Symbol:
EYA2
Name:
EYA transcriptional coactivator and phosphatase 2
RGD ID:
1350703
HGNC Page
HGNC:3520
Description:
Enables histone H2AXY142 phosphatase activity and magnesium ion binding activity. Predicted to be involved in cell differentiation; negative regulation of extrinsic apoptotic signaling pathway in absence of ligand; and positive regulation of DNA repair. Predicted to act upstream of or within apoptotic signaling pathway; protein dephosphorylation; and striated muscle tissue development. Located in cytosol.
Type:
protein-coding
RefSeq Status:
REVIEWED
Previously known as:
EAB1; eyes absent homolog 2; MGC10614
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Mus musculus (house mouse):
Eya2 (EYA transcriptional coactivator and phosphatase 2) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Rattus norvegicus (Norway rat):
Eya2 (EYA transcriptional coactivator and phosphatase 2) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Chinchilla lanigera (long-tailed chinchilla):
Eya2 (EYA transcriptional coactivator and phosphatase 2) NCBI
Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):
EYA2 (EYA transcriptional coactivator and phosphatase 2) NCBI
Ortholog
Canis lupus familiaris (dog):
EYA2 (EYA transcriptional coactivator and phosphatase 2) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Eya2 (EYA transcriptional coactivator and phosphatase 2) NCBI
Ortholog
Sus scrofa (pig):
EYA2 (EYA transcriptional coactivator and phosphatase 2) HGNC
EggNOG, Ensembl, NCBI, OMA, OrthoDB, Panther, Treefam
Chlorocebus sabaeus (green monkey):
EYA2 (EYA transcriptional coactivator and phosphatase 2) NCBI
Ortholog
Heterocephalus glaber (naked mole-rat):
Eya2 (EYA transcriptional coactivator and phosphatase 2) NCBI
Ortholog
Other homologs 2
Mus musculus (house mouse):
Eya4 (EYA transcriptional coactivator and phosphatase 4) HGNC
OrthoMCL
Mus musculus (house mouse):
Eya1 (EYA transcriptional coactivator and phosphatase 1) HGNC
OrthoMCL
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Eya2 (EYA transcriptional coactivator and phosphatase 2)
Alliance
DIOPT (HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Eya2 (EYA transcriptional coactivator and phosphatase 2)
Alliance
DIOPT (HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
eya2 (EYA transcriptional coactivator and phosphatase 2)
Alliance
DIOPT (OMA|OrthoFinder|PANTHER|PhylomeDB|ZFIN)
Drosophila melanogaster (fruit fly):
eya
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
eya-1
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus laevis (African clawed frog):
eya2.S
Alliance
DIOPT (Xenbase)
Xenopus tropicalis (tropical clawed frog):
eya2
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Allele / Splice:
See ClinVar data
Latest Assembly:
GRCh38 - Human Genome Assembly GRCh38
Position:
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 20 46,894,843 - 47,188,844 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 20 46,894,624 - 47,188,844 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 20 45,523,482 - 45,817,492 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 20 44,956,916 - 45,250,899 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 20 45,040,280 - 45,250,897 NCBI Celera 20 42,236,954 - 42,531,188 (+) NCBI Celera Cytogenetic Map 20 q13.12 NCBI HuRef 20 42,266,395 - 42,561,039 (+) NCBI HuRef CHM1_1 20 45,426,259 - 45,720,382 (+) NCBI CHM1_1 T2T-CHM13v2.0 20 48,632,937 - 48,926,940 (+) NCBI T2T-CHM13v2.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
EYA2 Human (-)-epigallocatechin 3-gallate multiple interactions EXP 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of EYA2 mRNA CTD PMID:22079256 EYA2 Human 17alpha-ethynylestradiol multiple interactions ISO Eya2 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of EYA2 mRNA CTD PMID:17942748 EYA2 Human 17alpha-ethynylestradiol increases expression ISO Eya2 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of EYA2 mRNA CTD PMID:17942748 EYA2 Human 17beta-estradiol multiple interactions ISO Eya2 (Rattus norvegicus) 6480464 [bisphenol A co-treated with Estradiol] results in increased expression of EYA2 mRNA CTD PMID:26496021 EYA2 Human 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Eya2 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of EYA2 mRNA CTD PMID:17942748 EYA2 Human 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Eya2 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in increased expression of EYA2 mRNA CTD PMID:33387578 EYA2 Human 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Eya2 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of EYA2 mRNA CTD PMID:34747641 EYA2 Human 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Eya2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of EYA2 mRNA CTD PMID:21570461 EYA2 Human 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of EYA2 mRNA CTD PMID:22298810 EYA2 Human 3,4-methylenedioxymethamphetamine decreases expression ISO Eya2 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of EYA2 mRNA CTD PMID:20188158 EYA2 Human 4,4'-sulfonyldiphenol increases expression ISO Eya2 (Mus musculus) 6480464 bisphenol S results in increased expression of EYA2 mRNA CTD PMID:30951980 EYA2 Human 4,4'-sulfonyldiphenol increases methylation ISO Eya2 (Mus musculus) 6480464 bisphenol S results in increased methylation of EYA2 exon CTD PMID:33297965 EYA2 Human 6-propyl-2-thiouracil decreases expression ISO Eya2 (Rattus norvegicus) 6480464 Propylthiouracil results in decreased expression of EYA2 mRNA CTD PMID:24780913 EYA2 Human acetamide increases expression ISO Eya2 (Rattus norvegicus) 6480464 acetamide results in increased expression of EYA2 mRNA CTD PMID:31881176 EYA2 Human acrylamide increases expression ISO Eya2 (Rattus norvegicus) 6480464 Acrylamide results in increased expression of EYA2 mRNA CTD PMID:28959563 EYA2 Human acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of EYA2 mRNA CTD PMID:32763439 EYA2 Human aflatoxin B1 decreases expression EXP 6480464 Aflatoxin B1 results in decreased expression of EYA2 mRNA CTD PMID:22100608 EYA2 Human aflatoxin B1 decreases methylation EXP 6480464 Aflatoxin B1 results in decreased methylation of EYA2 intron CTD PMID:30157460 EYA2 Human aflatoxin B1 decreases expression ISO Eya2 (Rattus norvegicus) 6480464 Aflatoxin B1 results in decreased expression of EYA2 mRNA CTD PMID:23630614 EYA2 Human all-trans-retinoic acid increases expression ISO Eya2 (Mus musculus) 6480464 Tretinoin results in increased expression of EYA2 mRNA CTD PMID:16604517 EYA2 Human all-trans-retinoic acid increases expression EXP 6480464 Tretinoin results in increased expression of EYA2 mRNA CTD PMID:23830798 EYA2 Human alpha-Zearalanol multiple interactions ISO Eya2 (Rattus norvegicus) 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of EYA2 mRNA CTD PMID:35163327 EYA2 Human ammonium chloride affects expression ISO Eya2 (Rattus norvegicus) 6480464 Ammonium Chloride affects the expression of EYA2 mRNA CTD PMID:16483693 EYA2 Human benzbromarone decreases activity EXP 6480464 Benzbromarone results in decreased activity of EYA2 protein CTD PMID:22545090 EYA2 Human benzo[a]pyrene decreases expression ISO Eya2 (Rattus norvegicus) 6480464 Benzo(a)pyrene results in decreased expression of EYA2 mRNA CTD PMID:21839799 EYA2 Human benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of EYA2 mRNA CTD PMID:32234424 EYA2 Human benzo[a]pyrene decreases methylation EXP 6480464 Benzo(a)pyrene results in decreased methylation of EYA2 promoter CTD PMID:27901495 EYA2 Human benzo[a]pyrene affects methylation EXP 6480464 Benzo(a)pyrene affects the methylation of EYA2 5' UTR CTD PMID:27901495 EYA2 Human benzo[a]pyrene multiple interactions ISO Eya2 (Mus musculus) 6480464 AHR protein affects the reaction [Benzo(a)pyrene affects the expression of EYA2 mRNA] CTD PMID:22228805 EYA2 Human bis(2-chloroethyl) sulfide decreases expression ISO Eya2 (Mus musculus) 6480464 Mustard Gas results in decreased expression of EYA2 mRNA CTD PMID:15674843 EYA2 Human bis(2-ethylhexyl) phthalate multiple interactions ISO Eya2 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of EYA2 mRNA and Diethylhexyl Phthalate inhibits the reaction [[Streptozocin co-treated with Dietary Fats] results in decreased expression of EYA2 mRNA] CTD PMID:33484791 and PMID:39150890 EYA2 Human bisphenol A multiple interactions ISO Eya2 (Rattus norvegicus) 6480464 [bisphenol A co-treated with Estradiol] results in increased expression of EYA2 mRNA CTD PMID:26496021 EYA2 Human bisphenol A decreases methylation EXP 6480464 bisphenol A results in decreased methylation of EYA2 gene CTD PMID:31601247 EYA2 Human bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of EYA2 gene CTD PMID:31601247 EYA2 Human bisphenol A increases expression ISO Eya2 (Mus musculus) 6480464 bisphenol A results in increased expression of EYA2 mRNA CTD PMID:30951980 EYA2 Human bisphenol A decreases expression ISO Eya2 (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of EYA2 mRNA CTD PMID:25181051 more ... EYA2 Human bisphenol F increases expression ISO Eya2 (Mus musculus) 6480464 bisphenol F results in increased expression of EYA2 mRNA CTD PMID:30951980 EYA2 Human bisphenol F multiple interactions EXP 6480464 [bisphenol F co-treated with Fulvestrant] results in decreased methylation of EYA2 gene CTD PMID:31601247 EYA2 Human Butylbenzyl phthalate multiple interactions ISO Eya2 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of EYA2 mRNA CTD PMID:39150890 EYA2 Human cadmium atom increases expression EXP 6480464 Cadmium results in increased expression of EYA2 mRNA CTD PMID:31082426 EYA2 Human cadmium atom multiple interactions EXP 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of EYA2 mRNA CTD PMID:35301059 EYA2 Human cadmium dichloride multiple interactions EXP 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of EYA2 mRNA CTD PMID:35301059 EYA2 Human carbamazepine affects expression EXP 6480464 Carbamazepine affects the expression of EYA2 mRNA CTD PMID:25979313 EYA2 Human CGP 52608 multiple interactions EXP 6480464 CGP 52608 promotes the reaction [RORA protein binds to EYA2 gene] CTD PMID:28238834 EYA2 Human chlorpyrifos decreases expression ISO Eya2 (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of EYA2 mRNA CTD PMID:32715474 EYA2 Human chromium(6+) decreases expression EXP 6480464 chromium hexavalent ion results in decreased expression of EYA2 mRNA CTD PMID:30690063 EYA2 Human chromium(6+) multiple interactions EXP 6480464 [zinc chromate results in increased abundance of chromium hexavalent ion] which results in decreased expression of EYA2 mRNA CTD PMID:38479592 EYA2 Human cocaine affects expression ISO Eya2 (Rattus norvegicus) 6480464 Cocaine affects the expression of EYA2 mRNA CTD PMID:20187946 EYA2 Human crocidolite asbestos decreases expression ISO Eya2 (Mus musculus) 6480464 Asbestos and Crocidolite results in decreased expression of EYA2 mRNA CTD PMID:29279043 EYA2 Human Cuprizon increases expression ISO Eya2 (Rattus norvegicus) 6480464 Cuprizone results in increased expression of EYA2 mRNA CTD PMID:26577399 EYA2 Human cyclosporin A decreases expression EXP 6480464 Cyclosporine results in decreased expression of EYA2 mRNA CTD PMID:20106945 EYA2 Human dibutyl phthalate multiple interactions ISO Eya2 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of EYA2 mRNA CTD PMID:39150890 EYA2 Human diethyl phthalate multiple interactions ISO Eya2 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of EYA2 mRNA CTD PMID:39150890 EYA2 Human diisobutyl phthalate multiple interactions ISO Eya2 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of EYA2 mRNA CTD PMID:39150890 EYA2 Human diisononyl phthalate multiple interactions ISO Eya2 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of