,756 - 34,989,581 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 X 37,790,004 - 38,196,365 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl X 37,790,586 - 38,196,204 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 X 38,094,434 - 38,505,289 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 X 56,075,533 - 56,422,980 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 X 56,129,005 - 56,476,449 (-) NCBI Celera X 35,544,608 - 35,884,206 (-) NCBI Celera Cytogenetic Map X q14 NCBI
SH3KBP1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 X 19,533,977 - 19,887,600 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl X 19,533,977 - 19,887,600 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 X 19,552,095 - 19,905,718 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 X 19,463,441 - 19,815,640 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 X 19,313,176 - 19,665,376 NCBI Celera X 23,675,636 - 24,008,177 (-) NCBI Celera Cytogenetic Map X p22.12 NCBI HuRef X 17,300,128 - 17,651,187 (-) NCBI HuRef CHM1_1 X 19,582,478 - 19,936,208 (-) NCBI CHM1_1 T2T-CHM13v2.0 X 19,116,856 - 19,470,507 (-) NCBI T2T-CHM13v2.0
Sh3kbp1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 X 158,409,888 - 158,758,916 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl X 158,410,268 - 158,761,065 (+) Ensembl GRCm39 Ensembl GRCm38 X 159,626,892 - 159,975,920 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl X 159,627,272 - 159,978,069 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 X 156,065,340 - 156,413,849 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 X 155,052,706 - 155,318,272 (+) NCBI MGSCv36 mm8 Celera X 142,872,597 - 143,219,835 (+) NCBI Celera Cytogenetic Map X F4 NCBI cM Map X 73.65 NCBI
Sh3kbp1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955509 4,960 - 345,012 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955509 6,157 - 344,930 (-) NCBI ChiLan1.0 ChiLan1.0
SH3KBP1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 X 21,332,665 - 21,689,981 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 X 21,336,054 - 21,693,305 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 X 12,154,789 - 12,511,949 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 X 19,517,952 - 19,822,925 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl X 19,517,952 - 19,822,931 (-) Ensembl panpan1.1 panPan2
SH3KBP1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 X 15,482,593 - 15,818,113 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl X 15,484,680 - 15,817,967 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 ROS_Cfam_1.0 X 15,442,674 - 15,782,235 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl X 15,441,780 - 15,779,762 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 X 15,491,286 - 15,830,650 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 X 15,493,198 - 15,832,564 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 X 15,560,580 - 15,900,196 (-) NCBI UU_Cfam_GSD_1.0
Sh3kbp1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 X 8,541,179 - 8,830,808 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936624 4,327,031 - 4,615,699 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936624 4,327,100 - 4,616,724 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
SH3KBP1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl X 15,885,069 - 16,224,183 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 X 15,887,131 - 16,229,212 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 X 17,136,481 - 17,492,932 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SH3KBP1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 X 17,999,262 - 18,357,003 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl X 17,999,211 - 18,357,157 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666056 19,857,065 - 20,214,417 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Sh3kbp1
.
