Ptgis (prostaglandin I2 synthase)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Ptgis (prostaglandin I2 synthase) Rattus norvegicus

Analyze

Symbol:

Ptgis (Ensembl: AABR07054614.1)

Name:

prostaglandin I2 synthase

RGD ID:

3438

Description:

Enables prostaglandin-I synthase activity. Involved in prostaglandin biosynthetic process and response to hypoxia. Located in extracellular space. Used to study brain ischemia and pulmonary hypertension. Human ortholog(s) of this gene implicated in colorectal adenoma; essential hypertension; and hypertension. Orthologous to human PTGIS (prostaglandin I2 synthase); PARTICIPATES IN acetylsalicylic acid pharmacodynamics pathway; antipyrine drug pathway; arachidonic acid metabolic pathway; INTERACTS WITH (R)-carnitine; 1,1,1-trichloro-2,2-bis(4-hydroxyphenyl)ethane; 17alpha-ethynylestradiol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

hydroperoxy icosatetraenoate dehydratase; PGIS; prostacyclin synthase; prostaglandin I2 (prostacyclin) synthase

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PTGIS (prostaglandin I2 synthase)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther
Mus musculus (house mouse):	Ptgis (prostaglandin I2 (prostacyclin) synthase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Ptgis (prostaglandin I2 synthase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PTGIS (prostaglandin I2 synthase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	PTGIS (prostaglandin I2 synthase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ptgis (prostaglandin I2 synthase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PTGIS (prostaglandin I2 synthase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PTGIS (prostaglandin I2 synthase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ptgis (prostaglandin I2 synthase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	DND1 (DND microRNA-mediated repression inhibitor 1)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Ptgis (prostaglandin I2 (prostacyclin) synthase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	PTGIS (prostaglandin I2 synthase)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ptgis (prostaglandin I2 (prostacyclin) synthase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	ptgis	Alliance	DIOPT (OrthoFinder\|PANTHER)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	3	155,928,564 - 155,964,228 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	155,916,412 - 155,965,451 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	159,730,001 - 159,765,702 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	3	168,228,974 - 168,264,675 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	3	165,970,684 - 166,006,385 (-)	NCBI	Rnor_WKY
Rnor_6.0	3	163,950,746 - 163,986,129 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_5.0	3	170,109,317 - 170,143,882 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	158,356,878 - 158,387,984 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	158,262,914 - 158,294,020 (-)	NCBI
Celera	3	154,508,773 - 154,544,997 (-)	NCBI		Celera
Cytogenetic Map	3	q42	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autism spectrum disorder (ISO)

brain ischemia (IDA)

Childhood Schizophrenia (ISO)

colon cancer (ISO)

colorectal adenoma (ISO)

essential hypertension (ISO)

genetic disease (ISO)

hypertension (ISO)

Lung Neoplasms (ISO)

lung non-small cell carcinoma (ISO)

Neoplasm Metastasis (ISO)

Nociceptive Pain (ISO)

oral squamous cell carcinoma (ISO)

patent ductus arteriosus (ISO)

peritonitis (ISO)

pulmonary hypertension (IDA,IMP)

Spontaneous Abortions (ISO)

Stevens-Johnson syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(R)-carnitine (EXP)

1,1,1-trichloro-2,2-bis(4-hydroxyphenyl)ethane (EXP)

17alpha-ethynylestradiol (EXP)

17beta-estradiol (ISO)

2,3',4,4',5-Pentachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

2,4,6-trinitrobenzenesulfonic acid (EXP)

2,6-dinitrotoluene (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (ISO)

6-oxoprostaglandin F1alpha (EXP)

6-propyl-2-thiouracil (EXP)

acrolein (ISO)

acrylamide (EXP)

aflatoxin B1 (EXP)

all-trans-retinoic acid (EXP,ISO)

ammonium chloride (EXP)

antirheumatic drug (ISO)

asbestos (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bis(2-chloroethyl) sulfide (ISO)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

cadmium dichloride (ISO)

calcitriol (ISO)

candesartan (EXP)

carbon nanotube (ISO)