EYA2 mRNA CTD PMID:39150890 EYA2 Human dorsomorphin multiple interactions EXP 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of EYA2 mRNA CTD PMID:27188386 EYA2 Human elemental selenium increases expression EXP 6480464 Selenium results in increased expression of EYA2 mRNA CTD PMID:19244175 EYA2 Human fenvalerate increases expression ISO Eya2 (Rattus norvegicus) 6480464 fenvalerate results in increased expression of EYA2 mRNA CTD PMID:30307764 EYA2 Human flavonoids decreases expression ISO Eya2 (Rattus norvegicus) 6480464 Flavonoids results in decreased expression of EYA2 mRNA CTD PMID:18035473 EYA2 Human fulvestrant multiple interactions EXP 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of EYA2 gene and [bisphenol F co-treated with Fulvestrant] results in decreased methylation of EYA2 gene CTD PMID:31601247 EYA2 Human genistein decreases expression ISO Eya2 (Mus musculus) 6480464 Genistein results in decreased expression of EYA2 mRNA CTD PMID:32186404 EYA2 Human glycidol decreases expression ISO Eya2 (Rattus norvegicus) 6480464 glycidol results in decreased expression of EYA2 mRNA CTD PMID:24915197 EYA2 Human glyphosate affects methylation ISO Eya2 (Rattus norvegicus) 6480464 Glyphosate affects the methylation of EYA2 gene CTD PMID:35440735 EYA2 Human methoxychlor affects methylation ISO Eya2 (Rattus norvegicus) 6480464 Methoxychlor affects the methylation of EYA2 gene CTD PMID:35440735 EYA2 Human methylmercury chloride decreases expression EXP 6480464 methylmercuric chloride results in decreased expression of EYA2 mRNA CTD PMID:28001369 EYA2 Human N-Nitrosopyrrolidine decreases expression EXP 6480464 N-Nitrosopyrrolidine results in decreased expression of EYA2 mRNA CTD PMID:32234424 EYA2 Human nickel atom decreases expression EXP 6480464 Nickel results in decreased expression of EYA2 mRNA CTD PMID:24768652 and PMID:25583101 EYA2 Human nickel sulfate decreases expression EXP 6480464 nickel sulfate results in decreased expression of EYA2 mRNA CTD PMID:22714537 EYA2 Human O-methyleugenol decreases expression EXP 6480464 methyleugenol results in decreased expression of EYA2 mRNA CTD PMID:32234424 EYA2 Human paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of EYA2 mRNA CTD PMID:26690555 EYA2 Human paracetamol increases expression ISO Eya2 (Rattus norvegicus) 6480464 Acetaminophen results in increased expression of EYA2 mRNA CTD PMID:33387578 EYA2 Human perfluorooctanoic acid multiple interactions ISO Eya2 (Rattus norvegicus) 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of EYA2 mRNA CTD PMID:35163327 EYA2 Human phenylephrine multiple interactions ISO Eya2 (Rattus norvegicus) 6480464 EYA2 protein inhibits the reaction [Phenylephrine results in increased expression of MYH7 protein] and EYA2 protein inhibits the reaction [Phenylephrine results in increased expression of NPPA protein] CTD PMID:17327491 EYA2 Human phenylmercury acetate decreases expression EXP 6480464 Phenylmercuric Acetate results in decreased expression of EYA2 mRNA CTD PMID:26272509 EYA2 Human phenylmercury acetate multiple interactions EXP 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of EYA2 mRNA CTD PMID:27188386 EYA2 Human potassium chromate multiple interactions EXP 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of EYA2 mRNA CTD PMID:22079256 EYA2 Human potassium chromate decreases expression EXP 6480464 potassium chromate(VI) results in decreased expression of EYA2 mRNA CTD PMID:22079256 and PMID:22714537 EYA2 Human resveratrol multiple interactions EXP 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of EYA2 mRNA CTD PMID:23557933 EYA2 Human retinyl acetate increases expression ISO Eya2 (Mus musculus) 6480464 retinol acetate results in increased expression of EYA2 mRNA CTD PMID:16772331 EYA2 Human SB 431542 multiple interactions EXP 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of EYA2 mRNA CTD PMID:27188386 EYA2 Human selenium atom increases expression EXP 6480464 Selenium results in increased expression of EYA2 mRNA CTD PMID:19244175 EYA2 Human sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of EYA2 mRNA CTD PMID:22714537 EYA2 Human sodium arsenite affects methylation EXP 6480464 sodium arsenite affects the methylation of EYA2 gene CTD PMID:28589171 EYA2 Human Soman increases expression ISO Eya2 (Rattus norvegicus) 6480464 Soman results in increased expression of EYA2 mRNA CTD PMID:19281266 EYA2 Human streptozocin multiple interactions ISO Eya2 (Mus musculus) 6480464 [Streptozocin co-treated with Dietary Fats] results in decreased expression of EYA2 mRNA and Diethylhexyl Phthalate inhibits the reaction [[Streptozocin co-treated with Dietary Fats] results in decreased expression of EYA2 mRNA] CTD PMID:33484791 EYA2 Human titanium dioxide increases expression ISO Eya2 (Mus musculus) 6480464 titanium dioxide results in increased expression of EYA2 mRNA CTD PMID:27760801 EYA2 Human trichloroethene increases expression ISO Eya2 (Rattus norvegicus) 6480464 Trichloroethylene results in increased expression of EYA2 mRNA CTD PMID:33387578 EYA2 Human trichostatin A increases expression EXP 6480464 trichostatin A results in increased expression of EYA2 mRNA CTD PMID:24935251 EYA2 Human trimellitic anhydride decreases expression ISO Eya2 (Mus musculus) 6480464 trimellitic anhydride results in decreased expression of EYA2 mRNA CTD PMID:19042947 EYA2 Human valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of EYA2 mRNA CTD PMID:23179753 and PMID:24383497 EYA2 Human valproic acid affects expression EXP 6480464 Valproic Acid affects the expression of EYA2 mRNA CTD PMID:25979313 EYA2 Human vinclozolin decreases methylation ISO Eya2 (Rattus norvegicus) 6480464 vinclozolin results in decreased methylation of EYA2 gene CTD PMID:31682807 EYA2 Human vitamin E increases expression EXP 6480464 Vitamin E results in increased expression of EYA2 mRNA CTD PMID:19244175
