Symbol:
Git1
Name:
GIT ArfGAP 1
RGD ID:
69331
Description:
Enables several functions, including GTPase activator activity; enzyme binding activity; and scaffold protein binding activity. A structural constituent of postsynaptic specialization. Involved in several processes, including cellular response to epidermal growth factor stimulus; neurotransmitter receptor localization to postsynaptic specialization membrane; and regulation of signal transduction. Acts upstream of or within dendritic spine development and immunological synapse formation. Located in several cellular components, including excitatory synapse; growth cone; and inhibitory synapse. Is active in GABA-ergic synapse; glutamatergic synapse; and postsynapse. Human ortholog(s) of this gene implicated in attention deficit hyperactivity disorder. Orthologous to human GIT1 (GIT ArfGAP 1); PARTICIPATES IN Arf family mediated signaling pathway; E-cadherin signaling pathway; endocytosis pathway; INTERACTS WITH 2,4-dinitrotoluene; 6-propyl-2-thiouracil; amitrole.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
ARF GAP GIT1; ARF GTPase-activating protein GIT1; CAT-1; CAT1; cool-associated and tyrosine-phosphorylated protein 1; G protein-coupled receptor kinase interacting ArfGAP 1; G protein-coupled receptor kinase interactor 1; G protein-coupled receptor kinase-associated ADP ribosylation factor GTPase-activating protein (GIT1); G protein-coupled receptor kinase-interactor 1; GRK-interacting protein 1; GRK-interactor 1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
GIT1 (GIT ArfGAP 1) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, Panther
Mus musculus (house mouse):
Git1 (GIT ArfGAP 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Git1 (GIT ArfGAP 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
GIT1 (GIT ArfGAP 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
GIT1 (GIT ArfGAP 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Git1 (GIT ArfGAP 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
GIT1 (GIT ArfGAP 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
GIT1 (GIT ArfGAP 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Git1 (GIT ArfGAP 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
GIT1 (GIT ArfGAP 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Git1 (GIT ArfGAP 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
git1 (G protein-coupled receptor kinase interacting ArfGAP 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
git-1
Alliance
DIOPT (Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
Git
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
git1
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 62,840,165 - 62,854,508 (+) NCBI GRCr8 mRatBN7.2 10 62,342,082 - 62,356,379 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 62,342,299 - 62,356,373 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 66,992,057 - 67,006,179 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 66,497,543 - 66,511,665 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 61,970,798 - 61,984,917 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 62,656,000 - 62,664,467 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 62,656,000 - 62,664,466 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 62,352,883 - 62,362,201 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 66,610,282 - 66,618,919 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 66,623,904 - 66,632,546 (-) NCBI Celera 10 61,351,008 - 61,359,475 (+) NCBI Celera Cytogenetic Map 10 q24 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Git1 Rat 1,2-dimethylhydrazine increases expression ISO RGD:737425 6480464 1,2-Dimethylhydrazine results in increased expression of GIT1 mRNA CTD PMID:22206623 Git1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:737425 6480464 Tetrachlorodibenzodioxin affects the expression of GIT1 mRNA CTD PMID:21570461 Git1 Rat 2,4,6-tribromophenol decreases expression ISO RGD:732720 6480464 2,4,6-tribromophenol results in decreased expression of GIT1 mRNA CTD PMID:31675489 Git1 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2,4-dinitrotoluene affects the expression of GIT1 mRNA CTD PMID:21346803 Git1 Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO RGD:732720 6480464 tetrabromobisphenol A results in decreased expression of GIT1 protein CTD PMID:31675489 Git1 Rat 4,4'-sulfonyldiphenol decreases methylation ISO RGD:737425 6480464 bisphenol S results in decreased methylation of GIT1 exon CTD PMID:33297965 Git1 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of GIT1 mRNA CTD PMID:30047161 Git1 Rat actinomycin D multiple interactions ISO RGD:732720 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of GIT1 