CGP 52608 (ISO)

clofibrate (ISO)

dexamethasone (ISO)

dextran sulfate (ISO)

dibenz[a,h]anthracene (ISO)

diethyl malate (ISO)

dioxygen (ISO)

disodium selenite (ISO)

diuron (EXP)

dorsomorphin (ISO)

doxorubicin (EXP)

entinostat (ISO)

ethanol (ISO)

furan (EXP)

genistein (EXP)

gentamycin (EXP)

glafenine (EXP)

inulin (ISO)

Lasiocarpine (ISO)

methotrexate (ISO)

N-methyl-4-phenylpyridinium (EXP)

nitrofen (EXP)

ozone (ISO)

paracetamol (ISO)

paraquat (EXP)

perfluorooctane-1-sulfonic acid (EXP,ISO)

phenobarbital (EXP)

phenylephrine (EXP)

phenylmercury acetate (ISO)

pregnenolone 16alpha-carbonitrile (EXP)

propanal (ISO)

raloxifene (EXP)

resveratrol (ISO)

rofecoxib (ISO)

SB 431542 (ISO)

senecionine (ISO)

Senkirkine (ISO)

sodium arsenite (ISO)

sodium chloride (EXP)

sodium fluoride (ISO)

T-2 toxin (ISO)

tetrachloromethane (EXP,ISO)

titanium dioxide (ISO)

valdecoxib (EXP)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

apoptotic signaling pathway (IEA,ISO)

cellular response to hypoxia (IEA,ISO,ISS)

cellular response to interleukin-1 (IEA,ISO,ISS)

cellular response to interleukin-6 (IEA,ISO,ISS)

decidualization (ISO)

embryo implantation (ISO)

icosanoid metabolic process (ISO)

negative regulation of inflammatory response (IEA,ISO,ISS)

negative regulation of NF-kappaB transcription factor activity (IEA,ISO,ISS)

negative regulation of nitric oxide biosynthetic process (IEA,ISO,ISS)

positive regulation of angiogenesis (IEA,ISO,ISS)

positive regulation of execution phase of apoptosis (IEA,ISO,ISS)

positive regulation of peroxisome proliferator activated receptor signaling pathway (IEA,ISO,ISS)

prostaglandin biosynthetic process (IBA,IDA,IEA,ISO,ISS,TAS)

response to hypoxia (IMP)

vasodilation (ISO)

Cellular Component

caveola (IEA,ISO,ISS)

cytoplasm (ISO)

endoplasmic reticulum (IEA,ISO,ISS)

endoplasmic reticulum membrane (IEA,ISS)

extracellular space (IDA)

nucleus (IEA,ISO,ISS)

Molecular Function

heme binding (IEA,ISO,ISS)

hydroperoxy icosatetraenoate dehydratase activity (IEA)

iron ion binding (IEA)

monooxygenase activity (IEA)

oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen (IEA)

prostaglandin-I synthase activity (IBA,IDA,IEA,IMP,ISO)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

acetylsalicylic acid pharmacodynamics pathway (ISO)

antipyrine drug pathway (ISO)

arachidonic acid metabolic pathway (IEA,ISO)

celecoxib pharmacodynamics pathway (ISO)

diclofenac pharmacodynamics pathway (ISO)

diflunisal pharmacodynamics pathway (ISO)

etodolac pharmacodynamics pathway (ISO)

fenoprofen pharmacodynamics pathway (ISO)

flurbiprofen pharmacodynamics pathway (ISO)

ibuprofen pharmacodynamics pathway (ISO)

indometacin pharmacodynamics pathway (ISO)

ketoprofen pharmacodynamics pathway (ISO)

ketorolac pharmacodynamics pathway (ISO)

leukotriene C4 synthase deficiency pathway (ISO)

lornoxicam pharmacodynamics pathway (ISO)

magnesium salicylate pharmacodynamics pathway (ISO)

mefenamic acid pharmacodynamics pathway (ISO)

meloxicam pharmacodynamics pathway (ISO)