(-)-epigallocatechin 3-gallate (EXP) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3,4-methylenedioxymethamphetamine (ISO) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (ISO) acetamide (ISO) acrylamide (EXP,ISO) aflatoxin B1 (EXP,ISO) all-trans-retinoic acid (EXP,ISO) alpha-Zearalanol (ISO) ammonium chloride (ISO) benzbromarone (EXP) benzo[a]pyrene (EXP,ISO) bis(2-chloroethyl) sulfide (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (EXP,ISO) Butylbenzyl phthalate (ISO) cadmium atom (EXP) cadmium dichloride (EXP) carbamazepine (EXP) CGP 52608 (EXP) chlorpyrifos (ISO) chromium(6+) (EXP) cocaine (ISO) crocidolite asbestos (ISO) Cuprizon (ISO) cyclosporin A (EXP) dibutyl phthalate (ISO) diethyl phthalate (ISO) diisobutyl phthalate (ISO) diisononyl phthalate (ISO) dorsomorphin (EXP) elemental selenium (EXP) fenvalerate (ISO) flavonoids (ISO) fulvestrant (EXP) genistein (ISO) glycidol (ISO) glyphosate (ISO) methoxychlor (ISO) methylmercury chloride (EXP) N-Nitrosopyrrolidine (EXP) nickel atom (EXP) nickel sulfate (EXP) O-methyleugenol (EXP) paracetamol (EXP,ISO) perfluorooctanoic acid (ISO) phenylephrine (ISO) phenylmercury acetate (EXP) potassium chromate (EXP) resveratrol (EXP) retinyl acetate (ISO) SB 431542 (EXP) selenium atom (EXP) sodium arsenite (EXP) Soman (ISO) streptozocin (ISO) titanium dioxide (ISO) trichloroethene (ISO) trichostatin A (EXP) trimellitic anhydride (ISO) valproic acid (EXP) vinclozolin (ISO) vitamin E (EXP)
EYA2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 20 46,894,843 - 47,188,844 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 20 46,894,624 - 47,188,844 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 20 45,523,482 - 45,817,492 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 20 44,956,916 - 45,250,899 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 20 45,040,280 - 45,250,897 NCBI Celera 20 42,236,954 - 42,531,188 (+) NCBI Celera Cytogenetic Map 20 q13.12 NCBI HuRef 20 42,266,395 - 42,561,039 (+) NCBI HuRef CHM1_1 20 45,426,259 - 45,720,382 (+) NCBI CHM1_1 T2T-CHM13v2.0 20 48,632,937 - 48,926,940 (+) NCBI T2T-CHM13v2.0
Eya2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 165,436,892 - 165,613,645 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 165,436,952 - 165,613,647 (+) Ensembl GRCm39 Ensembl GRCm38 2 165,595,028 - 165,771,727 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 165,595,032 - 165,771,727 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 165,480,798 - 165,597,131 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 165,346,503 - 165,462,836 (+) NCBI MGSCv36 mm8 Celera 2 171,595,465 - 171,708,914 (+) NCBI Celera Cytogenetic Map 2 H3 NCBI cM Map 2 85.83 NCBI
Eya2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 174,754,772 - 174,938,035 (+) NCBI GRCr8 mRatBN7.2 3 154,335,598 - 154,519,006 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 154,335,400 - 154,518,793 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 158,214,097 - 158,322,360 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 166,713,095 - 166,821,357 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 164,454,709 - 164,562,989 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 162,285,275 - 162,470,642 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 162,346,490 - 162,470,065 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 168,527,052 - 168,647,898 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 156,731,490 - 156,848,691 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 156,685,847 - 156,746,476 (+) NCBI Celera 3 153,000,284 - 153,109,100 (+) NCBI Celera Cytogenetic Map 3 q42 NCBI
Eya2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955445 10,369,514 - 10,603,953 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955445 10,368,869 - 10,520,246 (-) NCBI ChiLan1.0 ChiLan1.0
EYA2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 21 52,629,651 - 52,923,413 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 20 52,622,756 - 52,916,518 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 20 43,226,621 - 43,520,301 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 20 44,310,517 - 44,603,846 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 20 44,310,451 - 44,607,468 (+) Ensembl panpan1.1 panPan2
EYA2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 24 34,126,086 - 34,308,412 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 24 34,082,197 - 34,308,423 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 24 33,504,631 - 33,767,623 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 24 34,753,206 - 35,017,240 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 24 34,802,105 - 35,017,234 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 24 34,009,635 - 34,272,364 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 24 34,127,141 - 34,390,163 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 24 34,666,914 - 34,930,928 (+) NCBI UU_Cfam_GSD_1.0
Eya2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 190,770,099 - 190,949,251 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936514 6,223,719 - 6,341,326 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936514 6,223,745 - 6,401,985 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
EYA2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 17 48,966,814 - 49,243,739 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 17 48,930,682 - 49,243,789 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 17 54,833,230 - 55,078,393 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
EYA2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 2 16,717,300 - 17,001,893 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 2 16,717,291 - 17,001,703 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666050 65,351,749 - 65,637,914 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Eya2
.