protein CTD PMID:38460933 Git1 Rat aflatoxin B1 decreases methylation ISO RGD:732720 6480464 Aflatoxin B1 results in decreased methylation of GIT1 intron CTD PMID:30157460 Git1 Rat all-trans-retinoic acid decreases expression ISO RGD:732720 6480464 Tretinoin results in decreased expression of GIT1 mRNA CTD PMID:33167477 Git1 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of GIT1 mRNA CTD PMID:30047161 Git1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of GIT1 mRNA CTD PMID:16483693 Git1 Rat aristolochic acid A increases expression ISO RGD:732720 6480464 aristolochic acid I results in increased expression of GIT1 mRNA CTD PMID:33212167 Git1 Rat arsane multiple interactions ISO RGD:732720 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of GIT1 more ... CTD PMID:39836092 Git1 Rat arsenic atom multiple interactions ISO RGD:732720 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of GIT1 more ... CTD PMID:39836092 Git1 Rat atrazine increases expression ISO RGD:732720 6480464 Atrazine results in increased expression of GIT1 mRNA CTD PMID:22378314 Git1 Rat benzo[a]pyrene multiple interactions ISO RGD:737425 6480464 Benzo(a)pyrene promotes the reaction [AHR protein binds to GIT1 promoter] CTD PMID:19654925 Git1 Rat bisphenol A decreases expression ISO RGD:737425 6480464 bisphenol A results in decreased expression of GIT1 mRNA CTD PMID:23798566|PMID:32926169 Git1 Rat bisphenol A multiple interactions ISO RGD:732720 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of GIT1 gene CTD PMID:31601247 Git1 Rat bisphenol A decreases expression ISO RGD:732720 6480464 bisphenol A results in decreased expression of GIT1 protein CTD PMID:31675489|PMID:33376534 Git1 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of GIT1 mRNA CTD PMID:25181051 Git1 Rat bisphenol F decreases expression ISO RGD:737425 6480464 bisphenol F results in decreased expression of GIT1 mRNA CTD PMID:38685157 Git1 Rat bortezomib decreases expression ISO RGD:732720 6480464 Bortezomib results in decreased expression of GIT1 mRNA CTD PMID:20977926 Git1 Rat cadmium dichloride decreases expression ISO RGD:732720 6480464 Cadmium Chloride results in decreased expression of GIT1 mRNA CTD PMID:38568856 Git1 Rat caffeine affects phosphorylation ISO RGD:732720 6480464 Caffeine affects the phosphorylation of GIT1 protein CTD PMID:35688186 Git1 Rat calcium dichloride increases expression ISO RGD:732720 6480464 Calcium Chloride results in increased expression of GIT1 protein CTD PMID:25824407 Git1 Rat carbon nanotube increases expression ISO RGD:737425 6480464 Nanotubes, Carbon results in increased expression of GIT1 mRNA CTD PMID:25554681 Git1 Rat chlorpyrifos increases expression ISO RGD:737425 6480464 Chlorpyrifos results in increased expression of GIT1 mRNA CTD PMID:37019170 Git1 Rat cisplatin multiple interactions ISO RGD:732720 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of GIT1 mRNA CTD PMID:27392435 Git1 Rat cisplatin increases expression ISO RGD:732720 6480464 Cisplatin results in increased expression of GIT1 mRNA CTD PMID:27392435 Git1 Rat coumarin affects phosphorylation ISO RGD:732720 6480464 coumarin affects the phosphorylation of GIT1 protein CTD PMID:35688186 Git1 Rat decabromodiphenyl ether increases expression ISO RGD:732720 6480464 decabromobiphenyl ether results in increased expression of GIT1 protein CTD PMID:31675489 Git1 Rat diazinon increases methylation ISO RGD:732720 6480464 Diazinon results in increased methylation of GIT1 gene CTD PMID:22964155 Git1 Rat Dibutyl phosphate affects expression ISO RGD:732720 6480464 di-n-butylphosphoric acid affects the expression of GIT1 mRNA CTD PMID:37042841 Git1 Rat doxorubicin decreases expression ISO RGD:732720 6480464 Doxorubicin results in decreased expression of GIT1 mRNA CTD PMID:29803840 Git1 Rat epoxiconazole decreases expression ISO RGD:737425 6480464 epoxiconazole results in decreased expression of GIT1 mRNA CTD PMID:35436446 Git1 Rat ethanol affects splicing ISO RGD:737425 6480464 Ethanol affects the splicing of GIT1 mRNA CTD PMID:30319688 Git1 Rat ethanol increases expression ISO RGD:737425 6480464 Ethanol results in increased expression of GIT1 mRNA CTD PMID:30319688 Git1 Rat FR900359 affects phosphorylation ISO RGD:732720 6480464 FR900359 affects the phosphorylation of GIT1 protein CTD PMID:37730182 Git1 Rat fulvestrant multiple interactions ISO RGD:732720 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of GIT1 gene CTD PMID:31601247 Git1 Rat hydrogen sulfide increases expression ISO RGD:737425 6480464 Hydrogen Sulfide results in increased expression of GIT1 protein CTD PMID:29932956 Git1 Rat ivermectin decreases expression ISO RGD:732720 6480464 Ivermectin results in decreased expression