nabumetone pharmacodynamics pathway (ISO)

naproxen pharmacodynamics pathway (ISO)

paracetamol drug pathway (ISO)

piroxicam pharmacodynamics pathway (ISO)

prostacyclin biosynthetic pathway (ISO)

salicylic acid pharmacodynamics pathway (ISO)

sodium salicylate pharmacodynamics pathway (ISO)

sulindac pharmacodynamics pathway (ISO)

tenoxicam pharmacodynamics pathway (ISO)

tiaprofenic acid pharmacodynamics pathway (ISO)

tolmetin pharmacodynamics pathway (ISO)

valdecoxib pharmacodynamics pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Induction of prostacyclin/PGI2 synthase expression after cerebral ischemia-reperfusion.	Fang YC, etal., J Cereb Blood Flow Metab. 2006 Apr;26(4):491-501.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Pulmonary prostacyclin synthase overexpression in transgenic mice protects against development of hypoxic pulmonary hypertension.	Geraci MW, etal., J Clin Invest 1999 Jun;103(11):1509-15.
4.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
5.	KEGG: Kyoto Encyclopedia of Genes and Genomes	KEGG
6.	Molecular mechanisms regulating the vascular prostacyclin pathways and their adaptation during pregnancy and in the newborn.	Majed BH and Khalil RA, Pharmacol Rev. 2012 Jul;64(3):540-82. doi: 10.1124/pr.111.004770. Epub 2012 Jun 7.
7.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
8.	Splicing mutation of the prostacyclin synthase gene in a family associated with hypertension.	Nakayama T, etal., Biochem Biophys Res Commun 2002 Oct 11;297(5):1135-9.
9.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
10.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
11.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
12.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
13.	Prostacyclin synthase and arachidonate 5-lipoxygenase polymorphisms and risk of colorectal polyps.	Poole EM, etal., Cancer Epidemiol Biomarkers Prev. 2006 Mar;15(3):502-8. doi: 10.1158/1055-9965.EPI-05-0804.
14.	GOA pipeline	RGD automated data pipeline
15.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
16.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
17.	Differential Expression of Prostaglandin I2 Synthase Associated with Arachidonic Acid Pathway in the Oral Squamous Cell Carcinoma.	Russo A, etal., J Oncol. 2018 Nov 8;2018:6301980. doi: 10.1155/2018/6301980. eCollection 2018.
18.	Genetic-deletion of Cyclooxygenase-2 Downstream Prostacyclin Synthase Suppresses Inflammatory Reactions but Facilitates Carcinogenesis, unlike Deletion of Microsomal Prostaglandin E Synthase-1.	Sasaki Y, etal., Sci Rep. 2015 Nov 27;5:17376. doi: 10.1038/srep17376.
19.	PGI2 production by rat blood vessels: diminished prostacyclin formation in veins compared to arteries.	Skidgel RA and Printz MP, Prostaglandins 1978 Jul;16(1):1-16.
20.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
21.	Repeated gene transfer of naked prostacyclin synthase plasmid into skeletal muscles attenuates monocrotaline-induced pulmonary hypertension and prolongs survival in rats.	Tahara N, etal., Hum Gene Ther. 2004 Dec;15(12):1270-8.

Additional References at PubMed

PMID:8185632	PMID:10385625	PMID:11551955	PMID:15115769	PMID:15489334	PMID:17020766	PMID:17825254	PMID:17951541	PMID:18032380	PMID:20122998	PMID:20159982	PMID:20925195
PMID:21035466	PMID:21296955	PMID:24141169	PMID:27923787	PMID:31505169

Genomics

Comparative Map Data

Ptgis
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	3	155,928,564 - 155,964,228 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	155,916,412 - 155,965,451 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	159,730,001 - 159,765,702 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	3	168,228,974 - 168,264,675 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	3	165,970,684 - 166,006,385 (-)	NCBI	Rnor_WKY
Rnor_6.0	3	163,950,746 - 163,986,129 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_5.0	3	170,109,317 - 170,143,882 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	158,356,878 - 158,387,984 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	158,262,914 - 158,294,020 (-)	NCBI
Celera	3	154,508,773 - 154,544,997 (-)	NCBI		Celera
Cytogenetic Map	3	q42	NCBI