Predicted Target Of
Count of predictions: 2350 Count of miRNA genes: 842 Interacting mature miRNAs: 982 Transcripts: ENST00000317304, ENST00000327619, ENST00000357410, ENST00000458636, ENST00000471081, ENST00000475856, ENST00000479843, ENST00000497062, ENST00000497428 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
597294992 GWAS1391066_H type 2 diabetes mellitus QTL GWAS1391066 (human) 3e-10 type 2 diabetes mellitus 20 46962019 46962020 Human 597250965 GWAS1347039_H BMI-adjusted hip circumference QTL GWAS1347039 (human) 2e-11 BMI-adjusted hip circumference hip circumference (CMO:0000014) 20 46915510 46915511 Human 597250964 GWAS1347038_H BMI-adjusted hip circumference QTL GWAS1347038 (human) 4e-18 BMI-adjusted hip circumference hip circumference (CMO:0000014) 20 46915865 46915866 Human 597250967 GWAS1347041_H BMI-adjusted hip circumference QTL GWAS1347041 (human) 4e-13 BMI-adjusted hip circumference hip circumference (CMO:0000014) 20 46946792 46946793 Human 597250966 GWAS1347040_H BMI-adjusted hip circumference QTL GWAS1347040 (human) 5e-10 BMI-adjusted hip circumference hip circumference (CMO:0000014) 20 46906280 46906281 Human 597025671 GWAS1121745_H triglyceride measurement QTL GWAS1121745 (human) 0.000003 triglyceride measurement blood triglyceride level (CMO:0000118) 20 46975601 46975602 Human 596962176 GWAS1081695_H metabolic syndrome QTL GWAS1081695 (human) 5e-13 metabolic syndrome 20 46975601 46975602 Human 597270415 GWAS1366489_H BMI-adjusted waist circumference QTL GWAS1366489 (human) 2e-08 body size trait (VT:0100005) 20 46939784 46939785 Human 597270414 GWAS1366488_H BMI-adjusted waist circumference QTL GWAS1366488 (human) 4e-09 body size trait (VT:0100005) 20 46910612 46910613 Human 597254585 GWAS1350659_H BMI-adjusted waist-hip ratio QTL GWAS1350659 (human) 1e-08 body size trait (VT:0100005) 20 46915218 46915219 Human 597087159 GWAS1183233_H allergic disease, age at onset QTL GWAS1183233 (human) 4e-09 allergic disease 20 47061144 47061145 Human 597254587 GWAS1350661_H BMI-adjusted waist-hip ratio QTL GWAS1350661 (human) 3e-14 body size trait (VT:0100005) 20 46939784 46939785 Human 597254586 GWAS1350660_H BMI-adjusted waist-hip ratio QTL GWAS1350660 (human) 3e-11 body size trait (VT:0100005) 20 46938867 46938868 Human 597019071 GWAS1115145_H BMI-adjusted waist-hip ratio QTL GWAS1115145 (human) 0.000003 body size trait (VT:0100005) 20 46909795 46909796 Human 597324726 GWAS1420800_H cup-to-disc ratio measurement QTL GWAS1420800 (human) 1e-10 cup-to-disc ratio measurement 20 47168611 47168612 Human 596953017 GWAS1072536_H bone density QTL GWAS1072536 (human) 7e-12 bone density 20 46970869 46970870 Human 597247403 GWAS1343477_H BMI-adjusted waist-hip ratio QTL GWAS1343477 (human) 3e-21 body size trait (VT:0100005) 20 46895000 46895001 Human 597588396 GWAS1645256_H glucose measurement QTL GWAS1645256 (human) 7e-12 glucose measurement blood glucose level (CMO:0000046) 20 46975601 46975602 Human 1300007 BP29_H Blood pressure QTL 29 (human) Blood pressure hypertension susceptibility 20 36536005 62536005 Human 597247405 GWAS1343479_H BMI-adjusted waist-hip ratio QTL GWAS1343479 (human) 9e-13 body size trait (VT:0100005) 20 46928812 46928813 Human 597247404 GWAS1343478_H BMI-adjusted waist-hip ratio QTL GWAS1343478 (human) 3e-16 body size trait (VT:0100005) 20 46903483 46903484 Human 597247406 GWAS1343480_H BMI-adjusted waist-hip ratio QTL GWAS1343480 (human) 2e-08 body size trait (VT:0100005) 20 46915218 46915219 Human 406992506 GWAS641482_H reticulocyte count QTL GWAS641482 (human) 3e-09 reticulocyte quantity (VT:0003135) total reticulocyte count (CMO:0003020) 20 46906280 46906281 Human 597019053 GWAS1115127_H BMI-adjusted waist-hip ratio QTL GWAS1115127 (human) 0.000005 body size trait (VT:0100005) 20 46909795 46909796 Human 597308323 GWAS1404397_H BMI-adjusted hip circumference QTL GWAS1404397 (human) 3e-14 BMI-adjusted hip circumference hip circumference (CMO:0000014) 20 46960620 46960621 Human 597308321 GWAS1404395_H BMI-adjusted hip circumference QTL GWAS1404395 (human) 2e-11 BMI-adjusted hip circumference hip circumference (CMO:0000014) 20 46946792 46946793 Human 597308326 GWAS1404400_H BMI-adjusted hip circumference QTL GWAS1404400 (human) 1e-11 BMI-adjusted hip circumference hip circumference (CMO:0000014) 20 46973398 46973399 Human 407050878 GWAS699854_H lysophosphatidylcholine 20:4 measurement QTL GWAS699854 (human) 0.000003 glycerophosphocholine amount (VT:0011004) 20 47044574 47044575 Human 407073917 GWAS722893_H triglyceride measurement, alcohol drinking QTL GWAS722893 (human) 3e-08 triglyceride measurement, alcohol drinking blood triglyceride level (CMO:0000118) 20 46975601 46975602 Human 597147607 GWAS1243681_H body composition measurement QTL GWAS1243681 (human) 2e-20 body composition measurement 20 46928812 46928813 Human 597367767 GWAS1463841_H waist-hip ratio QTL GWAS1463841 (human) 5e-08 waist-hip ratio waist to hip ratio (WHR) (CMO:0000020) 20 46900932 46900933 Human 597284820 GWAS1380894_H hemoglobin A1 measurement QTL GWAS1380894 (human) 4e-18 hemoglobin A1 measurement 20 46968907 46968908 Human 597019610 GWAS1115684_H