Predicted Target Of
Count of predictions: 1388 Count of miRNA genes: 246 Interacting mature miRNAs: 309 Transcripts: ENSRNOT00000006438, ENSRNOT00000006741, ENSRNOT00000058687, ENSRNOT00000058688, ENSRNOT00000074898 Prediction methods: Microtar, Miranda, Pita, Rnahybrid, Targetscan Result types: miRGate_prediction
1598873 Memor2 Memory QTL 2 2.5 exploratory behavior trait (VT:0010471) average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674) X 20990947 41052531 Rat 1298071 Edpm12 Estrogen-dependent pituitary mass QTL 12 3.2 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) X 2927898 47927898 Rat 2290375 Gluco34 Glucose level QTL 34 2.75 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) X 20990947 41203591 Rat 731181 Uae27 Urinary albumin excretion QTL 27 2.7 0.0059 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) X 1 43491017 Rat 61430 Cia18 Collagen induced arthritis QTL 18 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) X 14843113 120568734 Rat 10755455 Coatc13 Coat color QTL 13 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 4406000 49406000 Rat 631666 Iddm5 Insulin dependent diabetes mellitus QTL 5 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) X 4494549 49494549 Rat 71116 Niddm16 Non-insulin dependent diabetes mellitus QTL 16 7.81 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) X 15297802 60297802 Rat
RH18201
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 X 34,877,938 - 34,878,128 (+) MAPPER mRatBN7.2 Rnor_6.0 X 37,790,659 - 37,790,848 NCBI Rnor6.0 Rnor_5.0 X 38,095,089 - 38,095,278 UniSTS Rnor5.0 RGSC_v3.4 X 56,075,610 - 56,075,799 UniSTS RGSC3.4 Celera X 35,544,685 - 35,544,874 UniSTS Cytogenetic Map X q21 UniSTS
AW530792
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 X 34,877,514 - 34,877,635 (+) MAPPER mRatBN7.2 Rnor_6.0 X 37,790,235 - 37,790,355 NCBI Rnor6.0 Rnor_5.0 X 38,094,665 - 38,094,785 UniSTS Rnor5.0 RGSC_v3.4 X 56,075,186 - 56,075,306 UniSTS RGSC3.4 Celera X 35,544,261 - 35,544,381 UniSTS RH 3.4 Map X 499.1 UniSTS Cytogenetic Map X q21 UniSTS
AU048313
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 X 35,211,181 - 35,211,310 (+) MAPPER mRatBN7.2 Rnor_6.0 X 38,185,037 - 38,185,165 NCBI Rnor6.0 Rnor_5.0 X 38,494,431 - 38,494,559 UniSTS Rnor5.0 RGSC_v3.4 X 56,411,812 - 56,411,940 UniSTS RGSC3.4 Celera X 35,873,465 - 35,873,593 UniSTS Cytogenetic Map X q21 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000006438 ⟹ ENSRNOP00000006438
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl X 34,877,866 - 35,222,747 (-) Ensembl Rnor_6.0 Ensembl X 37,790,586 - 38,196,204 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000006741 ⟹ ENSRNOP00000006741