PTGIS
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	20	49,503,874 - 49,568,137 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	20	49,503,874 - 49,568,137 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	20	48,120,411 - 48,184,674 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	20	47,553,818 - 47,618,114 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	20	47,553,820 - 47,618,114	NCBI
Celera	20	44,825,044 - 44,889,311 (-)	NCBI		Celera
Cytogenetic Map	20	q13.13	NCBI
HuRef	20	44,868,991 - 44,933,099 (-)	NCBI		HuRef
CHM1_1	20	48,024,824 - 48,089,470 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	20	51,273,490 - 51,337,709 (-)	NCBI		T2T-CHM13v2.0

Ptgis
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	167,045,114 - 167,094,070 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	167,033,725 - 167,082,524 (-)	Ensembl		GRCm39 Ensembl
GRCm38	2	167,203,194 - 167,252,150 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	167,191,805 - 167,240,604 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	167,028,696 - 167,066,037 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	166,894,401 - 166,931,742 (-)	NCBI		MGSCv36	mm8
Celera	2	173,143,332 - 173,180,671 (-)	NCBI		Celera
Cytogenetic Map	2	H3	NCBI

Ptgis
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955445	8,623,430 - 8,677,658 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955445	8,624,228 - 8,663,385 (+)	NCBI	ChiLan1.0	ChiLan1.0

PTGIS
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	20	55,237,848 - 55,302,529 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	20	45,841,238 - 45,905,641 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	20	46,909,010 - 46,952,850 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	20	46,905,665 - 46,971,612 (-)	Ensembl	panpan1.1		panPan2

PTGIS
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	24	36,129,091 - 36,162,525 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	24	36,132,173 - 36,162,509 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	24	35,371,271 - 35,411,412 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	24	36,836,800 - 36,873,631 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	24	36,821,516 - 36,873,620 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	24	36,074,715 - 36,114,829 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	24	36,208,769 - 36,248,925 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	24	36,750,911 - 36,791,264 (-)	NCBI		UU_Cfam_GSD_1.0