BMI-adjusted waist-hip ratio, sex interaction measurement, age at assessment QTL GWAS1115684 (human) 1e-09 body size trait (VT:0100005) 20 46909795 46909796 Human 597163975 GWAS1260049_H non-alcoholic fatty liver disease QTL GWAS1260049 (human) 1e-10 non-alcoholic fatty liver disease 20 46921850 46921851 Human 597263819 GWAS1359893_H BMI-adjusted hip circumference QTL GWAS1359893 (human) 4e-13 BMI-adjusted hip circumference hip circumference (CMO:0000014) 20 46914240 46914241 Human 597030342 GWAS1126416_H waist-hip ratio QTL GWAS1126416 (human) 6e-27 waist-hip ratio waist to hip ratio (WHR) (CMO:0000020) 20 46921850 46921851 Human 597263821 GWAS1359895_H BMI-adjusted hip circumference QTL GWAS1359895 (human) 9e-10 BMI-adjusted hip circumference hip circumference (CMO:0000014) 20 46928812 46928813 Human 597263820 GWAS1359894_H BMI-adjusted hip circumference QTL GWAS1359894 (human) 1e-08 BMI-adjusted hip circumference hip circumference (CMO:0000014) 20 46906280 46906281 Human 597363661 GWAS1459735_H BMI-adjusted waist-hip ratio QTL GWAS1459735 (human) 3e-55 body size trait (VT:0100005) 20 46900932 46900933 Human 597263823 GWAS1359897_H BMI-adjusted hip circumference QTL GWAS1359897 (human) 1e-08 BMI-adjusted hip circumference hip circumference (CMO:0000014) 20 46946792 46946793 Human 597087182 GWAS1183256_H type 2 diabetes mellitus QTL GWAS1183256 (human) 6e-19 type 2 diabetes mellitus 20 46966072 46966073 Human 597163976 GWAS1260050_H non-alcoholic fatty liver disease QTL GWAS1260050 (human) 3e-08 non-alcoholic fatty liver disease 20 46978214 46978215 Human 597030385 GWAS1126459_H waist-hip ratio QTL GWAS1126459 (human) 4e-23 waist-hip ratio waist to hip ratio (WHR) (CMO:0000020) 20 46897482 46897483 Human 597065714 GWAS1161788_H BMI-adjusted waist-hip ratio QTL GWAS1161788 (human) 0.000006 body size trait (VT:0100005) 20 46930192 46930193 Human 597156849 GWAS1252923_H sex hormone-binding globulin measurement QTL GWAS1252923 (human) 0.0000002 sex hormone-binding globulin measurement 20 46965656 46965657 Human 406949929 GWAS598905_H BMI-adjusted waist-hip ratio QTL GWAS598905 (human) 6e-11 body size trait (VT:0100005) 20 46930192 46930193 Human 406949928 GWAS598904_H BMI-adjusted waist-hip ratio QTL GWAS598904 (human) 3e-10 body size trait (VT:0100005) 20 46930192 46930193 Human 597432818 GWAS1528892_H vital capacity QTL GWAS1528892 (human) 4e-08 vital capacity 20 46900932 46900933 Human 597207016 GWAS1303090_H type 2 diabetes mellitus QTL GWAS1303090 (human) 2e-09 type 2 diabetes mellitus 20 46966072 46966073 Human 597242851 GWAS1338925_H BMI-adjusted waist-hip ratio QTL GWAS1338925 (human) 2e-28 body size trait (VT:0100005) 20 46921232 46921233 Human 597242853 GWAS1338927_H BMI-adjusted waist-hip ratio QTL GWAS1338927 (human) 7e-20 body size trait (VT:0100005) 20 46944571 46944575 Human 597242852 GWAS1338926_H BMI-adjusted waist-hip ratio QTL GWAS1338926 (human) 2e-33 body size trait (VT:0100005) 20 46928378 46928379 Human 597147113 GWAS1243187_H triglyceride measurement QTL GWAS1243187 (human) 1e-11 triglyceride measurement blood triglyceride level (CMO:0000118) 20 46967739 46967740 Human 597242855 GWAS1338929_H BMI-adjusted waist-hip ratio QTL GWAS1338929 (human) 3e-08 body size trait (VT:0100005) 20 47099526 47099527 Human 597147112 GWAS1243186_H triglyceride measurement QTL GWAS1243186 (human) 1e-08 body size trait (VT:0100005) blood triglyceride level (CMO:0000118) 20 46921850 46921851 Human 597242854 GWAS1338928_H BMI-adjusted waist-hip ratio QTL GWAS1338928 (human) 5e-19 body size trait (VT:0100005) 20 46960620 46960621 Human 407070915 GWAS719891_H triglyceride measurement, alcohol drinking QTL GWAS719891 (human) 0.0000004 triglyceride measurement, alcohol drinking blood triglyceride level (CMO:0000118) 20 46975601 46975602 Human 597157140 GWAS1253214_H triglyceride:HDL cholesterol ratio QTL GWAS1253214 (human) 3e-11 blood triglyceride amount (VT:0002644) 20 46970451 46970452 Human 596955409 GWAS1074928_H size QTL GWAS1074928 (human) 2e-20 size 20 46903808 46903810 Human 597602067 GWAS1658927_H calcium measurement QTL GWAS1658927 (human) 4e-11 calcium measurement blood calcium level (CMO:0000502) 20 46998212 46998213 Human 597618448 GWAS1675308_H triglyceride measurement QTL GWAS1675308 (human) 2e-11 triglyceride measurement blood triglyceride level (CMO:0000118) 20 46964203 46964204 Human 597168904 GWAS1264978_H BMI-adjusted waist-hip ratio QTL GWAS1264978 (human) 5e-20 body size trait (VT:0100005) 20 46944571 46944575 Human 597168905 GWAS1264979_H BMI-adjusted waist-hip ratio QTL GWAS1264979 (human) 3e-17 body size trait (VT:0100005) 20 46946792 46946793 Human 597168906 GWAS1264980_H BMI-adjusted waist-hip ratio QTL GWAS1264980 (human) 4e-19 body size trait (VT:0100005) 20 46960620 46960621 Human 407048912 GWAS697888_H lysophosphatidylcholine 18:2 measurement QTL GWAS697888 (human) 0.000005 glycerophosphocholine amount (VT:0011004) 20 47044574 47044575 Human 597168907 GWAS1264981_H BMI-adjusted waist-hip ratio QTL GWAS1264981 (human) 2e-08 body size trait (VT:0100005) 20 47099526 47099527 Human 597579529 GWAS1636389_H high density lipoprotein cholesterol