Symbol:
Grip1
Name:
glutamate receptor interacting protein 1
RGD ID:
621667
Description:
Enables GTPase binding activity; PDZ domain binding activity; and ionotropic glutamate receptor binding activity. Involved in several processes, including nervous system development; positive regulation of cell projection organization; and regulation of neurotransmitter receptor activity. Located in several cellular components, including dendrite; spine synapse; and synaptic membrane. Part of exocyst. Is active in glutamatergic synapse and postsynaptic density. Human ortholog(s) of this gene implicated in Fraser syndrome 3. Orthologous to human GRIP1 (glutamate receptor interacting protein 1); INTERACTS WITH 2,2',4,4'-Tetrabromodiphenyl ether; 2,3,7,8-Tetrachlorodibenzofuran; 2,3-Dioxo-6-nitro-7-sulfamoylbenzo(f)quinoxaline.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
AMPA receptor-interacting protein GRIP1; Glutamate receptor interacting protein; glutamate receptor-interacting protein 1; GRIP-1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 56,820,501 - 57,477,877 (+) NCBI GRCr8 mRatBN7.2 7 54,934,856 - 55,592,274 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 54,934,250 - 55,592,273 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 57,218,667 - 57,489,247 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 59,421,818 - 59,692,413 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 59,199,652 - 59,469,780 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 64,672,723 - 64,854,939 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 64,672,722 - 64,864,404 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 64,890,319 - 65,072,097 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 59,157,276 - 59,306,131 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 59,170,845 - 59,326,858 (+) NCBI Celera 7 52,073,046 - 52,340,208 (+) NCBI Celera Cytogenetic Map 7 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Grip1 Rat 1,2-dimethylhydrazine decreases expression ISO Grip1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of GRIP1 mRNA CTD PMID:22206623 Grip1 Rat 17beta-estradiol affects response to substance ISO GRIP1 (Homo sapiens) 6480464 GRIP1 gene SNP affects the susceptibility to Estradiol CTD PMID:25622337 Grip1 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression EXP 6480464 2 more ... CTD PMID:27291303 Grip1 Rat 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO Grip1 (Mus musculus) 6480464 2 more ... CTD PMID:31388691 Grip1 Rat 2,3,4,5-tetrachlorophenol affects response to substance ISO GRIP1 (Homo sapiens) 6480464 GRIP1 gene SNP affects the susceptibility to 2 more ... CTD PMID:25622337 Grip1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Grip1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of GRIP1 mRNA CTD PMID:21570461 Grip1 Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:32109520 Grip1 Rat 2,3-Dioxo-6-nitro-7-sulfamoylbenzo(f)quinoxaline multiple interactions EXP 6480464 2 and 3-dioxo-6-nitro-7-sulfamoylbenzo(f)quinoxaline inhibits the reaction [perfluorooctane sulfonic acid results in decreased expression of GRIP1 mRNA] CTD PMID:30508566 Grip1 Rat 2-hydroxypropanoic acid increases expression ISO GRIP1 (Homo sapiens) 6480464 Lactic Acid results in increased expression of GRIP1 mRNA CTD PMID:30851411 Grip1 Rat 3,3',4,4',5-pentachlorobiphenyl increases expression EXP 6480464 3 more ... CTD PMID:23196670 Grip1 Rat 3-Chloro-4-(dichloromethyl)-5-hydroxy-2(5H)-furanone affects response to substance ISO GRIP1 (Homo sapiens) 6480464 GRIP1 gene SNP affects the susceptibility to 3-chloro-4-(dichloromethyl)-5-hydroxy-2(5H)-furanone CTD PMID:25622337 Grip1 Rat 4,4'-sulfonyldiphenol increases methylation ISO GRIP1 (Homo sapiens) 6480464 bisphenol S results in increased methylation of GRIP1 gene CTD PMID:31601247 Grip1 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of GRIP1 mRNA CTD PMID:24780913 Grip1 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of GRIP1 mRNA CTD PMID:30047161 Grip1 Rat acetohydrazide decreases expression ISO Grip1 (Mus musculus) 6480464 acetylhydrazine results in decreased expression of GRIP1 mRNA CTD PMID:15282401 Grip1 Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of GRIP1 mRNA CTD PMID:28959563 Grip1 Rat aflatoxin B1 increases methylation ISO GRIP1 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of GRIP1 intron CTD PMID:30157460 Grip1 Rat amiloride affects response to substance ISO GRIP1 (Homo sapiens) 6480464 GRIP1 gene SNP affects the susceptibility to Amiloride CTD PMID:25622337 Grip1 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of GRIP1 mRNA CTD PMID:30047161 Grip1 Rat androgen antagonist multiple interactions EXP 6480464 [bisphenol A co-treated with enzacamene co-treated with octylmethoxycinnamate co-treated with butylparaben co-treated with Androgen Antagonists co-treated with Acetaminophen] results in decreased expression of GRIP1 mRNA CTD PMID:25607892 Grip1 Rat aristolochic acid A decreases expression ISO GRIP1 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of GRIP1 mRNA CTD PMID:33212167 Grip1 Rat arsenite(3-) increases expression ISO Grip1 (Mus musculus) 6480464 arsenite results in increased expression of GRIP1 mRNA CTD PMID:33053406 Grip1 Rat benzo[a]pyrene decreases expression ISO Grip1 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of GRIP1 mRNA CTD PMID:22228805 Grip1 Rat benzo[a]pyrene decreases methylation ISO GRIP1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of GRIP1 exon CTD PMID:27901495 Grip1 Rat benzo[a]pyrene affects methylation ISO GRIP1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of GRIP1 promoter CTD PMID:27901495 Grip1 Rat benzo[a]pyrene affects methylation ISO Grip1 (Mus musculus) 6480464 Benzo(a)pyrene affects the methylation of GRIP1 intron CTD PMID:27901495 Grip1 Rat benzo[a]pyrene increases expression ISO Grip1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of GRIP1 mRNA CTD PMID:23735875 Grip1 Rat bis(2-ethylhexyl) phthalate multiple interactions EXP 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with vinclozolin co-treated with prochloraz co-treated with procymidone co-treated with Linuron co-treated with epoxiconazole co-treated with Dichlorodiphenyl Dichloroethylene] results