CASP3 (caspase 3) - Rat Genome Database

Name: CASP3
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) RatMine GViewer (Genome Viewer) Overgo Probe Designer VCMap Aging & Age-Related Disease Cancer Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: CASP3 (caspase 3) Sus scrofa

Analyze

Symbol:

CASP3

Name:

caspase 3

RGD ID:

14134172

Description:

ENCODES a protein that exhibits cysteine-type endopeptidase activity involved in apoptotic process (ortholog); cysteine-type endopeptidase activity involved in apoptotic signaling pathway (ortholog); cysteine-type peptidase activity (ortholog); INVOLVED IN anterior neural tube closure (ortholog); apoptotic process (ortholog); axonal fasciculation (ortholog); PARTICIPATES IN apoptotic cell death pathway; extrinsic apoptotic pathway; FasL mediated signaling pathway; ASSOCIATED WITH abdominal aortic aneurysm (ortholog); Acute Liver Failure (ortholog); Acute Lung Injury (ortholog); FOUND IN cytoplasm; nucleus; caspase complex (ortholog); INTERACTS WITH 3-[3-(tert-butylsulfanyl)-1-(4-chlorobenzyl)-5-(propan-2-yl)-1H-indol-2-yl]-2,2-dimethylpropanoic acid; 3-methyladenine; 3-oxalomalic acid

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

CASP-3; caspase-3

RGD Orthologs

Human

Mouse

Rat

Chinchilla

Bonobo

Dog

Squirrel

Green Monkey

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CASP3 (caspase 3)	HGNC	Ensembl, Inparanoid, NCBI, OrthoDB
Mus musculus (house mouse):	Casp3 (caspase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus norvegicus (Norway rat):	Casp3 (caspase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Casp3 (caspase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CASP3 (caspase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CASP3 (caspase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Casp3 (caspase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CASP3 (caspase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	CFLAR (CASP8 and FADD like apoptosis regulator)	HGNC	Panther

Latest Assembly:

Sscrofa11.1 - Pig Sscrofa11.1 Assembly

NCBI Annotation Information:

Annotation category: partial on reference assembly

Position:

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	15	45,742,749 - 45,763,773 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	15	45,744,320 - 45,753,252 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	15	52,291,074 - 52,299,625 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

abdominal aortic aneurysm (ISO)

Acute Liver Failure (ISO)

Acute Lung Injury (ISO)

acute myocardial infarction (ISO)

acute necrotizing pancreatitis (ISO)

Alzheimer's disease (ISO)

amyotrophic lateral sclerosis (ISO)

atherosclerosis (ISO)

bacterial infectious disease (ISO)

Brain Contusion (ISO)

brain glioma (ISO)

Brain Injuries (ISO)

brain ischemia (ISO)

breast cancer (ISO)

breast carcinoma (ISO)

Bronchopulmonary Dysplasia (ISO)

Burns (ISO)

calcinosis (ISO)

cataract (ISO)

Cerebral Hemorrhage (ISO)

cervical cancer (ISO)

chemical colitis (ISO)

Chronic Hepatitis (ISO)

chronic obstructive pulmonary disease (ISO)

colon cancer (ISO)

Colonic Neoplasms (ISO)

congestive heart failure (ISO)

Contrast-Induced Nephropathy (ISO)

Copper-Overload Cirrhosis (ISO)

cryptorchidism (ISO)

diabetes mellitus (ISO)

diabetic angiopathy (ISO)

Diabetic Cardiomyopathies (ISO)

Diabetic Nephropathies (ISO)

diabetic neuropathy (ISO)

diabetic retinopathy (ISO)

dilated cardiomyopathy (ISO)

Edema (ISO)

endometritis (ISO)

Endotoxemia (ISO)

Experimental Autoimmune Encephalomyelitis (ISO)

Experimental Autoimmune Myocarditis (ISO)

Experimental Diabetes Mellitus (ISO)

Fetal Growth Retardation (ISO)

gastric ulcer (ISO)

heart disease (ISO)

heart valve disease (ISO)

Hemorrhagic Shock (ISO)

hepatocellular carcinoma (ISO)

Huntington's disease (ISO)

Hypercholesterolemia (ISO)

hypertension (ISO)

hypertrophic cardiomyopathy (ISO)

Hypoxia (ISO)

Hypoxia-Ischemia, Brain (ISO)

impotence (ISO)

Insulin Resistance (ISO)

intermittent claudication (ISO)

intestinal disease (ISO)

Intestinal Reperfusion Injury (ISO)

kidney disease (ISO)