of GIT1 protein CTD PMID:32959892 Git1 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of GIT1 mRNA CTD PMID:30047161 Git1 Rat N-nitrosodiethylamine increases expression EXP 6480464 Diethylnitrosamine results in increased expression of GIT1 mRNA CTD PMID:20360939 Git1 Rat Nutlin-3 multiple interactions ISO RGD:732720 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of GIT1 protein CTD PMID:38460933 Git1 Rat paracetamol increases expression ISO RGD:732720 6480464 Acetaminophen results in increased expression of GIT1 mRNA CTD PMID:22230336|PMID:29067470 Git1 Rat pregnenolone 16alpha-carbonitrile increases expression EXP 6480464 Pregnenolone Carbonitrile results in increased expression of GIT1 mRNA CTD PMID:30047161 Git1 Rat sodium arsenite decreases expression ISO RGD:732720 6480464 sodium arsenite results in decreased expression of GIT1 mRNA CTD PMID:38568856 Git1 Rat sodium arsenite multiple interactions ISO RGD:732720 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of GIT1 more ... CTD PMID:39836092 Git1 Rat sodium fluoride decreases expression ISO RGD:737425 6480464 Sodium Fluoride results in decreased expression of GIT1 protein CTD PMID:28918527 Git1 Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of GIT1 mRNA CTD PMID:30047161 Git1 Rat sunitinib increases expression ISO RGD:732720 6480464 Sunitinib results in increased expression of GIT1 mRNA CTD PMID:31533062 Git1 Rat titanium dioxide decreases methylation ISO RGD:737425 6480464 titanium dioxide results in decreased methylation of GIT1 gene; titanium dioxide results in decreased methylation more ... CTD PMID:35295148 Git1 Rat tungsten decreases expression ISO RGD:737425 6480464 Tungsten results in decreased expression of GIT1 mRNA CTD PMID:30912803 Git1 Rat urethane increases expression ISO RGD:732720 6480464 Urethane results in increased expression of GIT1 mRNA CTD PMID:28818685
Molecular Function
Only show annotations with direct experimental evidence (0 objects hidden)
Git1 Rat gamma-tubulin binding enables ISS UniProtKB:Q9Y2X7 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Git1 Rat gamma-tubulin binding enables ISO RGD:732720 1624291 PMID:27012601 RGD PMID:27012601 Git1 Rat gamma-tubulin binding enables IEA UniProtKB:Q9Y2X7|ensembl:ENSP00000225394 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Git1 Rat GTPase activator activity IDA 68782 RGD Git1 Rat GTPase activator activity enables IEA InterPro:IPR001164|InterPro:IPR047161 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Git1 Rat GTPase activator activity enables IEA InterPro:IPR047161 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Git1 Rat GTPase activator activity enables IBA PANTHER:PTN002918693|RGD:69331 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Git1 Rat GTPase activator activity enables IEA UniProtKB-KW:KW-0343 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Git1 Rat GTPase activator activity IDA 11344921 RGD Git1 Rat identical protein binding IPI RGD:69331 1549447 homodimerization RGD Git1 Rat metal ion binding enables IEA UniProtKB-KW:KW-0479 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Git1 Rat protein binding IPI RGD:736143 1549447 RGD Git1 Rat protein binding enables ISO RGD:737425 1624291 PR:Q9ES28|UniProtKB:A2AIR5|UniProtKB:Q9ES28 PMID:10428811, PMID:16959763, PMID:19022416, PMID:24297929 RGD PMID:10428811|PMID:16959763|PMID:19022416|PMID:24297929 Git1 Rat protein binding enables IPI UniProtKB:O35346|UniProtKB:O55043|UniProtKB:P97879|UniProtKB:Q66H76|UniProtKB:Q9JKS6 9850090 PMID:12473661 UniProt Git1 Rat protein binding IPI RGD:620000 152995492 RGD Git1 Rat protein binding IPI RGD:621667 152995492 RGD Git1 Rat protein binding enables ISO RGD:732720 1624291 UniProtKB:O60925|UniProtKB:P25098|UniProtKB:P42858|UniProtKB:P49023|UniProtKB:P49024|UniProtKB:P62993|UniProtKB:Q12873|UniProtKB:Q13153|UniProtKB:Q14155|UniProtKB:Q14160|UniProtKB:Q14161|UniProtKB:Q15052|UniProtKB:Q5T3J3|UniProtKB:Q96C92|UniProtKB:Q99728|UniProtKB:Q9P2H0 PMID:15182672, PMID:15383276, PMID:16169070, PMID:16628223, PMID:16717130, PMID:16787945, PMID:18369319, PMID:19041750, PMID:21295525, PMID:21706016, PMID:21900206, PMID:23108400, PMID:23455922, more ... RGD PMID:15182672|PMID:15383276|PMID:16169070|PMID:16628223|PMID:16717130|PMID:16787945|PMID:18369319|PMID:19041750|PMID:21295525|PMID:21706016|PMID:21900206|PMID:23108400|PMID:23455922|PMID:25852190|PMID:27012601|PMID:31980649|PMID:33961781|PMID:35271311 Git1 Rat protein binding enables IPI UniProtKB:O55043|UniProtKB:Q9R1M7 42721994 PMID:24297929 UniProt Git1 Rat protein binding enables IPI UniProtKB:Q9ES28 8553358 PMID:21295525 IntAct Git1 Rat protein phosphatase binding IPI RGD:3453 152995492 RGD Git1 Rat protein tyrosine kinase