in decreased expression of GRIP1 mRNA CTD PMID:25607892 Grip1 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with enzacamene co-treated with octylmethoxycinnamate co-treated with butylparaben co-treated with Androgen Antagonists co-treated with Acetaminophen] results in decreased expression of GRIP1 mRNA CTD PMID:25607892 Grip1 Rat bisphenol A increases expression ISO Grip1 (Mus musculus) 6480464 bisphenol A results in increased expression of GRIP1 mRNA CTD PMID:32156529 Grip1 Rat bisphenol A increases expression ISO GRIP1 (Homo sapiens) 6480464 bisphenol A results in increased expression of GRIP1 protein CTD PMID:30953815 Grip1 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of GRIP1 mRNA CTD PMID:30816183 Grip1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of GRIP1 mRNA CTD PMID:25181051 and PMID:34947998 Grip1 Rat butanal decreases expression ISO GRIP1 (Homo sapiens) 6480464 butyraldehyde results in decreased expression of GRIP1 mRNA CTD PMID:26079696 Grip1 Rat Butylparaben multiple interactions EXP 6480464 [bisphenol A co-treated with enzacamene co-treated with octylmethoxycinnamate co-treated with butylparaben co-treated with Androgen Antagonists co-treated with Acetaminophen] results in decreased expression of GRIP1 mRNA CTD PMID:25607892 Grip1 Rat cadmium atom multiple interactions ISO GRIP1 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of GRIP1 mRNA CTD PMID:35301059 Grip1 Rat cadmium dichloride multiple interactions ISO GRIP1 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of GRIP1 mRNA CTD PMID:35301059 Grip1 Rat cannabidiol decreases methylation ISO Grip1 (Mus musculus) 6480464 Cannabidiol results in decreased methylation of GRIP1 gene CTD PMID:33407853 Grip1 Rat CGP 52608 multiple interactions ISO GRIP1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to GRIP1 gene] CTD PMID:28238834 Grip1 Rat chlorpyrifos decreases expression ISO Grip1 (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of GRIP1 mRNA CTD PMID:37019170 Grip1 Rat choline multiple interactions ISO Grip1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of GRIP1 gene CTD PMID:20938992 Grip1 Rat cisplatin multiple interactions ISO GRIP1 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of GRIP1 mRNA CTD PMID:27392435 Grip1 Rat cisplatin decreases expression ISO GRIP1 (Homo sapiens) 6480464 Cisplatin results in decreased expression of GRIP1 mRNA CTD PMID:27392435 and PMID:27594783 Grip1 Rat cocaine increases phosphorylation EXP 6480464 Cocaine results in increased phosphorylation of GRIP1 protein CTD PMID:19439608 Grip1 Rat cocaine multiple interactions ISO Grip1 (Mus musculus) 6480464 [Cocaine co-treated with FOS protein mutant form] results in increased expression of GRIP1 mRNA CTD PMID:18355967 Grip1 Rat coumarin affects phosphorylation ISO GRIP1 (Homo sapiens) 6480464 coumarin affects the phosphorylation of GRIP1 protein CTD PMID:35688186 Grip1 Rat crocidolite asbestos affects expression ISO GRIP1 (Homo sapiens) 6480464 Asbestos and Crocidolite affects the expression of GRIP1 mRNA CTD PMID:17331233 Grip1 Rat DDE multiple interactions EXP 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with vinclozolin co-treated with prochloraz co-treated with procymidone co-treated with Linuron co-treated with epoxiconazole co-treated with Dichlorodiphenyl Dichloroethylene] results in decreased expression of GRIP1 mRNA CTD PMID:25607892 Grip1 Rat DDE decreases expression ISO GRIP1 (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of GRIP1 mRNA CTD PMID:38568856 Grip1 Rat dibutyl phthalate multiple interactions EXP 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with vinclozolin co-treated with prochloraz co-treated with procymidone co-treated with Linuron co-treated with epoxiconazole co-treated with Dichlorodiphenyl Dichloroethylene] results in decreased expression of GRIP1 mRNA CTD PMID:25607892 Grip1 Rat doxorubicin affects expression ISO GRIP1 (Homo sapiens) 6480464 Doxorubicin affects the expression of GRIP1 mRNA CTD PMID:29803840 Grip1 Rat entinostat decreases expression ISO GRIP1 (Homo sapiens) 6480464 entinostat results in decreased expression of GRIP1 mRNA CTD PMID:27188386 Grip1 Rat enzacamene multiple interactions EXP 6480464 [bisphenol A co-treated with enzacamene co-treated with octylmethoxycinnamate co-treated with butylparaben co-treated with Androgen Antagonists co-treated with Acetaminophen] results in decreased expression of GRIP1 mRNA CTD PMID:25607892 Grip1 Rat epoxiconazole multiple interactions EXP 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with vinclozolin co-treated with prochloraz co-treated with procymidone co-treated with Linuron co-treated with epoxiconazole co-treated with Dichlorodiphenyl Dichloroethylene] results in decreased expression of GRIP1 mRNA CTD PMID:25607892 Grip1 Rat ethanol affects expression EXP 6480464 Ethanol affects the expression of GRIP1 mRNA CTD PMID:11772933 Grip1 Rat ethanol decreases expression EXP 6480464 Ethanol results in decreased expression of GRIP1 mRNA CTD PMID:20655511 Grip1 Rat folic acid multiple interactions ISO Grip1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of GRIP1 gene CTD PMID:20938992 Grip1 Rat folic acid decreases expression ISO Grip1 (Mus musculus) 6480464 Folic Acid results in decreased expression of GRIP1 mRNA CTD PMID:25629700 Grip1 Rat FR900359 increases phosphorylation ISO GRIP1 (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of GRIP1 protein CTD PMID:37730182 Grip1 Rat genistein increases expression ISO Grip1 (Mus musculus) 6480464 Genistein results in increased expression of GRIP1 mRNA CTD PMID:32186404 Grip1 Rat L-methionine multiple interactions ISO Grip1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of GRIP1 gene CTD PMID:20938992 Grip1 Rat linuron multiple interactions EXP 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with vinclozolin co-treated with prochloraz co-treated with procymidone co-treated with Linuron co-treated with epoxiconazole co-treated with Dichlorodiphenyl Dichloroethylene] results in decreased expression of GRIP1 mRNA CTD PMID:25607892 Grip1 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of GRIP1 mRNA CTD PMID:30047161 Grip1 Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal increases expression ISO Grip1 (Mus musculus) 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in increased expression of GRIP1 mRNA CTD PMID:25566086 Grip1 Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal multiple interactions ISO GRIP1 (Homo sapiens) 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde inhibits the reaction [GRIP1 protein binds to NR1I3 protein] CTD PMID:24224465 Grip1 Rat O-methyleugenol decreases expression ISO GRIP1 (Homo sapiens) 6480464 methyleugenol results in decreased expression of GRIP1 mRNA CTD PMID:32234424 Grip1 Rat ozone multiple interactions ISO Grip1 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of GRIP1 mRNA CTD PMID:34911549 Grip1 Rat paracetamol multiple interactions EXP 6480464 [bisphenol A co-treated with enzacamene co-treated with octylmethoxycinnamate co-treated with butylparaben co-treated with Androgen Antagonists co-treated with Acetaminophen] results in decreased expression of GRIP1 mRNA CTD PMID:25607892 Grip1 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of GRIP1 mRNA CTD PMID:33387578 Grip1 Rat perfluorooctane-1-sulfonic acid multiple interactions EXP 6480464 2 and 3-dioxo-6-nitro-7-sulfamoylbenzo(f)quinoxaline inhibits the reaction [perfluorooctane sulfonic acid results in decreased expression of GRIP1 mRNA] CTD PMID:30508566 Grip1 Rat perfluorooctane-1-sulfonic acid decreases expression EXP 6480464 perfluorooctane sulfonic acid results in decreased expression of GRIP1 mRNA CTD PMID:30508566 Grip1 Rat phenobarbital decreases expression EXP 6480464 Phenobarbital results in decreased expression of GRIP1 mRNA CTD PMID:30047161 Grip1 Rat pirinixic acid multiple interactions ISO GRIP1 (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in increased expression of GRIP1 mRNA CTD PMID:19710929 Grip1 Rat PK-11195 multiple interactions ISO GRIP1 (Homo sapiens) 6480464 PK 11195 inhibits the reaction [GRIP1 protein binds to NR1I3 protein] CTD PMID:24224465 Grip1 Rat potassium chromate increases expression ISO GRIP1 (Homo sapiens) 6480464 potassium chromate(VI) results in increased expression of GRIP1 mRNA CTD PMID:22714537 Grip1 Rat prochloraz multiple interactions EXP 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with vinclozolin co-treated with prochloraz co-treated with procymidone co-treated with Linuron co-treated with epoxiconazole co-treated with Dichlorodiphenyl Dichloroethylene] results in decreased expression of GRIP1 mRNA CTD PMID:25607892 Grip1 Rat procymidone multiple interactions EXP 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with vinclozolin co-treated with prochloraz co-treated with procymidone co-treated with Linuron co-treated with epoxiconazole co-treated with Dichlorodiphenyl Dichloroethylene] results in decreased expression of GRIP1 mRNA CTD PMID:25607892 Grip1 Rat rac-lactic acid increases expression ISO GRIP1 (Homo sapiens) 6480464 Lactic Acid results in increased expression of GRIP1 mRNA CTD PMID:30851411 Grip1 Rat sulfadimethoxine decreases expression EXP 6480464 Sulfadimethoxine results in decreased expression of GRIP1 mRNA CTD PMID:30047161 Grip1 Rat valproic acid affects expression ISO Grip1 (Mus musculus) 6480464 Valproic Acid affects the expression of GRIP1 mRNA CTD PMID:17292431 Grip1 Rat valproic acid decreases palmitoylation ISO Grip1 (Mus musculus) 6480464 Valproic Acid results in decreased palmitoylation of GRIP1 protein CTD PMID:26348896 Grip1 Rat valproic acid decreases expression ISO GRIP1 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of GRIP1 mRNA CTD PMID:23179753 and PMID:27188386 Grip1 Rat valproic acid affects expression ISO GRIP1 (Homo sapiens) 6480464 Valproic Acid affects the expression of GRIP1 mRNA CTD PMID:25979313 Grip1 Rat vinclozolin multiple interactions EXP 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with vinclozolin co-treated with prochloraz co-treated with procymidone co-treated with Linuron co-treated with epoxiconazole co-treated with Dichlorodiphenyl Dichloroethylene] results in decreased expression of GRIP1 mRNA CTD PMID:25607892 Grip1 Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of GRIP1 mRNA CTD PMID:19015723 Grip1 Rat vinclozolin increases methylation EXP 6480464 vinclozolin results in increased methylation of GRIP1 gene CTD PMID:31079544
1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,4,5-tetrachlorophenol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2,3-Dioxo-6-nitro-7-sulfamoylbenzo(f)quinoxaline (EXP) 2-hydroxypropanoic acid (ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP) 3-Chloro-4-(dichloromethyl)-5-hydroxy-2(5H)-furanone (ISO) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) acetohydrazide (ISO) acrylamide (EXP) aflatoxin B1 (ISO) amiloride (ISO) amitrole (EXP) androgen antagonist (EXP) aristolochic acid A (ISO) arsenite(3-) (ISO) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (EXP) bisphenol A (EXP,ISO) butanal (ISO) Butylparaben (EXP) cadmium atom (ISO) cadmium dichloride (ISO) cannabidiol (ISO) CGP 52608 (ISO) chlorpyrifos (ISO) choline (ISO) cisplatin (ISO) cocaine (EXP,ISO) coumarin (ISO) crocidolite asbestos (ISO) DDE (EXP,ISO) dibutyl phthalate (EXP) doxorubicin (ISO) entinostat (ISO) enzacamene (EXP) epoxiconazole (EXP) ethanol (EXP) folic acid (ISO) FR900359 (ISO) genistein (ISO) L-methionine (ISO) linuron (EXP) methimazole (EXP) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO) O-methyleugenol (ISO) ozone (ISO) paracetamol (EXP) perfluorooctane-1-sulfonic acid (EXP) phenobarbital (EXP) pirinixic acid (ISO) PK-11195 (ISO) potassium chromate (ISO) prochloraz (EXP) procymidone (EXP) rac-lactic acid (ISO) sulfadimethoxine (EXP) valproic acid (ISO) vinclozolin (EXP)
1.
Postsynaptic ephrinB3 promotes shaft glutamatergic synapse formation.
Aoto J, etal., J Neurosci. 2007 Jul 11;27(28):7508-19. doi: 10.1523/JNEUROSCI.0705-07.2007.
2.
A novel Wnt5a-Frizzled4 signaling pathway mediates activity-independent dendrite morphogenesis via the distal PDZ motif of Frizzled 4.
Bian WJ, etal., Dev Neurobiol. 2015 Aug;75(8):805-22. doi: 10.1002/dneu.22250. Epub 2014 Dec 1.
3.
PIKE-mediated PI3-kinase activity is required for AMPA receptor surface expression.
Chan CB, etal., EMBO J. 2011 Aug 16;30(20):4274-86. doi: 10.1038/emboj.2011.281.