measurement QTL GWAS1636389 (human) 5e-12 high density lipoprotein cholesterol measurement blood high density lipoprotein cholesterol level (CMO:0000052) 20 46973999 46974000 Human 597325568 GWAS1421642_H vital capacity QTL GWAS1421642 (human) 5e-28 vital capacity 20 46903483 46903484 Human 597579013 GWAS1635873_H high density lipoprotein cholesterol measurement QTL GWAS1635873 (human) 2e-12 high density lipoprotein cholesterol measurement blood high density lipoprotein cholesterol level (CMO:0000052) 20 46964571 46964572 Human 596953359 GWAS1072878_H respiratory system disease QTL GWAS1072878 (human) 3e-12 respiratory system disease 20 47052639 47052640 Human 597114635 GWAS1210709_H coffee consumption measurement QTL GWAS1210709 (human) 9e-09 coffee consumption measurement 20 47187629 47187630 Human 597168902 GWAS1264976_H BMI-adjusted waist-hip ratio QTL GWAS1264976 (human) 4e-29 body size trait (VT:0100005) 20 46921232 46921233 Human 597168903 GWAS1264977_H BMI-adjusted waist-hip ratio QTL GWAS1264977 (human) 7e-34 body size trait (VT:0100005) 20 46928378 46928379 Human 597159222 GWAS1255296_H open-angle glaucoma QTL GWAS1255296 (human) 1e-09 open-angle glaucoma 20 47159504 47159505 Human 597100349 GWAS1196423_H sex hormone-binding globulin measurement QTL GWAS1196423 (human) 4e-16 sex hormone-binding globulin measurement 20 46928426 46928427 Human 597618995 GWAS1675855_H glaucoma QTL GWAS1675855 (human) 2e-12 glaucoma 20 47175819 47175820 Human 597076281 GWAS1172355_H heel bone mineral density QTL GWAS1172355 (human) 7e-10 heel bone mineral density bone mineral density (CMO:0001226) 20 46976909 46976911 Human 597095725 GWAS1191799_H sex hormone-binding globulin measurement QTL GWAS1191799 (human) 2e-09 sex hormone-binding globulin measurement 20 46921850 46921851 Human 597474142 GWAS1570216_H calcium measurement QTL GWAS1570216 (human) 1e-08 calcium measurement blood calcium level (CMO:0000502) 20 46998212 46998213 Human 597186395 GWAS1282469_H peak expiratory flow QTL GWAS1282469 (human) 3e-08 peak expiratory flow maximum mid-expiratory flow (MMEF) (CMO:0000253) 20 46903808 46903810 Human 597219165 GWAS1315239_H insulin measurement QTL GWAS1315239 (human) 9e-10 insulin measurement pancreatic islet insulin release measurement (CMO:0001216) 20 46953833 46953834 Human 597585746 GWAS1642606_H high density lipoprotein cholesterol measurement QTL GWAS1642606 (human) 2e-13 high density lipoprotein cholesterol measurement blood high density lipoprotein cholesterol level (CMO:0000052) 20 46973999 46974000 Human 597320020 GWAS1416094_H smoking initiation QTL GWAS1416094 (human) 3e-09 smoking initiation 20 47184536 47184537 Human 597097305 GWAS1193379_H sex hormone-binding globulin measurement QTL GWAS1193379 (human) 1e-08 sex hormone-binding globulin measurement 20 46965656 46965657 Human 597315402 GWAS1411476_H BMI-adjusted waist circumference QTL GWAS1411476 (human) 2e-08 body size trait (VT:0100005) 20 46944571 46944575 Human 406933649 GWAS582625_H heel bone mineral density QTL GWAS582625 (human) 5e-45 heel bone mineral density bone mineral density (CMO:0001226) 20 46975781 46975782 Human 597315401 GWAS1411475_H BMI-adjusted waist circumference QTL GWAS1411475 (human) 2e-11 body size trait (VT:0100005) 20 46921850 46921851 Human 406933650 GWAS582626_H heel bone mineral density QTL GWAS582626 (human) 1e-08 heel bone mineral density bone mineral density (CMO:0001226) 20 47173269 47173270 Human 406949015 GWAS597991_H BMI-adjusted waist-hip ratio QTL GWAS597991 (human) 2e-10 body size trait (VT:0100005) 20 46930192 46930193 Human 406949014 GWAS597990_H BMI-adjusted waist-hip ratio QTL GWAS597990 (human) 6e-10 body size trait (VT:0100005) 20 46930192 46930193 Human 597156160 GWAS1252234_H sex hormone-binding globulin measurement QTL GWAS1252234 (human) 0.0000001 sex hormone-binding globulin measurement 20 46965656 46965657 Human 597620037 GWAS1676897_H triglyceride measurement QTL GWAS1676897 (human) 7e-16 triglyceride measurement blood triglyceride level (CMO:0000118) 20 46962019 46962020 Human 597582656 GWAS1639516_H type 2 diabetes mellitus QTL GWAS1639516 (human) 4e-09 type 2 diabetes mellitus 20 46924467 46924468 Human 597582657 GWAS1639517_H type 2 diabetes mellitus QTL GWAS1639517 (human) 5e-24 type 2 diabetes mellitus 20 46967739 46967740 Human 597105526 GWAS1201600_H sex hormone-binding globulin measurement QTL GWAS1201600 (human) 6e-10 sex hormone-binding globulin measurement 20 46965656 46965657 Human 597050743 GWAS1146817_H Eczematoid dermatitis QTL GWAS1146817 (human) 1e-19 Eczematoid dermatitis 20 47052639 47052640 Human 597165437 GWAS1261511_H open-angle glaucoma QTL GWAS1261511 (human) 2e-08 open-angle glaucoma 20 46905414 46905415 Human 597165438 GWAS1261512_H open-angle glaucoma QTL GWAS1261512 (human) 2e-08 open-angle glaucoma 20 47185401 47185402 Human 597146993 GWAS1243067_H smoking initiation QTL GWAS1243067 (human) 7e-13 smoking initiation 20 47187629 47187630 Human 597255550 GWAS1351624_H serum alanine aminotransferase measurement QTL GWAS1351624 (human) 2e-10 serum alanine aminotransferase measurement serum alanine aminotransferase activity