binding IPI RGD:3443 152995492 RGD Git1 Rat protein-containing complex binding enables IEA UniProtKB:Q68FF6|ensembl:ENSMUSP00000037210 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Git1 Rat protein-containing complex binding enables ISO RGD:737425 1624291 PR:O55033|PR:Q8CBF3|PR:Q9JLQ2 PMID:17310244 RGD PMID:17310244 Git1 Rat scaffold protein binding IPI RGD:1305759 152995492 RGD Git1 Rat small GTPase binding IDA 68782 RGD Git1 Rat small GTPase binding enables IBA PANTHER:PTN002918693|RGD:69331 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Git1 Rat structural constituent of postsynaptic specialization enables IMP 13702191 PMID:25284783 SynGO Git1 Rat structural constituent of postsynaptic specialization enables IDA 13702191 PMID:25284783 SynGO Git1 Rat zinc ion binding enables IEA UniProtKB-KW:KW-0863 1600115 GO_REF:0000043 UniProt GO_REF:0000043
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
1,2-dimethylhydrazine (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4,6-tribromophenol (ISO) 2,4-dinitrotoluene (EXP) 3,3',5,5'-tetrabromobisphenol A (ISO) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) actinomycin D (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) amitrole (EXP) ammonium chloride (EXP) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) atrazine (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) bortezomib (ISO) cadmium dichloride (ISO) caffeine (ISO) calcium dichloride (ISO) carbon nanotube (ISO) chlorpyrifos (ISO) cisplatin (ISO) coumarin (ISO) decabromodiphenyl ether (ISO) diazinon (ISO) Dibutyl phosphate (ISO) doxorubicin (ISO) epoxiconazole (ISO) ethanol (ISO) FR900359 (ISO) fulvestrant (ISO) hydrogen sulfide (ISO) ivermectin (ISO) methimazole (EXP) N-nitrosodiethylamine (EXP) Nutlin-3 (ISO) paracetamol (ISO) pregnenolone 16alpha-carbonitrile (EXP) sodium arsenite (ISO) sodium fluoride (ISO) sulfadimethoxine (EXP) sunitinib (ISO) titanium dioxide (ISO) tungsten (ISO) urethane (ISO)
Biological Process
brain development (IBA,IEA,ISO) cell redox homeostasis (IEA,ISO,ISS) cellular response to epidermal growth factor stimulus (IDA) cellular response to lipopolysaccharide (IEA,ISO,ISS) dendritic spine development (IGI) ephrin receptor signaling pathway (IEA,ISO) immunological synapse formation (IGI) intramembranous ossification (IEA,ISO,ISS) locomotory behavior (IEA,ISO) maintenance of postsynaptic specialization structure (IEA) motor learning (IEA,ISO) negative regulation of ARF protein signal transduction (IDA) negative regulation of glycolytic process (IEA,ISO,ISS) negative regulation of inflammatory response to wounding (IEA,ISO,ISS) negative regulation of interleukin-1 beta production (IEA,ISO,ISS) neuron development (IEA,ISO) neurotransmitter receptor localization to postsynaptic specialization membrane (IDA,IMP) positive regulation of microtubule nucleation (IEA,ISO,ISS) positive regulation of receptor catabolic process (IMP) presynaptic modulation of chemical synaptic transmission (IEA,ISO) regulation of ARF protein signal transduction (IBA,IEA) regulation of cytokinesis (IEA,ISO) regulation of G protein-coupled receptor signaling pathway (IBA,IDA) regulation of synaptic vesicle exocytosis (IEA,ISO) synaptic vesicle recycling (IBA)
Cellular Component
anchoring junction (IEA) calyx of Held (IEA,ISO) cell projection (IEA) centrosome (IEA,ISO,ISS) cytoplasm (IEA) cytoskeleton (IEA) cytosol (IBA,IEA,ISO,TAS) dendrite (IDA) endosome (IDA) excitatory synapse (IDA) focal adhesion (IEA,ISO,TAS) GABA-ergic synapse (IDA,IMP) glutamatergic synapse (IDA) growth cone (IDA) inhibitory synapse (IDA) lamellipodium (IEA) mitochondrion (IEA,ISO) mitotic spindle pole (IEA,ISO,ISS) neuron projection (IBA) postsynapse (IBA,IDA,IEA,ISO,ISS) postsynaptic density (IEA) presynapse (IEA,ISO) spindle pole (IEA) synapse (IBA,IEA)
1.
An epidermal growth factor (EGF) -dependent interaction between GIT1 and sorting nexin 6 promotes degradation of the EGF receptor.
Cavet ME, etal., FASEB J. 2008 Oct;22(10):3607-16. doi: 10.1096/fj.07-094086. Epub 2008 Jun 3.
2.
GluN3A expression restricts spine maturation via inhibition of GIT1/Rac1 signaling.
Fiuza M, etal., Proc Natl Acad Sci U S A. 2013 Dec 17;110(51):20807-12. doi: 10.1073/pnas.1312211110. Epub 2013 Dec 2.
3.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
5.
A protein interaction network links GIT1, an enhancer of huntingtin aggregation, to Huntington's disease.
Goehler H, etal., Mol Cell 2004 Sep 24;15(6):853-65.
6.
N-alpha-acetyltransferase 10 protein suppresses cancer cell metastasis by binding PIX proteins and inhibiting Cdc42/Rac1 activity.
Hua KT, etal., Cancer Cell. 2011 Feb 15;19(2):218-31. doi: 10.1016/j.ccr.2010.11.010. Epub 2011 Feb 3.