4.
A four PDZ domain-containing splice variant form of GRIP1 is localized in GABAergic and glutamatergic synapses in the brain.
Charych EI, etal., J Biol Chem. 2004 Sep 10;279(37):38978-90. doi: 10.1074/jbc.M405786200. Epub 2004 Jun 29.
5.
Identification and characterization of two novel splice forms of GRIP1 in the rat brain.
Charych EI, etal., J Neurochem. 2006 May;97(3):884-98. doi: 10.1111/j.1471-4159.2006.03795.x. Epub 2006 Mar 15.
6.
Phosphorylation of the AMPA receptor subunit GluR2 differentially regulates its interaction with PDZ domain-containing proteins.
Chung HJ, etal., J Neurosci. 2000 Oct 1;20(19):7258-67.
7.
Differential palmitoylation directs the AMPA receptor-binding protein ABP to spines or to intracellular clusters.
DeSouza S, etal., J Neurosci 2002 May 1;22(9):3493-503.
8.
Characterization of the glutamate receptor-interacting proteins GRIP1 and GRIP2.
Dong H, etal., J Neurosci 1999 Aug 15;19(16):6930-41.
9.
GRIP: a synaptic PDZ domain-containing protein that interacts with AMPA receptors.
Dong H, etal., Nature 1997 Mar 20;386(6622):279-84.
10.
PDZ7 of glutamate receptor interacting protein binds to its target via a novel hydrophobic surface area.
Feng W, etal., J Biol Chem 2002 Oct 25;277(43):41140-6.
11.
Association of the AMPA receptor-related postsynaptic density proteins GRIP and ABP with subsets of glutamate-sensitive neurons in the rat retina.
Gabriel R, etal., J Comp Neurol 2002 Jul 22;449(2):129-40.
12.
Activity-dependent synaptic GRIP1 accumulation drives synaptic scaling up in response to action potential blockade.
Gainey MA, etal., Proc Natl Acad Sci U S A. 2015 Jul 7;112(27):E3590-9. doi: 10.1073/pnas.1510754112. Epub 2015 Jun 24.
13.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
14.
Glutamate stimulates glutamate receptor interacting protein 1 degradation by ubiquitin-proteasome system to regulate surface expression of GluR2.
Guo L and Wang Y, Neuroscience. 2007 Mar 2;145(1):100-9. doi: 10.1016/j.neuroscience.2006.11.042. Epub 2007 Jan 3.
15.
The PDZ proteins PICK1, GRIP, and syntenin bind multiple glutamate receptor subtypes. Analysis of PDZ binding motifs.
Hirbec H, etal., J Biol Chem. 2002 May 3;277(18):15221-4. Epub 2002 Mar 12.
16.
Rapid and differential regulation of AMPA and kainate receptors at hippocampal mossy fibre synapses by PICK1 and GRIP.
Hirbec H, etal., Neuron. 2003 Feb 20;37(4):625-38. doi: 10.1016/s0896-6273(02)01191-1.
17.
CASK associates with glutamate receptor interacting protein and signaling molecules.
Hong CJ and Hsueh YP, Biochem Biophys Res Commun. 2006 Dec 22;351(3):771-6. Epub 2006 Oct 30.
18.
GRIP1 controls dendrite morphogenesis by regulating EphB receptor trafficking.
Hoogenraad CC, etal., Nat Neurosci. 2005 Jul;8(7):906-15. doi: 10.1038/nn1487.
19.
Roles that nurses in the community can play in nursing research.
Johnson MN and Okunade AO, Int Nurs Rev. 1975 Sep-Oct;22(5):147-9.
20.
Acute BDNF treatment upregulates GluR1-SAP97 and GluR2-GRIP1 interactions: implications for sustained AMPA receptor expression.
Jourdi H and Kabbaj M, PLoS One. 2013;8(2):e57124. doi: 10.1371/journal.pone.0057124. Epub 2013 Feb 27.
21.
Brain-derived neurotrophic factor signal enhances and maintains the expression of AMPA receptor-associated PDZ proteins in developing cortical neurons.
Jourdi H, etal., Dev Biol. 2003 Nov 15;263(2):216-30. doi: 10.1016/j.ydbio.2003.07.008.
22.
The GIT family of proteins forms multimers and associates with the presynaptic cytomatrix protein Piccolo.
Kim S, etal., J Biol Chem. 2003 Feb 21;278(8):6291-300. Epub 2002 Dec 6.
23.
Interaction between liprin-alpha and GIT1 is required for AMPA receptor targeting.
Ko J, etal., J Neurosci. 2003 Mar 1;23(5):1667-77.
24.
CIPP, a novel multivalent PDZ domain protein, selectively interacts with Kir4.0 family members, NMDA receptor subunits, neurexins, and neuroligins.
Kurschner C, etal., Mol Cell Neurosci. 1998 Jun;11(3):161-72.
25.
GRIP1 in GABAergic synapses.
Li RW, etal., J Comp Neurol. 2005 Jul 18;488(1):11-27.
26.
PICK1 interacts with ABP/GRIP to regulate AMPA receptor trafficking.
Lu W and Ziff EB, Neuron. 2005 Aug 4;47(3):407-21.
27.
GRIP1 and 2 regulate activity-dependent AMPA receptor recycling via exocyst complex interactions.
Mao L, etal., Proc Natl Acad Sci U S A. 2010 Nov 2;107(44):19038-43. doi: 10.1073/pnas.1013494107. Epub 2010 Oct 18.
28.
NMDA receptor activation potentiates inhibitory transmission through GABA receptor-associated protein-dependent exocytosis of GABA(A) receptors.
Marsden KC, etal., J Neurosci. 2007 Dec 26;27(52):14326-37.
29.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
30.
Generation of lentiviral transgenic rats expressing glutamate receptor interacting protein 1 (GRIP1) in brain, spinal cord and testis.
Nakagawa T, etal., J Neurosci Methods. 2006 Apr 15;152(1-2):1-9. doi: 10.1016/j.jneumeth.2005.08.001. Epub 2005 Sep 12.
31.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
32.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
33.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
34.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
35.
Novel anchorage of GluR2/3 to the postsynaptic density by the AMPA receptor-binding protein ABP.
Srivastava S, etal., Neuron 1998 Sep;21(3):581-91.
36.
Interactions between NEEP21, GRIP1 and GluR2 regulate sorting and recycling of the glutamate receptor subunit GluR2.