Ptgis
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	189,336,652 - 189,360,405 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936514	4,791,031 - 4,812,027 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936514	4,775,884 - 4,814,574 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PTGIS
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	17	51,153,154 - 51,200,300 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	17	51,153,151 - 51,200,515 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	17	57,474,357 - 57,521,683 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PTGIS
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	2	14,420,318 - 14,484,667 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	2	14,441,983 - 14,488,264 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666050	62,907,161 - 62,972,792 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ptgis
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624790	5,850,810 - 5,886,014 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624790	5,850,647 - 5,885,754 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Ptgis
155 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	43
Count of miRNA genes:	41
Interacting mature miRNAs:	43
Transcripts:	ENSRNOT00000010891
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	31172320	163586636	Rat
1559282	Emca5	Estrogen-induced mammary cancer QTL 5	3.9		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	3	43827364	169034231	Rat
1581568	Rf53	Renal function QTL 53			urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	3	56395968	161299569	Rat
8662816	Vetf4	Vascular elastic tissue fragility QTL 4	4		renal artery integrity trait (VT:0010642)	number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563)	3	59242096	157323038	Rat
631841	Niddm39	Non-insulin dependent diabetes mellitus QTL 39	3.36		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	94856903	159898684	Rat
2312659	Slep7	Serum leptin concentration QTL 7		0.001	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	3	98535255	168026850	Rat
2312670	Bw94	Body weight QTL 94		0.01	inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	3	98535255	168026850	Rat
2312673	Scl63	Serum cholesterol level QTL 63		0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	3	98535255	168026850	Rat
2302373	Gluco39	Glucose level QTL 39	5.01		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	3	98535386	161695835	Rat
1578754	Stresp16	Stress response QTL 16	4	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	3	112681431	157681431	Rat
1576306	Schws3	Schwannoma susceptibility QTL 3		0.001	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	3	118839124	163839124	Rat
1598877	Bp285	Blood pressure QTL 285	1.5	0.03	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	120538241	165538241	Rat
1300159	Kidm4	Kidney mass QTL 4	3.83		kidney mass (VT:0002707)	right kidney wet weight to body weight ratio (CMO:0001953)	3	121056165	157309487	Rat
10755461	Coatc16	Coat color QTL 16			coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	3	122438700	167438700	Rat
631541	Bp81	Blood pressure QTL 81	4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	124122556	169034231	Rat
2303620	Vencon4	Ventilatory control QTL 4	3.9		respiration trait (VT:0001943)	tidal volume (CMO:0000222)	3	127162703	168026850	Rat
631673	Iddm13	Insulin dependent diabetes mellitus QTL 13	1.3	0.663	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	3	130193298	161695983	Rat
1578656	Vnigr2	Vascular neointimal growth QTL 2	4.2		artery morphology trait (VT:0002191)	lesioned artery residual lumen area (CMO:0001417)	3	130656562	169034231	Rat
1578653	Vnigr3	Vascular neointimal growth QTL 3	3.1		artery morphology trait (VT:0002191)	artery neointimal hyperplastic lesion area (CMO:0001414)	3	130656562	169034231	Rat
9589106	Insul23	Insulin level QTL 23	13.86	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	3	131635904	169034231	Rat
2298477	Eau4	Experimental allergic uveoretinitis QTL 4		0.0011	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	3	137398739	169034231	Rat
8552952	Pigfal13	Plasma insulin-like growth factor 1 level QTL 13			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	3	138799500	169034231	Rat
1298068	Bp167	Blood pressure QTL 167		0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	141074471	169034231	Rat
1331726	Bp208	Blood pressure QTL 208	3.129		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	141339013	162184794	Rat
2317883	Alcrsp26	Alcohol response QTL 26	1.8	0.63	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	3	145526770	169034231	Rat
12879871	Am7	Aortic mass QTL 7		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	3	145925360	166177555	Rat
12879872	Cm97	Cardiac mass QTL 97		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	145925360	166177555	Rat
12879873	Cm96	Cardiac mass QTL 96		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	3	145925360	166177555	Rat
12879874	Cm98	Cardiac mass QTL 98		0.005	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	3	145925360	166177555	Rat
12879875	Kidm64	Kidney mass QTL 64		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	145925360	166177555	Rat
12879876	Bw182	Body weight QTL 182		0.003	body mass (VT:0001259)	body weight (CMO:0000012)	3	145925360	166177555	Rat
2301411	Bp320	Blood pressure QTL 320		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	145925360	166177555	Rat
1300113	Bp176	Blood pressure QTL 176	3.9		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	145956084	157309487	Rat
1598854	Memor10	Memory QTL 10	2		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	3	145956084	161299569	Rat
8552791	Vie2	Viral induced encephalitis QTL 2	4.1		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	3	145956084	169034231	Rat
1578666	Vnigr1	Vascular neointimal growth QTL 1	4.6		artery morphology trait (VT:0002191)	artery lumen area (CMO:0001409)	3	149040888	168026850	Rat

Markers in Region

D3Got155

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	155,951,423 - 155,951,573 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	163,973,327 - 163,973,476	NCBI	Rnor6.0
Rnor_5.0	3	170,131,080 - 170,131,229	UniSTS	Rnor5.0
Celera	3	154,532,212 - 154,532,361	UniSTS
RH 3.4 Map	3	1441.6	RGD
RH 3.4 Map	3	1441.6	UniSTS
Cytogenetic Map	3	q42	UniSTS

AW529446

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	155,943,587 - 155,943,756 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	163,965,193 - 163,965,361	NCBI	Rnor6.0
Rnor_5.0	3	170,124,593 - 170,124,761	UniSTS	Rnor5.0
Celera	3	154,524,558 - 154,524,726	UniSTS
RH 3.4 Map	3	1442.4	UniSTS
Cytogenetic Map	3	q42	UniSTS