7.
The GIT family of proteins forms multimers and associates with the presynaptic cytomatrix protein Piccolo.
Kim S, etal., J Biol Chem. 2003 Feb 21;278(8):6291-300. Epub 2002 Dec 6.
8.
Interaction between liprin-alpha and GIT1 is required for AMPA receptor targeting.
Ko J, etal., J Neurosci. 2003 Mar 1;23(5):1667-77.
9.
Regulation of neuroendocrine exocytosis by the ARF6 GTPase-activating protein GIT1.
Meyer MZ, etal., J Biol Chem. 2006 Mar 24;281(12):7919-26. Epub 2006 Jan 26.
10.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
11.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
12.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
13.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
14.
The GIT/PIX complex: an oligomeric assembly of GIT family ARF GTPase-activating proteins and PIX family Rac1/Cdc42 guanine nucleotide exchange factors.
Premont RT, etal., Cell Signal 2004 Sep;16(9):1001-11.
15.
beta2-Adrenergic receptor regulation by GIT1, a G protein-coupled receptor kinase-associated ADP ribosylation factor GTPase-activating protein.
Premont RT, etal., Proc Natl Acad Sci U S A 1998 Nov 24;95(24):14082-7.
16.
GOA pipeline
RGD automated data pipeline
17.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
18.
Grb4 and GIT1 transduce ephrinB reverse signals modulating spine morphogenesis and synapse formation.
Segura I, etal., Nat Neurosci. 2007 Mar;10(3):301-10. Epub 2007 Feb 18.
19.
GIT1 and ßPIX are essential for GABA(A) receptor synaptic stability and inhibitory neurotransmission.
Smith KR, etal., Cell Rep. 2014 Oct 9;9(1):298-310. doi: 10.1016/j.celrep.2014.08.061. Epub 2014 Oct 2.
20.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
21.
GIT1 is associated with ADHD in humans and ADHD-like behaviors in mice.
Won H, etal., Nat Med. 2011 May;17(5):566-72. doi: 10.1038/nm.2330. Epub 2011 Apr 17.
Git1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 62,840,165 - 62,854,508 (+) NCBI GRCr8 mRatBN7.2 10 62,342,082 - 62,356,379 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 62,342,299 - 62,356,373 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 66,992,057 - 67,006,179 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 66,497,543 - 66,511,665 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 61,970,798 - 61,984,917 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 62,656,000 - 62,664,467 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 62,656,000 - 62,664,466 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 62,352,883 - 62,362,201 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 66,610,282 - 66,618,919 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 66,623,904 - 66,632,546 (-) NCBI Celera 10 61,351,008 - 61,359,475 (+) NCBI Celera Cytogenetic Map 10 q24 NCBI
GIT1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 17 29,573,475 - 29,589,648 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 17 29,573,475 - 29,594,054 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 17 27,900,493 - 27,916,666 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 17 24,924,613 - 24,940,736 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 17 24,924,619 - 24,940,735 NCBI Celera 17 24,761,352 - 24,777,476 (-) NCBI Celera Cytogenetic Map 17 q11.2 NCBI HuRef 17 24,109,826 - 24,125,786 (-) NCBI HuRef CHM1_1 17 27,963,149 - 27,983,295 (-) NCBI CHM1_1 T2T-CHM13v2.0 17 30,516,351 - 30,532,526 (-) NCBI T2T-CHM13v2.0
Git1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 77,384,114 - 77,398,600 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 77,384,388 - 77,398,612 (+) Ensembl GRCm39 Ensembl GRCm38 11 77,493,288 - 77,507,774 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 77,493,562 - 77,507,786 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 77,306,914 - 77,321,276 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 77,309,607 - 77,323,969 (+) NCBI MGSCv36 mm8 Celera 11 84,991,973 - 85,006,335 (+) NCBI Celera Cytogenetic Map 11 B5 NCBI cM Map 11 46.61 NCBI
Git1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955481 3,670,111 - 3,685,051 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955481 3,671,728 - 3,681,279 (+) NCBI ChiLan1.0 ChiLan1.0
GIT1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 19 34,866,807 - 34,882,933 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 17 36,748,981 - 36,765,176 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 17 27,185,025 - 27,201,146 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 17 27,707,452 - 27,717,857 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 17 27,706,776 - 27,717,857 (+) Ensembl panpan1.1 panPan2
GIT1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 9 43,676,707 - 43,686,566 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 9 43,677,899 - 43,693,177 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 9 42,829,811 - 42,846,296 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 9 44,492,902 - 44,509,385 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 9 44,492,901 - 44,508,582 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 9 43,277,271 - 43,293,743 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 9 43,567,974 - 43,584,445 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 9 43,648,051 - 43,664,538 (-) NCBI UU_Cfam_GSD_1.0
Git1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405602 42,806,717 - 42,827,559 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936538 5,684,644 - 5,695,043 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936538 5,684,660 - 5,694,779 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
GIT1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 12 45,768,176 - 45,783,658 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 12 45,768,172 - 45,783,652 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 12 47,719,221 - 47,730,533 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
GIT1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 16 23,313,629 - 23,329,665 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 16 23,315,439 - 23,329,469 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666075 6,742,731 - 6,758,827 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Git1
.