Kidney Reperfusion Injury (ISO)

liver cirrhosis (ISO)

lung non-small cell carcinoma (ISO)

Lung Reperfusion Injury (ISO)

Mammary Neoplasms, Experimental (ISO)

middle cerebral artery infarction (ISO)

Mycoplasma Infections (ISO)

myocardial infarction (ISO)

Myocardial Reperfusion Injury (ISO)

Neoplasm Metastasis (ISO)

Nerve Degeneration (ISO)

nervous system disease (ISO)

osteoarthritis (ISO)

Osteoarthritis, Experimental (ISO)

pancreatitis (ISO)

Parkinson's disease (ISO)

Parkinsonism (ISO)

pre-malignant neoplasm (ISO)

prostate cancer (ISO)

Prostatic Neoplasms (ISO)

Radiation Injuries, Experimental (ISO)

renal cell carcinoma (ISO)

Reperfusion Injury (ISO)

retinal detachment (ISO)

retinal disease (ISO)

salivary gland disease (ISO)

sciatic neuropathy (ISO)

scrapie (ISO)

Sepsis (ISO)

severe acute respiratory syndrome (ISO)

spermatic cord torsion (ISO)

Spinal Cord Injuries (ISO)

status epilepticus (ISO)

stomach cancer (ISO)

Stroke (ISO)

Subarachnoid Hemorrhage (ISO)

Testis Reperfusion Injury (ISO)

toxic encephalopathy (ISO)

transient cerebral ischemia (ISO)

transitional cell carcinoma (ISO)

type 1 diabetes mellitus (ISO)

type 2 diabetes mellitus (ISO)

ulcerative colitis (ISO)

ureteral obstruction (ISO)

urinary bladder cancer (ISO)

Viral Myocarditis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

3-[3-(tert-butylsulfanyl)-1-(4-chlorobenzyl)-5-(propan-2-yl)-1H-indol-2-yl]-2,2-dimethylpropanoic acid (EXP)

3-methyladenine (EXP)

3-oxalomalic acid (EXP)

4-phenylbutyric acid (EXP)

anthra[1,9-cd]pyrazol-6(2H)-one (EXP)

aristolochic acid (EXP)

arsenous acid (EXP)

bezafibrate (EXP)

bilirubin IXalpha (EXP)

bis(2-chloroethyl) sulfide (EXP)

bisphenol A (EXP)

cadmium atom (EXP)

cadmium dichloride (EXP)

cadmium selenide (EXP)

chloroquine (EXP)

cilastatin (EXP)

cisplatin (EXP)

deoxynivalenol (EXP)

dexamethasone (EXP)

diarsenic trioxide (EXP)

digitoxin (EXP)

dihydroartemisinin (EXP)

dihydroouabain (EXP)

disodium selenite (EXP)

elemental selenium (EXP)

fisetin (EXP)

flavones (EXP)

flavonol (EXP)

fumonisin B1 (EXP)

glycerol 2-phosphate (EXP)

hydrogen peroxide (EXP)

L-ascorbic acid (EXP)

lead(0) (EXP)

lead(2+) (EXP)

linoleic acid (EXP)

lipopolysaccharide (EXP)

melatonin (EXP)

N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine (EXP)

N-acetyl-L-cysteine (EXP)

ochratoxin A (EXP)

oleandrin (EXP)

ouabain (EXP)

p-xylene (EXP)

prostaglandin F2alpha (EXP)

resveratrol (EXP)

selenium atom (EXP)

T-2 toxin (EXP)

tacrolimus hydrate (EXP)

tert-butyl hydroperoxide (EXP)

toluene (EXP)

troglitazone (EXP)

Tylophorine (EXP)

zearalenone (EXP)

zinc acetate (EXP)

zinc sulfate (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

anterior neural tube closure (IEA,ISO)

apoptotic process (IBA,IEA,ISO)

apoptotic signaling pathway (IEA)

axonal fasciculation (ISO)

B cell homeostasis (IEA,ISO)

cell fate commitment (IEA,ISO)

cellular response to DNA damage stimulus (IEA,ISO)

cellular response to organic cyclic compound (ISO)

cellular response to organic substance (IEA,ISO)

cellular response to staurosporine (IEA)

epithelial cell apoptotic process (IEA,ISO)

erythrocyte differentiation (IBA,IEA)

execution phase of apoptosis (IEA,ISO)

extrinsic apoptotic signaling pathway (ISO)

fibroblast apoptotic process (IEA,ISO)

glial cell apoptotic process (IEA,ISO)

heart development (IEA,ISO)

hippocampus development (ISO)

intracellular signal transduction (ISO)