RH130734

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	155,928,598 - 155,928,784 (-)	MAPPER	mRatBN7.2
mRatBN7.2	3	155,928,598 - 155,928,784 (+)	MAPPER	mRatBN7.2
mRatBN7.2	11	52,245,400 - 52,245,586 (-)	MAPPER	mRatBN7.2
mRatBN7.2	11	52,245,400 - 52,245,586 (+)	MAPPER	mRatBN7.2
Rnor_6.0	11	54,830,061 - 54,830,246	NCBI	Rnor6.0
Rnor_6.0	3	163,950,781 - 163,950,966	NCBI	Rnor6.0
Rnor_5.0	3	170,109,352 - 170,109,537	UniSTS	Rnor5.0
Rnor_5.0	11	57,988,636 - 57,988,821	UniSTS	Rnor5.0
RGSC_v3.4	3	158,356,913 - 158,357,098	UniSTS	RGSC3.4
RGSC_v3.4	11	53,492,284 - 53,492,469	UniSTS	RGSC3.4
Celera	11	51,841,764 - 51,841,949	UniSTS
Celera	3	154,508,808 - 154,508,993	UniSTS
RH 3.4 Map	2	755.19	UniSTS
Cytogenetic Map	11	q21	UniSTS
Cytogenetic Map	3	q42	UniSTS

BI275702

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	155,931,041 - 155,931,252 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	163,953,224 - 163,953,434	NCBI	Rnor6.0
Rnor_5.0	3	170,111,795 - 170,112,005	UniSTS	Rnor5.0
Celera	3	154,511,251 - 154,511,461	UniSTS
RH 3.4 Map	3	1441.5	UniSTS
Cytogenetic Map	3	q42	UniSTS

Expression

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_031557	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039104378	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC061814	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000120	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U53855	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000010891 ⟹ ENSRNOP00000010891

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	155,928,564 - 155,951,645 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000082474 ⟹ ENSRNOP00000074093

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	155,928,564 - 155,953,292 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000103286 ⟹ ENSRNOP00000088713

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	155,916,412 - 155,965,451 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000105814 ⟹ ENSRNOP00000077774

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	155,925,619 - 155,964,267 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000115486 ⟹ ENSRNOP00000087709

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	155,928,570 - 155,965,451 (-)	Ensembl

RefSeq Acc Id:

NM_031557 ⟹ NP_113745

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	3	155,928,564 - 155,964,228 (-)	NCBI
Rnor_6.0	3	163,950,746 - 163,986,129 (-)	NCBI
Rnor_5.0	3	170,109,317 - 170,143,882 (-)	NCBI
RGSC_v3.4	3	158,356,878 - 158,387,984 (-)	RGD
Celera	3	154,508,773 - 154,544,997 (-)	RGD

Sequence:

show sequence

CTGAGCTGAGGATCCTGCGGTTCGGTGTTGGTGGCGGTGACCTGTTGCCACCCGGCAGCCGCAC
ACCCTCGAGCCATGTCCTGGGCCGCTCTGCTCGGCCTTCTGGCCGTGTTATTACTGTTGCTGCT
GCTGCTGAGCCGCCGGCGCGCGCGGCGACCCGGTGAGCCTCCGTTGGACCTGGGCAGCATCCCC
TGGCTGGGCCATGCCTTGGAGTTTGGGAAGGATGCCGCCAGCTTCCTTACCAGGATGAAGGAGA
AGCACGGTGACATATTTACTGTGCTGGTGGGGGGCAGGTATGTCACTGTCCTCCTGGACCCACA
CTCTTACGACACAGTGGTGTGGGATCTGCGTACACGGCTGGACTTCCACCCCTACGCCATCTTC
CTCATGGAGAGGATTTTTGATCTGCAGCTTCCAAATTTCAACCCCAGCGAGGAGAAGGCCAGGA
TGAAGCCGACGCTCATGCACAAAGACCTGCAGGCGCTCACGGAAGCCATGTATACCAACCTGCG
CACCGTCCTGCTGGGTGACTCCACAGAAGGAGGCAGTGGCTGGCAGGAGAAAGGTCTGCTTGAG
TTCTCCTACAGCTCCCTGCTCAGCGCTGGCTACCTGACCCTGTATGGAGTGGAGGCCTCACCAC
GCACCCACGAGAGTCAGGCCCTCGACCGTGACCACTCAGCCGACGTTTTCCGCACCTTCCGCCA
GCTGGATCTGATGCTCCCCAAACTGGCTCGAGGCTCCTTGTCAGTGGGGGATAAAGACCATGCA
TGCAGTGTCAAAAGCCGCCTGTGGAAGCTGCTGTCTCCAGCCGGACTGGCCTCCAGGGCTGACC
GGAGCAGCTGGTTGGAGAGTTACCTGAGACATCTTGAGGAGATGGGGGTATCAGAGGACATGCA
GGCCCGGGCACTGGTGCTGCAGCTCTGGGCCACACAAGGGAATATGGGACCCACGGCTTTCTGG
CTCCTCCTCTTCCTCCTCAAGAACCCGGAAGCCCTCGATGCTGTCCATGCAGAGCTGAAACGCA
TCGTCTGGCAAGCAGAGAAGCCTGTTTTACAGATGACCGCACTCCCGCAGAAGATTCTAGACAG
CATGCCTGTGCTAGACAGTGTGCTCAATGAGACCCTCCGGCTCACGGCCGCCCCCTTCATCACC
CGTGAGGTCATGGCAGACCTGGCCTTGCCTATGGCAGACAGGAGGGAATTCTCTCTTCGACGCG
GTGACCGCCTTCTCCTCTTTCCTTTCCTGAGTCCCCAGAAGGACCCAGAAATCTACACAGAACC
TGAAGTCTTTAAATACAACCGGTTCTTGAACCCAGATGGGTCAGAAAAGAAAGATTTTTACAAA
GATGGGAAACGGCTAAAGAATTACAACATGCCTTGGGGCGCAGGGCACAACCAGTGCCTGGGGA
AGAGCTATGCCATCAACAGCATCAAACAGTTTGTGGTCCTGCTGCTGACTCATTTCGACCTGGA
GCTGGTCAGTGAGGACACAGAGGTCCCGGAGTTTGACCTTAGCAGATATGGCTTTGGCCTGATG
CAGCCGGAGGAAGATGTGCCCATCCGGTACCGTACCAGGCTGTGACCTGTGGAGCAGACACTAC
ACTCATCTGGGGCCTCCTGACTTCCTGTTGTTCCTCCAGAATGCTGTGTCCAGAGGAGGGGACA
GTGAGAACACCGAGAGCAGGAAAAGCTAATAAAAGCTCTGTGTCTCGCTGTGAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039104378 ⟹ XP_038960306

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	3	155,928,564 - 155,952,790 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_113745	(Get FASTA)	NCBI Sequence Viewer
	XP_038960306	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAB02322	(Get FASTA)	NCBI Sequence Viewer
	AAH61814	(Get FASTA)	NCBI Sequence Viewer
	Q62969	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_113745 ⟸ NM_031557
- Peptide Label:	precursor
- UniProtKB:	Q62969 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MSWAALLGLLAVLLLLLLLLSRRRARRPGEPPLDLGSIPWLGHALEFGKDAASFLTRMKEKHGD IFTVLVGGRYVTVLLDPHSYDTVVWDLRTRLDFHPYAIFLMERIFDLQLPNFNPSEEKARMKPT LMHKDLQALTEAMYTNLRTVLLGDSTEGGSGWQEKGLLEFSYSSLLSAGYLTLYGVEASPRTHE SQALDRDHSADVFRTFRQLDLMLPKLARGSLSVGDKDHACSVKSRLWKLLSPAGLASRADRSSW LESYLRHLEEMGVSEDMQARALVLQLWATQGNMGPTAFWLLLFLLKNPEALDAVHAELKRIVWQ AEKPVLQMTALPQKILDSMPVLDSVLNETLRLTAAPFITREVMADLALPMADRREFSLRRGDRL LLFPFLSPQKDPEIYTEPEVFKYNRFLNPDGSEKKDFYKDGKRLKNYNMPWGAGHNQCLGKSYA INSIKQFVVLLLTHFDLELVSEDTEVPEFDLSRYGFGLMQPEEDVPIRYRTRL hide sequence