Predicted Target Of
Count of predictions: 303 Count of miRNA genes: 155 Interacting mature miRNAs: 188 Transcripts: ENSRNOT00000056112 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
61441 Btemp1 Thermal response to stress QTL 1 4 body temperature trait (VT:0005535) core body temperature (CMO:0001036) 10 35392457 63642539 Rat 1549846 Scl47 Serum cholesterol level QTL 47 3.6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 10 50574707 95574707 Rat 152025229 Scl83 Serum cholesterol level QTL 83 4.33 blood cholesterol amount (VT:0000180) 10 35710580 68663659 Rat 1578779 Tcas10 Tongue tumor susceptibility QTL 10 3.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 10 31297439 76297439 Rat 152025227 Bw195 Body weight QTL 195 5.73 body mass (VT:0001259) 10 46989699 68663659 Rat 1298069 Bp168 Blood pressure QTL 168 5.5 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 10 26521957 98003205 Rat 2293669 Bmd33 Bone mineral density QTL 33 4.5 0.0001 femur strength trait (VT:0010010) femoral neck polar moment of inertia (CMO:0001670) 10 49444551 81709989 Rat 152025224 Bw193 Body weight QTL 193 6.47 body mass (VT:0001259) 10 51663405 75085664 Rat 631552 Vetf2 Vascular elastic tissue fragility QTL 2 4.5 0.0002 aorta elastic tissue integrity trait (VT:0010556) artery internal elastic lamina non-tumorous lesion count (CMO:0001913) 10 41142633 86142633 Rat 631554 Bp133 Blood pressure QTL 133 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 743364 63851208 Rat 631557 Bp136 Blood pressure QTL 136 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 30632053 75632053 Rat 61325 Aia5 Adjuvant induced arthritis QTL 5 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1298078 Stresp5 Stress response QTL 5 2.99 0.00025 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 42045676 104670812 Rat 2293679 Bmd30 Bone mineral density QTL 30 3.5 0.0001 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 10 49444551 81709989 Rat 1549831 Bss6 Bone structure and strength QTL 6 4 lumbar vertebra strength trait (VT:0010574) vertebra ultimate force (CMO:0001678) 10 57576521 102576521 Rat 70164 Bw21 Body weight QTL 21 4.36 0.00005 body mass (VT:0001259) body weight (CMO:0000012) 10 53797494 98952626 Rat 61463 Bp12 Blood pressure QTL 12 6.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 41333258 86333258 Rat 8694173 Bw149 Body weight QTL 149 4.38 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 10 44441699 89441699 Rat 2300218 Hpcl2 Hepatic cholesterol level QTL 2 liver cholesterol amount (VT:0010498) liver cholesterol level (CMO:0001597) 10 45029650 95600334 Rat 1554317 Bmd4 Bone mineral density QTL 4 9.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 19816042 99406971 Rat 70171 Cari1 Carrageenan-induced inflammation QTL 1 4.9 0.0005 hypodermis integrity trait (VT:0010550) inflammatory exudate volume (CMO:0001429) 10 53797385 107211142 Rat 1598852 Anxrr19 Anxiety related response QTL 19 5.07 body movement coordination trait (VT:0005424) number of rearing movements in an experimental apparatus (CMO:0001752) 10 18167841 63167841 Rat 724527 Bp148 Blood pressure QTL 148 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 28453136 73453136 Rat 1358897 Stresp6 Stress response QTL 6 4.17 0.022 blood norepinephrine amount (VT:0005663) plasma norepinephrine level (CMO:0001010) 10 35392267 64155584 Rat 1331762 Rf40 Renal function QTL 40 3.873 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 10 29299504 64155584 Rat 2300171 Bmd58 Bone mineral density QTL 58 4.9 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 26944628 71944628 Rat 61354 Pia10 Pristane induced arthritis QTL 10 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2301967 Cm73 Cardiac mass QTL 73 4.55 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 10 14487011 89062041 Rat 2313103 Bss80 Bone structure and strength QTL 80 2 0.0001 tibia strength trait (VT:1000284) tibia midshaft endosteal cross-sectional area (CMO:0001716) 10 62057807 107057807 Rat 2303118 Mamtr7 Mammary tumor resistance QTL 7 0.003 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 9658275 104670812 Rat 70188 BpQTLcluster1 Blood pressure QTL cluster 1 4.864 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 42323132 87323132 Rat 2313105 Bss79 Bone structure and strength QTL 79 1.8 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 10 62057807 107057807 Rat 9589030 Epfw9 Epididymal fat weight QTL 9 19.24 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 10 44441699 89441699 Rat 10402859 Bp381 Blood pressure QTL 381 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 2316949 Gluco60 Glucose level QTL 60 3.