Steiner P, etal., EMBO J. 2005 Aug 17;24(16):2873-84. Epub 2005 Jul 21.
37.
GRIP1 is required for homeostatic regulation of AMPAR trafficking.
Tan HL, etal., Proc Natl Acad Sci U S A. 2015 Aug 11;112(32):10026-31. doi: 10.1073/pnas.1512786112. Epub 2015 Jul 27.
38.
Ribosomal S6 kinase 2 interacts with and phosphorylates PDZ domain-containing proteins and regulates AMPA receptor transmission.
Thomas GM, etal., Proc Natl Acad Sci U S A. 2005 Oct 18;102(42):15006-11. Epub 2005 Oct 10.
39.
Interaction between GRIP and liprin-alpha/SYD2 is required for AMPA receptor targeting.
Wyszynski M, etal., Neuron 2002 Mar 28;34(1):39-52.
40.
GRASP-1: a neuronal RasGEF associated with the AMPA receptor/GRIP complex.
Ye B, etal., Neuron 2000 Jun;26(3):603-17.
41.
Gephyrin interacts with the glutamate receptor interacting protein 1 isoforms at GABAergic synapses.
Yu W, etal., J Neurochem. 2008 Jun 1;105(6):2300-14. doi: 10.1111/j.1471-4159.2008.05311.x.
42.
The AAA+ ATPase Thorase regulates AMPA receptor-dependent synaptic plasticity and behavior.
Zhang J, etal., Cell. 2011 Apr 15;145(2):284-99. doi: 10.1016/j.cell.2011.03.016.
Grip1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 56,820,501 - 57,477,877 (+) NCBI GRCr8 mRatBN7.2 7 54,934,856 - 55,592,274 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 54,934,250 - 55,592,273 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 57,218,667 - 57,489,247 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 59,421,818 - 59,692,413 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 59,199,652 - 59,469,780 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 64,672,723 - 64,854,939 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 64,672,722 - 64,864,404 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 64,890,319 - 65,072,097 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 59,157,276 - 59,306,131 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 59,170,845 - 59,326,858 (+) NCBI Celera 7 52,073,046 - 52,340,208 (+) NCBI Celera Cytogenetic Map 7 q22 NCBI
GRIP1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 12 66,347,431 - 67,069,338 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 12 66,347,431 - 67,069,162 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 12 66,741,211 - 67,463,118 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 12 65,029,066 - 65,359,020 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 12 65,028,871 - 65,145,401 NCBI Celera 12 66,405,432 - 66,737,052 (-) NCBI Celera Cytogenetic Map 12 q14.3 NCBI HuRef 12 63,792,018 - 64,123,720 (-) NCBI HuRef CHM1_1 12 66,708,221 - 67,039,968 (-) NCBI CHM1_1 T2T-CHM13v2.0 12 66,326,883 - 67,048,770 (-) NCBI T2T-CHM13v2.0
Grip1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 10 119,289,810 - 119,923,172 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 10 119,289,735 - 119,923,166 (+) Ensembl GRCm39 Ensembl GRCm38 10 119,453,238 - 120,087,267 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 10 119,453,830 - 120,087,261 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 10 118,891,370 - 119,512,653 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 10 118,857,374 - 119,478,657 (+) NCBI MGSCv36 mm8 Celera 10 121,814,033 - 122,436,941 (+) NCBI Celera Cytogenetic Map 10 D2 NCBI cM Map 10 67.33 NCBI
Grip1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955458 12,967,089 - 13,214,838 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955458 12,970,858 - 13,179,369 (-) NCBI ChiLan1.0 ChiLan1.0
GRIP1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 10 27,286,061 - 28,012,479 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 12 27,282,825 - 28,004,487 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 12 21,841,611 - 22,562,418 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 12 22,826,257 - 23,069,480 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 12 22,744,177 - 23,069,480 (+) Ensembl panpan1.1 panPan2
GRIP1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 10 8,801,023 - 9,187,684 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 10 8,802,529 - 9,063,848 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 10 8,731,329 - 9,389,361 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 10 8,912,752 - 9,572,589 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 10 8,914,210 - 9,176,615 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 10 8,789,226 - 9,449,620 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 10 9,034,586 - 9,695,263 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 10 9,155,858 - 9,816,627 (-) NCBI UU_Cfam_GSD_1.0
Grip1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404945 49,107,221 - 49,757,054 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936545 4,353,040 - 5,002,725 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936545 4,353,056 - 4,606,196 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
GRIP1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 5 30,697,040 - 31,020,901 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 5 30,697,018 - 31,175,412 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 5 33,972,164 - 34,714,229 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
GRIP1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 11 62,018,037 - 62,464,440 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 11 62,015,463 - 62,335,876 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666037 182,985,387 - 183,705,463 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Grip1
.