intrinsic apoptotic signaling pathway in response to osmotic stress (IEA)

keratinocyte differentiation (IBA,IEA,ISO)

learning or memory (ISO)

leukocyte apoptotic process (ISO)

luteolysis (ISO)

negative regulation of activated T cell proliferation (IEA,ISO)

negative regulation of apoptotic process (IEA,ISO)

negative regulation of B cell proliferation (IEA,ISO)

negative regulation of cell cycle (IEA,ISO)

negative regulation of cyclin-dependent protein serine/threonine kinase activity (IEA,ISO)

neuron apoptotic process (IEA,ISO)

neuron differentiation (IBA,ISO)

neurotrophin TRK receptor signaling pathway (IEA,ISO)

positive regulation of amyloid-beta formation (IEA,ISS)

positive regulation of apoptotic DNA fragmentation (ISO)

positive regulation of apoptotic process (IBA,IEA,ISO)

positive regulation of neuron apoptotic process (ISO)

protein catabolic process (ISO)

protein processing (IEA,ISO)

proteolysis (IEA,ISS)

regulation of protein stability (IEA,ISS)

response to amino acid (ISO)

response to antibiotic (ISO)

response to auditory stimulus (ISO)

response to cobalt ion (ISO)

response to estradiol (ISO)

response to glucocorticoid (ISO)

response to glucose (ISO)

response to hydrogen peroxide (ISO)

response to hypoxia (ISO)

response to lipopolysaccharide (ISO)

response to metal ion (ISO)

response to nicotine (ISO)

response to organic cyclic compound (ISO)

response to organic substance (IEA,ISO)

response to UV (IEA,ISO)

response to wounding (IEA,ISO)

response to X-ray (ISO)

response to xenobiotic stimulus (ISO)

sensory perception of sound (IEA,ISO)

striated muscle cell differentiation (ISO)

T cell homeostasis (IEA,ISO)

wound healing (ISO)

Cellular Component

caspase complex (ISO)

cytoplasm (IBA,IDA,IEA,ISO)

cytosol (IEA,ISO)

death-inducing signaling complex (ISO)

membrane raft (ISO)

neuronal cell body (ISO)

nucleus (IDA,IEA)

Molecular Function

aspartic-type endopeptidase activity (IEA)

cyclin-dependent protein serine/threonine kinase inhibitor activity (IEA)

cysteine-type endopeptidase activity (IEA)

cysteine-type endopeptidase activity involved in apoptotic process (IBA,IEA,ISS)

cysteine-type endopeptidase activity involved in apoptotic signaling pathway (IEA,ISS)

cysteine-type endopeptidase activity involved in execution phase of apoptosis (IEA)

cysteine-type peptidase activity (IEA,ISO)

death receptor binding (ISO)

endopeptidase activity (IEA,ISS)

hydrolase activity (IEA)

peptidase activity (IEA)

phospholipase A2 activator activity (ISO)

protease binding (ISO)

protein binding (IPI,ISO)

protein-containing complex binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

apoptotic cell death pathway (ISO)

extrinsic apoptotic pathway (ISO)

FasL mediated signaling pathway (ISO)

intrinsic apoptotic pathway (ISO)

syndecan signaling pathway (ISO)

titanium dioxide nanoparticle response pathway (ISO)

Trail mediated signaling pathway (ISO)

References

Additional References at PubMed

PMID:11440638	PMID:15609044	PMID:17268855	PMID:17437340	PMID:19283610	PMID:21151608	PMID:21732350	PMID:21887717	PMID:23313858	PMID:26436384

Genomics

Comparative Map Data

CASP3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	15	45,742,749 - 45,763,773 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	15	45,744,320 - 45,753,252 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	15	52,291,074 - 52,299,625 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CASP3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	4	184,627,696 - 184,649,447 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	4	184,627,696 - 184,649,509 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	4	185,548,850 - 185,570,601 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	4	185,785,844 - 185,807,623 (-)	NCBI	NCBI36		hg18	NCBI36
Build 34	4	185,923,999 - 185,945,750	NCBI
Celera	4	182,877,510 - 182,899,293 (-)	NCBI
Cytogenetic Map	4	q35.1	NCBI
HuRef	4	181,303,305 - 181,324,956 (-)	NCBI		HuRef
CHM1_1	4	185,525,377 - 185,547,156 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	4	187,971,378 - 187,993,131 (-)	NCBI