RefSeq Acc Id:	XP_038960306 ⟸ XM_039104378
- Peptide Label:	isoform X1
- UniProtKB:	A0A0G2K776 (UniProtKB/TrEMBL)

RefSeq Acc Id:

ENSRNOP00000087709 ⟸ ENSRNOT00000115486

RefSeq Acc Id:

ENSRNOP00000074093 ⟸ ENSRNOT00000082474

RefSeq Acc Id:

ENSRNOP00000010891 ⟸ ENSRNOT00000010891

RefSeq Acc Id:

ENSRNOP00000077774 ⟸ ENSRNOT00000105814

RefSeq Acc Id:

ENSRNOP00000088713 ⟸ ENSRNOT00000103286

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-A0A0G2K776-F1-model_v2	AlphaFold	A0A0G2K776	1-500	view protein structure
AF-Q62969-F1-model_v2	AlphaFold	Q62969	1-501	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:3438	AgrOrtholog
BioCyc Gene	G2FUF-46744	BioCyc
BioCyc Pathway	PWY66-374 [C20 prostanoid biosynthesis]	BioCyc
Ensembl Genes	ENSRNOG00000008245	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000010891.7	UniProtKB/TrEMBL
	ENSRNOP00000074093	ENTREZGENE
	ENSRNOP00000074093.2	UniProtKB/TrEMBL
	ENSRNOP00000077774.1	UniProtKB/TrEMBL
	ENSRNOP00000087709	ENTREZGENE
	ENSRNOP00000087709.1	UniProtKB/Swiss-Prot
	ENSRNOP00000088713.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000010891.7	UniProtKB/TrEMBL
	ENSRNOT00000082474	ENTREZGENE
	ENSRNOT00000082474.2	UniProtKB/TrEMBL
	ENSRNOT00000103286.1	UniProtKB/TrEMBL
	ENSRNOT00000105814.1	UniProtKB/TrEMBL
	ENSRNOT00000115486	ENTREZGENE
	ENSRNOT00000115486.1	UniProtKB/Swiss-Prot
Gene3D-CATH	1.10.630.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:5598666	IMAGE-MGC_LOAD
InterPro	Cyt_P450	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Cyt_P450_CYP7A1-type	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Cyt_P450_E_grp-IV	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Cyt_P450_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTGIS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:25527	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:72400	IMAGE-MGC_LOAD
NCBI Gene	25527	ENTREZGENE
PANTHER	PTHR24306	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR24306:SF4	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	p450	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PharmGKB	PTGIS	RGD
PhenoGen	Ptgis	PhenoGen
PIRSF	Cytochrome_CYPVIIA1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTGIS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PRINTS	EP450IV	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	P450	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF48264	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A0G2K776	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I5Y1K4_RAT	UniProtKB/TrEMBL
	A0A8I6ABA7_RAT	UniProtKB/TrEMBL
	F1LP67_RAT	UniProtKB/TrEMBL
	PTGIS_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-09-21	Ptgis	prostaglandin I2 synthase	Ptgis	prostaglandin I2 (prostacyclin) synthase	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Ptgis	prostaglandin I2 (prostacyclin) synthase		prostaglandin I2 synthase	Name updated	1299863	APPROVED
2003-04-09	Ptgis	prostaglandin I2 synthase		Prostaglandin I2 (prostacyclin) synthase	Name updated	629478	APPROVED
2002-06-10	Ptgis	Prostaglandin I2 (prostacyclin) synthase			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_mutations_overexpression	overexpression in transgenic mice provides protection against severe pulmonary hypertension	727270

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)