Assembly: mRatBN7.2
Chromosome Start Pos End Pos Reference Nucleotide Variant Nucleotide Variant Type Strain Variant Page
7
55589880
55589881
G
C
snv
European Variation Archive Release 3 , FXLE25/StmMcwi (2023), European Variation Archive Release 6, FXLE12/StmMcwi (2023), BUF/N (2020), FXLE18/Stm (2020), LEXF11/Stm (2020), LEXF1C/Stm (2019), LEXF4/Stm (2020), LE/Stm (2019), FXLE12/StmMcwi (2021), FXLE12/Stm (2019NG), FXLE20/Stm (2019NG), FXLE23/Stm (2022), FXLE25/Stm (2022), LEXF1C/StmMcwi (2021), LEXF2A/Stm (2022), LEXF5/Stm (2019NG), LEXF7C/StmMcwi (2022), LEXF8A/StmMcwi (2021), LEXF8D/Stm (2022), LEXF2A/StmMcwi (2023), LEXF5/StmMcwi (2023), FXLE20/StmMcwi (2023), LEXF8D/StmMcwi (2023), FXLE23/StmMcwi (2023), European Variation Archive Release 4 View more Information
Predicted Target Of
Count of predictions: 195 Count of miRNA genes: 111 Interacting mature miRNAs: 139 Transcripts: ENSRNOT00000005539, ENSRNOT00000005545, ENSRNOT00000064448 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
7411569 Bw137 Body weight QTL 137 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 7 21921195 66921195 Rat 1300179 Kidm5 Kidney mass QTL 5 3.51 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 7 43747012 135012528 Rat 2293667 Bss42 Bone structure and strength QTL 42 7.25 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 7 47651439 92651439 Rat 10053722 Scort27 Serum corticosterone level QTL 27 2.41 0.0083 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 7 43228750 88228750 Rat 1578652 Bmd15 Bone mineral density QTL 15 5.2 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 7 9866467 60460686 Rat 1641885 Alcrsp9 Alcohol response QTL 9 alcohol metabolism trait (VT:0015089) blood ethanol level (CMO:0000535) 7 24099606 69099606 Rat 1549840 Bss5 Bone structure and strength QTL 5 9.8 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 7 24751841 69751841 Rat 1300127 Srn1 Serum renin concentration QTL 1 3.87 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 7 29409683 84928080 Rat 10059605 Kidm47 Kidney mass QTL 47 2.91 0.05 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 7 47251783 65728867 Rat 2293678 Bss24 Bone structure and strength QTL 24 6.71 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 7 47651439 92651439 Rat 1358361 Sradr5 Stress Responsive Adrenal Weight QTL 5 5.55 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 7 43747012 108555253 Rat 2298547 Neuinf5 Neuroinflammation QTL 5 3.7 nervous system integrity trait (VT:0010566) spinal cord Cd74 protein level (CMO:0002131) 7 9462246 58265113 Rat 631513 Scl7 Serum cholesterol level QTL 7 4.1 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 7 37960569 82960569 Rat 2293685 Bmd21 Bone mineral density QTL 21 4.2 0.0003 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 7 47651439 92651439 Rat 10755453 Coatc12 Coat color QTL 12 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 31112832 76112832 Rat 631504 Cm27 Cardiac mass QTL 27 3.45 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 7 44421311 118198041 Rat 10755451 Coatc11 Coat color QTL 11 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 17944357 62944357 Rat 634326 Hc3 Hypercalciuria QTL 3 2.1 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 7 42787314 87787314 Rat 2317059 Aia15 Adjuvant induced arthritis QTL 15 2.46 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 7 17004598 62004598 Rat 2293696 Bmd32 Bone mineral density QTL 32 5.1 0.0001 femur strength trait (VT:0010010) femoral neck polar moment of inertia (CMO:0001670) 7 47651439 92651439 Rat 7411605 Foco14 Food consumption QTL 14 24.1 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 7 34293282 79293282 Rat 1300151 Bp181 Blood pressure QTL 181 3.36 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 7 53612714 103945643 Rat 1643004 Pain2 Pain QTL 2 1 mechanical nociception trait (VT:0002734) self mutilation severity score (CMO:0002145) 7 9462246 98011544 Rat 738030 Anxrr8 Anxiety related response QTL 8 4.1 exploratory behavior trait (VT:0010471) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 46590070 91590070 Rat 1300149 Cm6 Cardiac mass QTL 6 4.09 heart mass (VT:0007028) heart left ventricle weight to body weight ratio (CMO:0000530) 7 43747099 102228765 Rat 631534 Lnnr1 Liver neoplastic nodule remodeling QTL 1 3.85 0.001 liver integrity trait (VT:0010547) liver remodeling tumorous lesion number to liver total tumorous lesion number ratio (CMO:0001705) 7 34293282 79293282 Rat 634336 Anxrr17 Anxiety related response QTL 17 3.66 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 924703 115097879 Rat 2293707 Bss32 Bone structure and strength QTL 32 7.64 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 7 47651439 92651439 Rat 61357 Bp38 Blood pressure QTL 38 1.6 0.052 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 41333674 119109060 Rat 2303629 Vencon3 Ventilatory control QTL 3 7.25 respiration trait (VT:0001943) respiration rate (CMO:0000289) 7 41109692 56793354 Rat 2293644 Bmd29 Bone mineral density QTL 29 5.4 0.0001 femur size trait (VT:1000369) femoral neck cross-sectional area (CMO:0001697) 7 47651439 92651439 Rat 70190 Mcs6 Mammary carcinoma susceptibility QTL 6 2.29 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 7 26737401 63902784 Rat 2300178 Bmd54 Bone mineral density QTL 54 5.3 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 7 47651439 92651439 Rat 61428 Scl3 Serum cholesterol level QTL 3 3.2 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 7 44867533 89867533 Rat 1300132 Bp182 Blood pressure QTL 182 3.49 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 7 19654317 84928080 Rat 10402855 Bp379 Blood pressure QTL 379 0.21 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 29409683 74409683 Rat 738033 Anxrr6 Anxiety related response QTL 6 4.1 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 7 15573889 60573889 Rat
D7Got206