Casp3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	47,070,326 - 47,092,733 (+)	NCBI	GRCm39		mm39
GRCm39 Ensembl	8	47,070,326 - 47,092,724 (+)	Ensembl
GRCm38	8	46,617,291 - 46,639,698 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	46,617,291 - 46,639,689 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	8	47,702,803 - 47,724,071 (+)	NCBI	GRCm37		mm9	NCBIm37
MGSCv36	8	48,116,266 - 48,137,534 (+)	NCBI			mm8
Celera	8	49,300,031 - 49,321,270 (+)	NCBI		Celera
Cytogenetic Map	8	B1.1	NCBI
cM Map	8	26.39	NCBI

Casp3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	16	45,662,910 - 45,681,171 (-)	NCBI	mRatBN7.2
mRatBN7.2 Ensembl	16	45,662,910 - 45,684,648 (-)	Ensembl
Rnor_6.0	16	48,845,011 - 48,863,249 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	48,845,012 - 48,863,204 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	16	48,560,090 - 48,578,325 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	16	48,944,226 - 48,962,420 (-)	NCBI	RGSC3.4		rn4	RGSC3.4
RGSC_v3.1	16	48,944,301 - 48,962,495 (-)	NCBI
Celera	16	43,665,975 - 43,684,168 (-)	NCBI		Celera
Cytogenetic Map	16	q11	NCBI

Casp3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955403	24,315,712 - 24,326,271 (+)	NCBI	ChiLan1.0	ChiLan1.0

CASP3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	4	189,018,422 - 189,040,217 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	4	189,018,422 - 189,040,185 (-)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	4	176,793,190 - 176,815,023 (-)	NCBI	Mhudiblu_PPA_v0		panPan3

CASP3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	16	45,920,074 - 45,940,507 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	16	45,920,071 - 45,940,505 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	16	46,413,238 - 46,434,538 (+)	NCBI
ROS_Cfam_1.0	16	48,136,012 - 48,157,278 (+)	NCBI
ROS_Cfam_1.0 Ensembl	16	48,135,662 - 48,157,268 (+)	Ensembl
UMICH_Zoey_3.1	16	46,101,180 - 46,122,422 (+)	NCBI
UNSW_CanFamBas_1.0	16	46,715,535 - 46,736,806 (+)	NCBI
UU_Cfam_GSD_1.0	16	46,848,704 - 46,870,015 (+)	NCBI

Casp3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404943	33,516,817 - 33,538,924 (-)	NCBI
SpeTri2.0	NW_004936554	4,571,072 - 4,593,765 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CASP3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	7	130,589,592 - 130,610,845 (-)	NCBI	ChlSab1.1		chlSab2
ChlSab1.1 Ensembl	7	130,591,166 - 130,610,899 (-)	Ensembl	ChlSab1.1		chlSab2
Vero_WHO_p1.0	NW_023666037	110,841,187 - 110,862,527 (-)	NCBI	Vero_WHO_p1.0

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	hemolymphoid system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system
High
Medium	10	2	1	5		1	2	3	3
Low		2	2		2	22
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_214131	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB029345	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AEMK02000099	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK230496	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK389767	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CU915789	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	GBZA01000093	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	GFLN01007976	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSSSCT00000042090 ⟹ ENSSSCP00000049424

RefSeq Status:

Type:

CODING

Position:

Pig Assembly	Chr	Position (strand)	Source
Sscrofa11.1 Ensembl	15	45,742,749 - 45,751,203 (-)	Ensembl

RefSeq Acc Id:

ENSSSCT00000064876 ⟹ ENSSSCP00000038262

RefSeq Status:

Type:

CODING

Position:

Pig Assembly	Chr	Position (strand)	Source
Sscrofa11.1 Ensembl	15	45,742,752 - 45,763,750 (-)	Ensembl

RefSeq Acc Id:

ENSSSCT00000091301 ⟹ ENSSSCP00000067227

RefSeq Status:

Type:

CODING

Position:

Pig Assembly	Chr	Position (strand)	Source
Sscrofa11.1 Ensembl	15	45,742,761 - 45,763,773 (-)	Ensembl

RefSeq Acc Id:

NM_214131 ⟹ NP_999296

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Pig Assembly	Chr	Position (strand)	Source
Sscrofa11.1	15	45,744,320 - 45,753,252 (-)	NCBI