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 14487011 107057807 Rat 2293652 Bmd22 Bone mineral density QTL 22 4.9 0.0001 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 10 49444551 81709989 Rat 70198 BpQTLcluster9 Blood pressure QTL cluster 9 2.94 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 42323132 87323132 Rat 2306970 Anxrr22 Anxiety related response QTL 22 5.95 fear/anxiety-related behavior trait (VT:1000241) number of periods of voluntary immobility (CMO:0001045) 10 61345276 98211570 Rat 1359017 Hrtrt21 Heart rate QTL 21 2.4 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 10 51772940 96772940 Rat 2306787 Ean3 Experimental allergic neuritis QTL 3 3.1 nervous system integrity trait (VT:0010566) body weight loss (CMO:0001399) 10 53797385 66979128 Rat 2312672 Insul15 Insulin level QTL 15 0.01 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 10 57134272 102134272 Rat 724556 Pur2 Proteinuria QTL 2 5.5 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 10 22427500 90627625 Rat 8662860 Vetf10 Vascular elastic tissue fragility QTL 10 artery integrity trait (VT:0010639) number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562) 10 6154182 73453136 Rat 61387 Bp1 Blood pressure QTL 1 5.1 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 10 51770177 107211142 Rat 70223 Bp57 Blood pressure QTL 57 5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 1 80676123 Rat 2317043 Aia7 Adjuvant induced arthritis QTL 7 3.82 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 10 37565079 82565079 Rat 2317042 Aia20 Adjuvant induced arthritis QTL 20 3.38 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 10 37565079 82565079 Rat 70363 Bp71 Blood pressure QTL 71 0.04 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 61345276 81714865 Rat 61402 Niddm3 Non-insulin dependent diabetes mellitus QTL 3 4.58 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 61345413 82564856 Rat 1331791 Cm31 Cardiac mass QTL 31 3.84606 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 29299504 107211142 Rat 2313087 Bmd80 Bone mineral density QTL 80 3.2 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 10 19606483 64606483 Rat 70364 Bp72 Blood pressure QTL 72 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 51121100 96121100 Rat 2293698 Bss43 Bone structure and strength QTL 43 5.33 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 10 59209888 104209888 Rat 631530 Tls3 T-lymphoma susceptibility QTL 3 0 0.0001 thymus integrity trait (VT:0010555) percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911) 10 51774612 95600334 Rat 1354608 Cm33 Cardiac mass QTL 33 2.8 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 10 54809292 99809292 Rat 1558643 Cm44 Cardiac mass QTL 44 4.8 0.0000368 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 61345276 99703528 Rat 631535 Cm51 Cardiac mass QTL 51 3 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 10 51786282 91669536 Rat 1576319 Cia29 Collagen induced arthritis QTL 29 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 33973921 78973921 Rat 8552805 Bw145 Body weight QTL 145 2.2 body mass (VT:0001259) change in body weight to body weight ratio (CMO:0002216) 10 41944526 78307017 Rat 631267 Cia20 Collagen induced arthritis QTL 20 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2293705 Bmd25 Bone mineral density QTL 25 7.1 0.0001 femur mineral mass (VT:0010011) compact volumetric bone mineral density (CMO:0001730) 10 49444551 81709989 Rat 1331839 Eae18b Experimental allergic encephalomyelitis QTL 18b 5.8 0.03 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis severity score (CMO:0001419) 10 61248303 67785171 Rat 1576308 Schws1 Schwannoma susceptibility QTL 1 0.0041 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 10 40035094 102359817 Rat 631269 Cia22 Collagen induced arthritis QTL 22 8.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 631268 Cia21 Collagen induced arthritis QTL 21 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 14487011 104060283 Rat 7207811 Bmd90 Bone mineral density QTL 90 5.2 femur size trait (VT:1000369) femoral neck cross-sectional area (CMO:0001697) 10 49444551 81709989 Rat 1576311 Pia26 Pristane induced arthritis QTL 26 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 31224026 75632053 Rat 631270 Cia23 Collagen induced arthritis QTL 23 3.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 7411614 Foco18 Food consumption QTL 18 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 10 44441699 89441699 Rat 631526 Bp76 Blood pressure QTL 76 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 61345413 66743655 Rat 6893336 Cm75 Cardiac mass QTL 75 0.1 0.87 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 10 61345276 99703528 Rat 631547 Bp87 Blood pressure QTL 87 4.