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 55,393,141 - 55,393,316 (+) MAPPER mRatBN7.2 Rnor_6.0 1 14,611,841 - 14,612,015 NCBI Rnor6.0 Rnor_6.0 7 64,669,331 - 64,669,505 NCBI Rnor6.0 Rnor_5.0 7 64,886,927 - 64,887,101 UniSTS Rnor5.0 Rnor_5.0 1 16,161,696 - 16,161,870 UniSTS Rnor5.0 Celera 7 52,155,851 - 52,156,025 UniSTS Cytogenetic Map 7 q22 UniSTS
AW530851
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 55,551,489 - 55,551,685 (+) MAPPER mRatBN7.2 Rnor_6.0 7 64,826,962 - 64,827,157 NCBI Rnor6.0 Rnor_5.0 7 65,044,120 - 65,044,315 UniSTS Rnor5.0 RGSC_v3.4 7 59,274,596 - 59,274,791 UniSTS RGSC3.4 Celera 7 52,312,966 - 52,313,161 UniSTS RH 3.4 Map 7 489.8 UniSTS Cytogenetic Map 7 q22 UniSTS
AU049021
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 55,414,629 - 55,414,796 (+) MAPPER mRatBN7.2 Rnor_6.0 7 64,690,095 - 64,690,261 NCBI Rnor6.0 Rnor_5.0 7 64,908,037 - 64,908,203 UniSTS Rnor5.0 Celera 7 52,177,253 - 52,177,419 UniSTS Cytogenetic Map 7 q22 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
6
40
113
83
82
51
25
51
6
195
84
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000005539 ⟹ ENSRNOP00000005539
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 54,934,250 - 55,592,096 (+) Ensembl Rnor_6.0 Ensembl 7 64,672,722 - 64,864,227 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000005545 ⟹ ENSRNOP00000005545
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 55,493,231 - 55,592,273 (+) Ensembl Rnor_6.0 Ensembl 7 64,768,742 - 64,864,404 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000064448 ⟹ ENSRNOP00000059908
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 55,397,072 - 55,581,859 (+) Ensembl Rnor_6.0 Ensembl 7 64,672,722 - 64,864,155 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000088861 ⟹ ENSRNOP00000073984
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 55,312,410 - 55,582,808 (+) Ensembl Rnor_6.0 Ensembl 7 64,769,089 - 64,854,248 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000095939 ⟹ ENSRNOP00000086684
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 55,194,360 - 55,582,808 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000103170 ⟹ ENSRNOP00000089072
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 54,935,257 - 55,582,808 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000104327 ⟹ ENSRNOP00000093733
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 55,397,045 - 55,582,808 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000107252 ⟹ ENSRNOP00000091086
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 55,312,227 - 55,582,808 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000116059 ⟹ ENSRNOP00000076991
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 54,934,250 - 55,582,808 (+) Ensembl
RefSeq Acc Id:
NM_032069 ⟹ NP_114458
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 57,197,852 - 57,468,413 (+) NCBI mRatBN7.2 7 55,312,227 - 55,582,808 (+) NCBI Rnor_6.0 7 64,672,723 - 64,854,939 (+) NCBI Rnor_5.0 7 64,890,319 - 65,072,097 (+) NCBI RGSC_v3.4 7 59,157,276 - 59,306,131 (+) RGD Celera 7 52,073,046 - 52,340,208 (+) RGD
Sequence:
AGCTCCACCAGATGACATGTAGCGCGCGGGACCTCTGCATCAGCCAAGAGGAATTAAGCTTTGTCACTCCCCACTGGGACTACCTTCCTCCTGGTATGTGCGCAAGGAATTCATATACTGCTGCTCGC
hide sequence
RefSeq Acc Id:
XM_039079958 ⟹ XP_038935886
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 57,225,885 - 57,477,877 (+) NCBI mRatBN7.2 7 55,339,602 - 55,592,274 (+) NCBI
RefSeq Acc Id:
XM_039079960 ⟹ XP_038935888
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 56,820,501 - 57,469,058 (+) NCBI mRatBN7.2 7 54,934,856 - 55,583,453 (+) NCBI
RefSeq Acc Id:
XM_039079961 ⟹ XP_038935889
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 57,194,132 - 57,469,058 (+) NCBI mRatBN7.2 7 55,310,970 - 55,583,453 (+) NCBI
RefSeq Acc Id:
XM_039079962 ⟹ XP_038935890
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 57,059,719 - 57,469,058 (+) NCBI mRatBN7.2 7 55,190,642 - 55,583,453 (+) NCBI
RefSeq Acc Id:
XM_039079963 ⟹ XP_038935891
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 57,194,132 - 57,477,877 (+) NCBI mRatBN7.2 7 55,310,970 - 55,592,274 (+) NCBI
RefSeq Acc Id:
XM_039079964 ⟹ XP_038935892
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 57,225,892 - 57,469,058 (+) NCBI mRatBN7.2 7 55,339,604 - 55,583,453 (+) NCBI
RefSeq Acc Id:
XM_039079965 ⟹ XP_038935893
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 56,820,501 - 57,469,058 (+) NCBI mRatBN7.2 7 54,934,856 - 55,583,453 (+) NCBI
RefSeq Acc Id:
XM_039079966 ⟹ XP_038935894
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 57,194,132 - 57,469,058 (+) NCBI mRatBN7.2 7 55,310,970 - 55,583,453 (+) NCBI
RefSeq Acc Id:
XM_039079967 ⟹ XP_038935895
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 57,375,296 - 57,469,058 (+) NCBI mRatBN7.2 7 55,489,649 - 55,583,453 (+) NCBI
RefSeq Acc Id:
XM_039079968 ⟹ XP_038935896
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 57,375,305 - 57,469,058 (+) NCBI mRatBN7.2 7 55,489,651 - 55,583,453 (+) NCBI
RefSeq Acc Id:
XM_039079969 ⟹ XP_038935897
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 57,375,301 - 57,477,877 (+) NCBI mRatBN7.2 7 55,489,650 - 55,592,274 (+) NCBI
RefSeq Acc Id:
XM_039079970 ⟹ XP_038935898
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 57,385,637 - 57,469,058 (+) NCBI mRatBN7.2 7 55,500,025 - 55,583,453 (+) NCBI
RefSeq Acc Id:
XM_063264313 ⟹ XP_063120383
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 57,225,891 - 57,477,877 (+) NCBI
RefSeq Acc Id:
XM_063264314 ⟹ XP_063120384
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 57,059,719 - 57,469,058 (+) NCBI
RefSeq Acc Id:
XM_063264315 ⟹ XP_063120385
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 57,059,716 - 57,469,058 (+) NCBI
RefSeq Acc Id:
XM_063264316 ⟹ XP_063120386
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 57,059,724 - 57,469,058 (+) NCBI
RefSeq Acc Id:
XM_063264317 ⟹ XP_063120387
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 57,059,720 - 57,477,877 (+) NCBI
RefSeq Acc Id:
XM_063264318 ⟹ XP_063120388