Sequence:

show sequence

ATGGAGAACAATAAAACCTCCGTGGATTCAAAATCCATTAAAACTTTGGAGACAAAGATCTTAC
ATGGAAGCAAATCAATGGACTCTGGAATATCCTTGGATGTCAGTTACAAAATGGATTATCCTGA
AATGGGTTTATGTATAATAATTAATAATAAGAACTTTGATAAAAATACCGGAATGGCATGTCGA
TCTGGTACAGATGTGGATGCTGCAAATCTCAGGGAGACCTTCACAAACTTGAAATATGAAGTCA
GGAATAAAAATGATCTTACACGTGAAGAAATTTTGGAGTTAATGCACAGTGTTTCTAAAGAAGA
CCATAGCAAAAGGAGCAGTTTTATTTGCGTGCTTCTAAGCCATGGTGAAGAAGGAAAAATTTTT
GGAACAAATGGACCTGTTGATCTGAAAAAATTAACAAGTTTCTTCAGAGGGGACTGCTGTAGAA
CTCTAACTGGCAAACCCAAACTTTTCATAATTCAGGCCTGCCGAGGCACAGAATTGGACTGTGG
GATTGAGACGGACAGTGGGACTGAAGATGACATGGCGTGTCAGAAAATACCAGTTGAGGCAGAC
TTCTTGTATGCATATTCTACAGCACCTGGTTACTATTCCTGGCGAAATTCAAAGGACGGATCCT
GGTTCATCCAGTCACTTTGTGCAGCGCTGAAACAGTATGTTCACAAGCTTGAGCTTATGCACAT
TCTTACTCGGGTTAACCGAAAGGTAGCAGTAGAATTCGAGTCCTTTTCTACTGACTCTACTTTT
CATGCAAAGAAACAGATTCCATGTATTGTGTCCATGCTCACAAAAGAACTCTACTTTTATCACT
AG

hide sequence

Protein Sequences


Protein RefSeqs	NP_999296	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	BAB55544	(Get FASTA)	NCBI Sequence Viewer
	JAG69675	(Get FASTA)	NCBI Sequence Viewer
	Q95ND5	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:

NP_999296 ⟸ NM_214131

- UniProtKB:

Q95ND5 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MENNKTSVDSKSIKTLETKILHGSKSMDSGISLDVSYKMDYPEMGLCIIINNKNFDKNTGMACR
SGTDVDAANLRETFTNLKYEVRNKNDLTREEILELMHSVSKEDHSKRSSFICVLLSHGEEGKIF
GTNGPVDLKKLTSFFRGDCCRTLTGKPKLFIIQACRGTELDCGIETDSGTEDDMACQKIPVEAD
FLYAYSTAPGYYSWRNSKDGSWFIQSLCAALKQYVHKLELMHILTRVNRKVAVEFESFSTDSTF
HAKKQIPCIVSMLTKELYFYH

hide sequence

RefSeq Acc Id:

ENSSSCP00000038262 ⟸ ENSSSCT00000064876

RefSeq Acc Id:

ENSSSCP00000067227 ⟸ ENSSSCT00000091301

RefSeq Acc Id:

ENSSSCP00000049424 ⟸ ENSSSCT00000042090

Protein Domains

CASPASE_P10 CASPASE_P20

Additional Information

External Database Links

Database	Acc Id	Source(s)
Ensembl Genes	ENSSSCG00000034012	Ensembl, UniProtKB/TrEMBL
Ensembl Protein	ENSSSCP00000038262	UniProtKB/TrEMBL
	ENSSSCP00000049424	UniProtKB/TrEMBL
	ENSSSCP00000067227	UniProtKB/TrEMBL
Ensembl Transcript	ENSSSCT00000042090	UniProtKB/TrEMBL
	ENSSSCT00000064876	UniProtKB/TrEMBL
	ENSSSCT00000091301	UniProtKB/TrEMBL
InterPro	Casp3/7	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Caspase-like_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Caspase_cys_AS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Caspase_his_AS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Pept_C14	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Pept_C14_p10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Pept_C14_p20	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Pept_C14A	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	ssc:397244	UniProtKB/Swiss-Prot
NCBI Gene	CASP3	ENTREZGENE
PANTHER	PTHR10454	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR10454:SF31	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PRINTS	IL1BCENZYME	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	CASPASE_CYS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	CASPASE_HIS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	CASPASE_P10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	CASPASE_P20	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SMART	CASc	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF52129	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A287A3E4_PIG	UniProtKB/TrEMBL
	A0A287AZZ1_PIG	UniProtKB/TrEMBL
	A0A5G2QQP0_PIG	UniProtKB/TrEMBL
	CASP3_PIG	UniProtKB/Swiss-Prot, ENTREZGENE
VGNC ID	VGNC:103911	ENTREZGENE

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - CTD

RGD Manual Annotations

Imported Annotations - PID (archival)

Send us a Message

Imported Disease Annotations - CTD

RGD Manual Annotations

Imported Annotations - PID (archival)