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 47369470 92369470 Rat 61427 Cia16 Collagen induced arthritis QTL 16 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 6357896 96121100 Rat 2312662 Slep8 Serum leptin concentration QTL 8 0.05 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 10 57134272 102134272 Rat 6893342 Cm78 Cardiac mass QTL 78 0.1 0.88 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 10 42876766 79813922 Rat 2292441 Bp308 Blood pressure QTL 308 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 2313055 Bw96 Body weight QTL 96 3.6 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 10 19606483 64606483 Rat 631542 Bp82 Blood pressure QTL 82 6.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 26521957 98952741 Rat 2312668 Scl65 Serum cholesterol level QTL 65 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 10 57134272 102134272 Rat
RH128287
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 62,356,158 - 62,356,348 (-) MAPPER mRatBN7.2 Rnor_6.0 10 62,655,702 - 62,655,891 NCBI Rnor6.0 Rnor_5.0 10 62,352,585 - 62,352,774 UniSTS Rnor5.0 RGSC_v3.4 10 66,609,984 - 66,610,173 UniSTS RGSC3.4 Celera 10 61,359,584 - 61,359,773 UniSTS Cytogenetic Map 10 q26 UniSTS
GIT1_9564
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 62,355,753 - 62,356,330 (-) MAPPER mRatBN7.2 Rnor_6.0 10 62,655,720 - 62,656,296 NCBI Rnor6.0 Rnor_5.0 10 62,352,603 - 62,353,179 UniSTS Rnor5.0 RGSC_v3.4 10 66,610,002 - 66,610,578 UniSTS RGSC3.4 Celera 10 61,359,179 - 61,359,755 UniSTS Cytogenetic Map 10 q26 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000078730 ⟹ ENSRNOP00000073267
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 62,342,299 - 62,356,373 (+) Ensembl Rnor_6.0 Ensembl 10 62,656,000 - 62,664,466 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000101598 ⟹ ENSRNOP00000090288
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 62,345,194 - 62,356,050 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000114941 ⟹ ENSRNOP00000091910
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 62,345,194 - 62,356,050 (+) Ensembl
RefSeq Acc Id:
NM_031814 ⟹ NP_114002
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 62,840,394 - 62,854,508 (+) NCBI mRatBN7.2 10 62,342,265 - 62,356,379 (+) NCBI Rnor_6.0 10 62,656,000 - 62,664,467 (-) NCBI Rnor_5.0 10 62,352,883 - 62,362,201 (-) NCBI RGSC_v3.4 10 66,610,282 - 66,618,919 (-) RGD Celera 10 61,351,008 - 61,359,475 (+) RGD
Sequence:
GCCCGCGCCCCCCACGCTGGCCCAGAGGGCTGCGGCCGCTTCGCCGCTGAGGATGTCCCGGAAGGGGCCGCGAGCGGAGGTGTGTGCGGACTGCAGCGCCCCTGACCCTGGCTGGGCATCTATCAGCA
hide sequence
RefSeq Acc Id:
XM_039086946 ⟹ XP_038942874
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 62,840,165 - 62,854,462 (+) NCBI mRatBN7.2 10 62,342,082 - 62,356,379 (+) NCBI
RefSeq Acc Id:
XM_039086947 ⟹ XP_038942875
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 62,840,165 - 62,854,462 (+) NCBI mRatBN7.2 10 62,342,083 - 62,356,379 (+) NCBI
RefSeq Acc Id:
XM_063269971 ⟹ XP_063126041
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 62,840,165 - 62,854,462 (+) NCBI
RefSeq Acc Id:
NP_114002 ⟸ NM_031814
- UniProtKB:
Q9Z272 (UniProtKB/Swiss-Prot), A0A8I6AGH2 (UniProtKB/TrEMBL)
- Sequence:
MSRKGPRAEVCADCSAPDPGWASISRGVLVCDECCSVHRSLGRHISIVKHLRHSAWPPTLLQMVHTLASNGANSIWEHSLLDPAQVQSGRRKANPQDKVHPIKSEFIRAKYQMLAFVHKLPCRDDDGV
hide sequence
Ensembl Acc Id:
ENSRNOP00000073267 ⟸ ENSRNOT00000078730
RefSeq Acc Id:
XP_038942874 ⟸ XM_039086946
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6AGH2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038942875 ⟸ XM_039086947
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I6AGH2 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000090288 ⟸ ENSRNOT00000101598
Ensembl Acc Id:
ENSRNOP00000091910 ⟸ ENSRNOT00000114941
RefSeq Acc Id:
XP_063126041 ⟸ XM_063269971
- Peptide Label:
isoform X3
- UniProtKB:
A0A8I6AGH2 (UniProtKB/TrEMBL)
RGD ID: 13697428 Promoter ID: EPDNEW_R7952 Type: single initiation site Name: Git1_1 Description: GIT ArfGAP 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 10 62,664,455 - 62,664,515 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-03-22
Git1
GIT ArfGAP 1
Git1
G protein-coupled receptor kinase interacting ArfGAP 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-10-23
Git1
G protein-coupled receptor kinase interacting ArfGAP 1
Git1
G protein-coupled receptor kinase interactor 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2004-09-10
Git1
G protein-coupled receptor kinase interactor 1
G protein-coupled receptor kinase-interactor 1
Name updated
1299863 APPROVED
2002-06-10
Git1
G protein-coupled receptor kinase-interactor 1
Name updated
70584 APPROVED
Note Type
Note
Reference
gene_process
GTPase-activating protein (GAP) for the ADP ribosylation factor (ARF) family of small GTP-binding proteins
68782
gene_product
member of G protein-coupled receptor kinase-interacting protein
68782