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 57,194,133 - 57,469,058 (+) NCBI
RefSeq Acc Id:
XM_063264319 ⟹ XP_063120389
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 57,194,132 - 57,477,877 (+) NCBI
RefSeq Acc Id:
XM_063264320 ⟹ XP_063120390
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 57,059,724 - 57,469,058 (+) NCBI
RefSeq Acc Id:
XM_063264321 ⟹ XP_063120391
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 57,194,132 - 57,477,877 (+) NCBI
RefSeq Acc Id:
XR_005486730
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 57,225,219 - 57,407,504 (+) NCBI mRatBN7.2 7 55,339,598 - 55,521,892 (+) NCBI
RefSeq Acc Id:
NP_114458 ⟸ NM_032069
- UniProtKB:
P97879 (UniProtKB/Swiss-Prot), A6IGX1 (UniProtKB/TrEMBL)
- Sequence:
MIAVSFKCRCQILRRLTKDESPYTKSASQTKPPDGALAVRRQSIPEEFKGSTVVELMKKEGTTLGLTVSGGIDKDGKPRVSNLRQGGIAARSDQLDVGDYIKAVNGINLAKFRHDEIISLLKNVGERV
hide sequence
Ensembl Acc Id:
ENSRNOP00000005539 ⟸ ENSRNOT00000005539
Ensembl Acc Id:
ENSRNOP00000005545 ⟸ ENSRNOT00000005545
Ensembl Acc Id:
ENSRNOP00000073984 ⟸ ENSRNOT00000088861
Ensembl Acc Id:
ENSRNOP00000059908 ⟸ ENSRNOT00000064448
RefSeq Acc Id:
XP_038935888 ⟸ XM_039079960
- Peptide Label:
isoform X4
- UniProtKB:
F1LMX8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038935893 ⟸ XM_039079965
- Peptide Label:
isoform X10
- UniProtKB:
F1LMX8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038935890 ⟸ XM_039079962
- Peptide Label:
isoform X6
- UniProtKB:
A0A8I6GEA5 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038935891 ⟸ XM_039079963
- Peptide Label:
isoform X7
- UniProtKB:
Q30A71 (UniProtKB/TrEMBL), A6IGX1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038935889 ⟸ XM_039079961
- Peptide Label:
isoform X5
- UniProtKB:
A0A8I6AEY6 (UniProtKB/TrEMBL), A6IGX0 (UniProtKB/TrEMBL), A6IGX1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038935894 ⟸ XM_039079966
- Peptide Label:
isoform X11
- UniProtKB:
A6IGX1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038935886 ⟸ XM_039079958
- Peptide Label:
isoform X1
- UniProtKB:
F1LMX8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038935892 ⟸ XM_039079964
- Peptide Label:
isoform X8
- UniProtKB:
A0A8I5Y580 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038935895 ⟸ XM_039079967
- Peptide Label:
isoform X18
- UniProtKB:
Q30A72 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038935897 ⟸ XM_039079969
- Peptide Label:
isoform X20
- UniProtKB:
A0A140TA96 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038935896 ⟸ XM_039079968
- Peptide Label:
isoform X19
RefSeq Acc Id:
XP_038935898 ⟸ XM_039079970
- Peptide Label:
isoform X21
Ensembl Acc Id:
ENSRNOP00000076991 ⟸ ENSRNOT00000116059
Ensembl Acc Id:
ENSRNOP00000086684 ⟸ ENSRNOT00000095939
Ensembl Acc Id:
ENSRNOP00000091086 ⟸ ENSRNOT00000107252
Ensembl Acc Id:
ENSRNOP00000089072 ⟸ ENSRNOT00000103170
Ensembl Acc Id:
ENSRNOP00000093733 ⟸ ENSRNOT00000104327
RefSeq Acc Id:
XP_063120385 ⟸ XM_063264315
- Peptide Label:
isoform X9
- UniProtKB:
A0A8I5Y580 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063120384 ⟸ XM_063264314
- Peptide Label:
isoform X3
- UniProtKB:
A0A8I6GEA5 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063120387 ⟸ XM_063264317
- Peptide Label:
isoform X13
- UniProtKB:
A0A8I5Y580 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063120386 ⟸ XM_063264316
- Peptide Label:
isoform X12
- UniProtKB:
A0A8I5Y580 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063120390 ⟸ XM_063264320
- Peptide Label:
isoform X16
- UniProtKB:
A0A8I6GGW0 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063120389 ⟸ XM_063264319
- Peptide Label:
isoform X15
- UniProtKB:
A0A0G2K6Y0 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063120391 ⟸ XM_063264321
- Peptide Label:
isoform X17
- UniProtKB:
A0A0G2K6Y0 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063120388 ⟸ XM_063264318
- Peptide Label:
isoform X14
- UniProtKB:
A0A0G2K6Y0 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063120383 ⟸ XM_063264313
- Peptide Label:
isoform X2
- UniProtKB:
F1LMX8 (UniProtKB/TrEMBL)
RGD ID: 13695237 Promoter ID: EPDNEW_R5756 Type: initiation region Name: Grip1_1 Description: glutamate receptor interacting protein 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 7 64,768,995 - 64,769,055 EPDNEW
BioCyc Gene G2FUF-33920 BioCyc
Ensembl Genes ENSRNOG00000004013 Ensembl, ENTREZGENE
Ensembl Transcript ENSRNOT00000005539 ENTREZGENE
ENSRNOT00000005545 ENTREZGENE
ENSRNOT00000064448 ENTREZGENE
ENSRNOT00000088861 ENTREZGENE
ENSRNOT00000095939 ENTREZGENE
ENSRNOT00000103170 ENTREZGENE
ENSRNOT00000107252 ENTREZGENE
ENSRNOT00000163589 ENTREZGENE
Gene3D-CATH 2.30.42.10 UniProtKB/Swiss-Prot
InterPro GRIP1/2 UniProtKB/Swiss-Prot
PDZ UniProtKB/Swiss-Prot
PDZ_6 UniProtKB/Swiss-Prot
PDZ_sf UniProtKB/Swiss-Prot
KEGG Report rno:84016 UniProtKB/Swiss-Prot
NCBI Gene 84016 ENTREZGENE
PANTHER PTHR46227 UniProtKB/Swiss-Prot
PTHR46227:SF3 UniProtKB/Swiss-Prot
Pfam PDZ UniProtKB/Swiss-Prot
PDZ_6 UniProtKB/Swiss-Prot
PhenoGen Grip1 PhenoGen
PROSITE PDZ UniProtKB/Swiss-Prot
RatGTEx ENSRNOG00000004013 RatGTEx
SMART PDZ UniProtKB/Swiss-Prot
Superfamily-SCOP SSF50156 UniProtKB/Swiss-Prot
UniProt A0A0G2K6Y0 ENTREZGENE, UniProtKB/TrEMBL
A0A140TA96 ENTREZGENE, UniProtKB/TrEMBL
A0A8I5Y580 ENTREZGENE, UniProtKB/TrEMBL
A0A8I6AEY6 ENTREZGENE, UniProtKB/TrEMBL
A0A8I6AK56_RAT UniProtKB/TrEMBL
A0A8I6GEA5 ENTREZGENE, UniProtKB/TrEMBL
A0A8I6GGW0 ENTREZGENE, UniProtKB/TrEMBL
A6IGX0 ENTREZGENE, UniProtKB/TrEMBL
A6IGX1 ENTREZGENE, UniProtKB/TrEMBL
F1LMX8 ENTREZGENE, UniProtKB/TrEMBL
F1LRA4_RAT UniProtKB/TrEMBL
F5HTD6_RAT UniProtKB/TrEMBL
GRIP1_RAT UniProtKB/Swiss-Prot, ENTREZGENE
Q30A71 ENTREZGENE, UniProtKB/TrEMBL
Q30A72 ENTREZGENE, UniProtKB/TrEMBL
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2004-09-10
Grip1
glutamate receptor interacting protein 1
Glutamate receptor interacting protein
Name updated
1299863 APPROVED
2002-08-07
Grip1
Glutamate receptor interacting protein
Symbol and Name status set to provisional
70820 PROVISIONAL