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl X 34,877,866 - 35,222,747 (-) Ensembl Rnor_6.0 Ensembl X 37,791,483 - 38,196,060 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000074898 ⟹ ENSRNOP00000067100
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl X 34,877,866 - 35,222,747 (-) Ensembl Rnor_6.0 Ensembl X 37,791,601 - 38,026,774 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000095370 ⟹ ENSRNOP00000093532
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl X 34,877,866 - 35,222,747 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000096669 ⟹ ENSRNOP00000083463
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl X 34,877,866 - 35,020,429 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000113102 ⟹ ENSRNOP00000089759
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl X 34,877,866 - 35,146,767 (-) Ensembl
RefSeq Acc Id:
NM_053360 ⟹ NP_445812
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 38,686,530 - 39,031,393 (-) NCBI mRatBN7.2 X 34,877,862 - 35,222,747 (-) NCBI Rnor_6.0 X 37,790,582 - 38,196,204 (-) NCBI Rnor_5.0 X 38,094,434 - 38,505,289 (-) NCBI RGSC_v3.4 X 56,075,533 - 56,422,980 (-) RGD Celera X 35,544,608 - 35,884,206 (-) RGD
Sequence:
CAGGAAACCCGGAGCAGCCGGGTGCAGCGGGGCCGCGATGCAGCAGCAGCAGCAGCAGGAGTCGCCCCAGGGCAGCAGCGGCAGCAGCAGCAGAAGCAGTAGCGGGCGGCGCTGAGCTGCCACCACCG
hide sequence
RefSeq Acc Id:
XM_006256924 ⟹ XP_006256986
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 38,686,530 - 38,953,932 (-) NCBI mRatBN7.2 X 34,877,862 - 35,145,267 (-) NCBI Rnor_6.0 X 37,790,004 - 38,026,891 (-) NCBI Rnor_5.0 X 38,094,434 - 38,505,289 (-) NCBI
Sequence:
GGTGTTTGTCAAATGTGTTGTGATTATATGGTGTTATTATGGTTTATTTCCAGAGATAAAGAGGCATCCCAAAACTTCAGCCTATAAATACCTTCTTCCCTTTCTATGTCCTCACAGGAAATAAAGAA
hide sequence
RefSeq Acc Id:
XM_006256929 ⟹ XP_006256991
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 38,686,530 - 38,953,931 (-) NCBI mRatBN7.2 X 34,877,862 - 35,145,264 (-) NCBI Rnor_6.0 X 37,790,004 - 38,026,806 (-) NCBI Rnor_5.0 X 38,094,434 - 38,505,289 (-) NCBI
Sequence:
AAATACCTTCTTCCCTTTCTATGTCCTCACAGGAAATAAAGAAGGATGTGAAGAAAGACCTTCTCTCTAACAAAGCTCCTGAGAAGCCCATGCATGATGTGTCCAGTGGAAACTCTTTGCTTTCTTCT
hide sequence
RefSeq Acc Id:
XM_006256930 ⟹ XP_006256992
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 38,686,530 - 38,829,093 (-) NCBI mRatBN7.2 X 34,877,862 - 35,020,424 (-) NCBI Rnor_6.0 X 37,790,004 - 37,932,668 (-) NCBI Rnor_5.0 X 38,094,434 - 38,505,289 (-) NCBI
Sequence:
ACACACACACAAGTAATCACTGGGTCCTGCCAATAAATACTCTGAATGTGTTCCTTGTCCACGT
hide sequence
RefSeq Acc Id:
XM_006256931 ⟹ XP_006256993
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 38,686,530 - 39,031,653 (-) NCBI mRatBN7.2 X 34,877,862 - 35,223,008 (-) NCBI Rnor_6.0 X 37,790,004 - 38,196,365 (-) NCBI Rnor_5.0 X 38,094,434 - 38,505,289 (-) NCBI
Sequence:
GCGCCTCTTAGGCGGGCGGAGCCGCTGAGCTTCGCCGCGGCGGGGAGGAGGGGAGAGCAGGCTCAGAGGCGGCTGCAGGGCACTGGGCTGGGCGGTGCTTTTTTTTTTCTTTTCTTTCTTTCTTTTTT
hide sequence
RefSeq Acc Id:
XM_008773199 ⟹ XP_008771421
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 38,686,530 - 38,719,604 (-) NCBI mRatBN7.2 X 34,877,862 - 34,910,937 (-) NCBI Rnor_6.0 X 37,790,004 - 37,823,989 (-) NCBI
Sequence:
ATCCCAGTAGTTCTCAGCTGTCTGCCCTCTGGTGAGGAGTATGTGAGAGTTGGATCCAATGCTTCCTTTCAGAAAGAGAGTTGGACTTCCTTCCATGGTTCCATCCCCACAGACGTGCTGGGGTGACA
hide sequence
RefSeq Acc Id:
XM_008773200 ⟹ XP_008771422
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 38,686,530 - 38,717,815 (-) NCBI mRatBN7.2 X 34,877,862 - 34,909,151 (-) NCBI Rnor_6.0 X 37,790,004 - 37,822,257 (-) NCBI
Sequence:
GGCAGGAACAGGCCTGTATTGCATCCTGTGGAGACAGCAGGAGGGTTTGTGGCTAGAAGTACATTGGCAAAGGGGGTGACAGTTCAAAGATTGACTTGGCAGGCAGCACGCTCTCTGGCATCTTGGAT
hide sequence
RefSeq Acc Id:
XM_039100100 ⟹ XP_038956028
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 38,686,530 - 39,031,652 (-) NCBI mRatBN7.2 X 34,877,862 - 35,223,007 (-) NCBI
RefSeq Acc Id:
XM_039100101 ⟹ XP_038956029
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 38,686,530 - 39,031,651 (-) NCBI mRatBN7.2 X 34,877,862 - 35,223,006 (-) NCBI
RefSeq Acc Id:
XM_039100102 ⟹ XP_038956030
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 38,686,530 - 39,031,658 (-) NCBI mRatBN7.2 X 34,877,862 - 35,223,013 (-) NCBI
RefSeq Acc Id:
XM_039100103 ⟹ XP_038956031
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 38,686,530 - 39,031,656 (-) NCBI mRatBN7.2 X 34,877,862 - 35,223,012 (-) NCBI
RefSeq Acc Id:
XM_039100104 ⟹ XP_038956032
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 38,686,530 - 39,031,649 (-) NCBI mRatBN7.2 X 34,877,862 - 35,223,005 (-) NCBI
RefSeq Acc Id:
XM_063280332 ⟹ XP_063136402
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 38,686,530 - 38,953,932 (-) NCBI
RefSeq Acc Id:
XM_063280333 ⟹ XP_063136403
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 38,686,530 - 38,953,946 (-) NCBI
RefSeq Acc Id:
XM_063280334 ⟹ XP_063136404
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 38,686,530 - 38,829,077 (-) NCBI
RefSeq Acc Id:
XM_063280335 ⟹ XP_063136405
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 38,686,530 - 38,719,605 (-) NCBI
RefSeq Acc Id:
XM_063280336 ⟹ XP_063136406
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 38,686,530 - 38,717,817 (-) NCBI
RefSeq Acc Id:
NP_445812 ⟸ NM_053360
- UniProtKB:
Q6IRL5 (UniProtKB/TrEMBL), A6IPM0 (UniProtKB/TrEMBL)
- Sequence:
MVEAIVEFDYQAQHDDELTISVGEVITNIRKEDGGWWEGQINGRRGLFPDNFVREIKKDVKKDLLSNKAPEKPMHDVSSGNSLLSSETILRTNKRGERRRRRCQVAFSYLPQNDDELELKVGDIIEVV
hide sequence
RefSeq Acc Id:
XP_006256993 ⟸ XM_006256931
- Peptide Label:
isoform X1
- UniProtKB:
Q9JKQ1 (UniProtKB/Swiss-Prot), Q9JKQ0 (UniProtKB/Swiss-Prot), Q925R3 (UniProtKB/Swiss-Prot), Q925R2 (UniProtKB/Swiss-Prot), Q925R1 (UniProtKB/Swiss-Prot), Q925R0 (UniProtKB/Swiss-Prot), Q9JLU9 (UniProtKB/Swiss-Prot), Q925Q9 (UniProtKB/Swiss-Prot), A6IPL9 (UniProtKB/TrEMBL), A6IPM1 (UniProtKB/TrEMBL)
- Sequence:
MVEAIVEFDYQAQHDDELTISVGEVITNIRKEDGGWWEGQINGRRGLFPDNFVREIKKDVKKDL
hide sequence
RefSeq Acc Id:
XP_006256991 ⟸ XM_006256929
- Peptide Label:
isoform X8
- UniProtKB:
A0A8I6A8U3 (UniProtKB/TrEMBL), A6IPM2 (UniProtKB/TrEMBL)
- Sequence:
MSSQEIKKDVKKDLLSNKAPEKPMHDVSSGNSLLSSETILRTNKRGERRRRRCQVAFSYLPQND
hide sequence
RefSeq Acc Id:
XP_006256986 ⟸ XM_006256924
- Peptide Label:
isoform X4
- UniProtKB:
A6IPM1 (UniProtKB/TrEMBL)
- Sequence:
MSSQEIKKDVKKDLLSNKAPEKPMHDVSSGNSLLSSETILRTNKRGERRRRRCQVAFSYLPQND
hide sequence
RefSeq Acc Id:
XP_006256992 ⟸ XM_006256930
- Peptide Label:
isoform X11
- UniProtKB:
A6IPM3 (UniProtKB/TrEMBL), A6IPM4 (UniProtKB/TrEMBL)
- Sequence:
MGEETIGKKLPPATSTPDPSKTEMDSRTKTKDYCKVIFPYEAQNDDELTIKEGDIVTLINKDCIDVGWWEGELNGRRGVFPDNFVKLLPSDFDKEGNRPKKPPPPSAPVIKQGAGTTERKHEIKKIPP
hide sequence
RefSeq Acc Id:
XP_008771421 ⟸ XM_008773199
- Peptide Label:
isoform X13
- Sequence:
MLPFRKRVGLPSMVPSPQTCWGDSSKIDLAGSTLSGILDKDLSDRSNDIDLEGFDSVISSTEKL
hide sequence
RefSeq Acc Id:
XP_008771422 ⟸ XM_008773200
- Peptide Label:
isoform X15
- UniProtKB:
A6IPM6 (UniProtKB/TrEMBL)
- Sequence:
MAAASSGPASLSSVASSPMSSSLGTAGQRASSPSLFSAEGKAKTESAVSSQAAIEELKMQVREL
hide sequence
Ensembl Acc Id:
ENSRNOP00000006438 ⟸ ENSRNOT00000006438
Ensembl Acc Id:
ENSRNOP00000006741 ⟸ ENSRNOT00000006741
Ensembl Acc Id:
ENSRNOP00000067100 ⟸ ENSRNOT00000074898
RefSeq Acc Id:
XP_038956030 ⟸ XM_039100102
- Peptide Label:
isoform X5
- UniProtKB:
A6IPM1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038956031 ⟸ XM_039100103
- Peptide Label:
isoform X7
- UniProtKB:
A6IPM1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038956028 ⟸ XM_039100100
- Peptide Label:
isoform X2
- UniProtKB:
M0RBZ7 (UniProtKB/TrEMBL), A6IPM1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038956029 ⟸ XM_039100101
- Peptide Label:
isoform X3
- UniProtKB:
A0A0H2UHD8 (UniProtKB/TrEMBL), A6IPM0 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038956032 ⟸ XM_039100104
- Peptide Label:
isoform X9
- UniProtKB:
A0A8I6AJT1 (UniProtKB/TrEMBL), A6IPM0 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000083463 ⟸ ENSRNOT00000096669
Ensembl Acc Id:
ENSRNOP00000089759 ⟸ ENSRNOT00000113102
Ensembl Acc Id:
ENSRNOP00000093532 ⟸ ENSRNOT00000095370
RefSeq Acc Id:
XP_063136403 ⟸ XM_063280333
- Peptide Label:
isoform X10
- UniProtKB:
A6IPM2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063136402 ⟸ XM_063280332
- Peptide Label:
isoform X6
- UniProtKB:
A6IPM2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063136404 ⟸ XM_063280334
- Peptide Label:
isoform X12
- UniProtKB:
A6IPM4 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063136405 ⟸ XM_063280335
- Peptide Label:
isoform X14
RefSeq Acc Id:
XP_063136406 ⟸ XM_063280336
- Peptide Label:
isoform X15
- UniProtKB:
A6IPM6 (UniProtKB/TrEMBL)
BioCyc Gene G2FUF-2489 BioCyc
Ensembl Genes ENSRNOG00000004322 Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript ENSRNOT00000006438 ENTREZGENE
ENSRNOT00000006741 ENTREZGENE
ENSRNOT00000006741.8 UniProtKB/Swiss-Prot
ENSRNOT00000074898 ENTREZGENE
ENSRNOT00000095370 ENTREZGENE
ENSRNOT00000096669 ENTREZGENE
ENSRNOT00000096669.1 UniProtKB/Swiss-Prot
ENSRNOT00000113102 ENTREZGENE
ENSRNOT00000142445 ENTREZGENE
Gene3D-CATH SH3 Domains UniProtKB/Swiss-Prot
IMAGE_CLONE IMAGE:7096160 IMAGE-MGC_LOAD
InterPro CIN85_SH3_1 UniProtKB/Swiss-Prot
CIN85_SH3_2 UniProtKB/Swiss-Prot
CIN85_SH3_3 UniProtKB/Swiss-Prot
Endophilin_SH3RF UniProtKB/Swiss-Prot
SH3-like_dom_sf UniProtKB/Swiss-Prot
SH3_domain UniProtKB/Swiss-Prot
KEGG Report rno:84357 UniProtKB/Swiss-Prot
MGC_CLONE MGC:91419 IMAGE-MGC_LOAD
NCBI Gene 84357 ENTREZGENE
PANTHER PTHR14167:SF6 UniProtKB/Swiss-Prot
SH3 DOMAIN-CONTAINING UniProtKB/Swiss-Prot
Pfam SH3_9 UniProtKB/Swiss-Prot
PhenoGen Sh3kbp1 PhenoGen
PRINTS P67PHOX UniProtKB/Swiss-Prot
SH3DOMAIN UniProtKB/Swiss-Prot
PROSITE SH3 UniProtKB/Swiss-Prot
RatGTEx ENSRNOG00000004322 RatGTEx
SMART SH3 UniProtKB/Swiss-Prot
Superfamily-SCOP SSF50044 UniProtKB/Swiss-Prot
UniProt A0A0H2UHD8 ENTREZGENE, UniProtKB/TrEMBL
A0A8I6A8U3 ENTREZGENE, UniProtKB/TrEMBL
A0A8I6AJT1 ENTREZGENE, UniProtKB/TrEMBL
A6IPL9 ENTREZGENE, UniProtKB/TrEMBL
A6IPM0 ENTREZGENE, UniProtKB/TrEMBL
A6IPM1 ENTREZGENE, UniProtKB/TrEMBL
A6IPM2 ENTREZGENE, UniProtKB/TrEMBL
A6IPM3 ENTREZGENE, UniProtKB/TrEMBL
A6IPM4 ENTREZGENE, UniProtKB/TrEMBL
A6IPM6 ENTREZGENE, UniProtKB/TrEMBL
A6IPM8_RAT UniProtKB/TrEMBL
M0RBZ7 ENTREZGENE, UniProtKB/TrEMBL
Q6IRL5 ENTREZGENE, UniProtKB/TrEMBL
Q925Q9 ENTREZGENE
Q925R0 ENTREZGENE
Q925R1 ENTREZGENE
Q925R2 ENTREZGENE
Q925R3 ENTREZGENE
Q9JKQ0 ENTREZGENE
Q9JKQ1 ENTREZGENE
Q9JLU9 ENTREZGENE
SH3K1_RAT UniProtKB/Swiss-Prot
UniProt Secondary Q925R0 UniProtKB/Swiss-Prot
Q925R1 UniProtKB/Swiss-Prot
Q925R2 UniProtKB/Swiss-Prot
Q925R3 UniProtKB/Swiss-Prot
Q9JKQ0 UniProtKB/Swiss-Prot
Q9JKQ1 UniProtKB/Swiss-Prot
Q9JLU9 UniProtKB/Swiss-Prot
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-05-04
Sh3kbp1
SH3 domain-containing kinase-binding protein 1
Sh3kbp1
SH3-domain kinase binding protein 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2004-02-26
Sh3kbp1
SH3-domain kinase binding protein 1
Symbol and Name status set to approved
625702 APPROVED
2002-08-07
Sh3kbp1
SH3-domain kinase binding protein 1
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_expression
expressed in tumorigenic astrocytes
729728