level (CMO:0000575) 20 46928426 46928427 Human 597531510 GWAS1627584_H hip geometry QTL GWAS1627584 (human) 5e-09 hip geometry hip circumference (CMO:0000014) 20 46929170 46929171 Human 597051258 GWAS1147332_H adolescent idiopathic scoliosis QTL GWAS1147332 (human) 4e-14 adolescent idiopathic scoliosis 20 47156382 47156383 Human 597455217 GWAS1551291_H BMI-adjusted waist-hip ratio QTL GWAS1551291 (human) 7e-33 body size trait (VT:0100005) 20 46900932 46900933 Human 597167976 GWAS1264050_H aspartate aminotransferase measurement QTL GWAS1264050 (human) 1e-08 aspartate aminotransferase measurement blood aspartate aminotransferase activity level (CMO:0000580) 20 46928812 46928813 Human 597212524 GWAS1308598_H heel bone mineral density QTL GWAS1308598 (human) 9e-44 heel bone mineral density bone mineral density (CMO:0001226) 20 46976909 46976911 Human 597249889 GWAS1345963_H BMI-adjusted waist-hip ratio QTL GWAS1345963 (human) 2e-09 body size trait (VT:0100005) 20 46946792 46946793 Human 597035374 GWAS1131448_H type 2 diabetes mellitus QTL GWAS1131448 (human) 2e-11 type 2 diabetes mellitus 20 46969925 46969926 Human 597249888 GWAS1345962_H BMI-adjusted waist-hip ratio QTL GWAS1345962 (human) 6e-14 body size trait (VT:0100005) 20 46937272 46937273 Human 597065064 GWAS1161138_H BMI-adjusted waist-hip ratio, physical activity measurement QTL GWAS1161138 (human) 0.000006 wellness/fitness trait (VT:1000152) voluntary body movement measurement (CMO:0000954) 20 46941157 46941158 Human 597065065 GWAS1161139_H BMI-adjusted waist-hip ratio, physical activity measurement QTL GWAS1161139 (human) 4e-08 wellness/fitness trait (VT:1000152) voluntary body movement measurement (CMO:0000954) 20 46941157 46941158 Human 597274776 GWAS1370850_H high density lipoprotein cholesterol measurement QTL GWAS1370850 (human) 1e-08 high density lipoprotein cholesterol measurement blood high density lipoprotein cholesterol level (CMO:0000052) 20 46970451 46970452 Human 597254811 GWAS1350885_H aspartate aminotransferase measurement QTL GWAS1350885 (human) 7e-10 aspartate aminotransferase measurement blood aspartate aminotransferase activity level (CMO:0000580) 20 46928812 46928813 Human 597620886 GWAS1677746_H open-angle glaucoma QTL GWAS1677746 (human) 3e-11 open-angle glaucoma 20 47182210 47182211 Human 597251216 GWAS1347290_H BMI-adjusted hip circumference QTL GWAS1347290 (human) 2e-10 BMI-adjusted hip circumference hip circumference (CMO:0000014) 20 47165013 47165014 Human 597055644 GWAS1151718_H BMI-adjusted waist-hip ratio QTL GWAS1151718 (human) 3e-10 body size trait (VT:0100005) 20 47112325 47112326 Human 597055645 GWAS1151719_H BMI-adjusted waist-hip ratio QTL GWAS1151719 (human) 6e-13 body size trait (VT:0100005) 20 47169235 47169236 Human 597055642 GWAS1151716_H BMI-adjusted waist-hip ratio QTL GWAS1151716 (human) 6e-18 body size trait (VT:0100005) 20 46960622 46960623 Human 597041306 GWAS1137380_H triglyceride measurement QTL GWAS1137380 (human) 1e-10 triglyceride measurement blood triglyceride level (CMO:0000118) 20 46978214 46978215 Human 597055643 GWAS1151717_H BMI-adjusted waist-hip ratio QTL GWAS1151717 (human) 7e-12 body size trait (VT:0100005) 20 46915218 46915219 Human 597055641 GWAS1151715_H BMI-adjusted waist-hip ratio QTL GWAS1151715 (human) 4e-32 body size trait (VT:0100005) 20 46941020 46941021 Human 597251209 GWAS1347283_H BMI-adjusted hip circumference QTL GWAS1347283 (human) 1e-22 BMI-adjusted hip circumference hip circumference (CMO:0000014) 20 46928378 46928379 Human 597251208 GWAS1347282_H BMI-adjusted hip circumference QTL GWAS1347282 (human) 1e-13 BMI-adjusted hip circumference hip circumference (CMO:0000014) 20 46928812 46928813 Human 597251210 GWAS1347284_H BMI-adjusted hip circumference QTL GWAS1347284 (human) 6e-09 BMI-adjusted hip circumference hip circumference (CMO:0000014) 20 46944571 46944575 Human 597035653 GWAS1131727_H triglyceride measurement QTL GWAS1131727 (human) 2e-15 triglyceride measurement blood triglyceride level (CMO:0000118) 20 46970451 46970452 Human 597251213 GWAS1347287_H BMI-adjusted hip circumference QTL GWAS1347287 (human) 2e-14 BMI-adjusted hip circumference hip circumference (CMO:0000014) 20 46957616 46957617 Human 597251212 GWAS1347286_H BMI-adjusted hip circumference QTL GWAS1347286 (human) 3e-13 BMI-adjusted hip circumference hip circumference (CMO:0000014) 20 46946792 46946793 Human 597251215 GWAS1347289_H BMI-adjusted hip circumference QTL GWAS1347289 (human) 2e-08 BMI-adjusted hip circumference hip circumference (CMO:0000014) 20 47000868 47000869 Human 597251214 GWAS1347288_H BMI-adjusted hip circumference QTL GWAS1347288 (human) 4e-16 BMI-adjusted hip circumference hip circumference (CMO:0000014) 20 46973398 46973399 Human 597065352 GWAS1161426_H BMI-adjusted waist-hip ratio QTL GWAS1161426 (human) 6e-09 body size trait (VT:0100005) 20 46930192 46930193 Human 597251206 GWAS1347280_H BMI-adjusted hip circumference QTL GWAS1347280 (human) 7e-20 BMI-adjusted hip circumference hip circumference (CMO:0000014) 20 46898021 46898022 Human 597166266 GWAS1262340_H type 2 diabetes mellitus QTL GWAS1262340 (human) 5e-11 type 2 diabetes mellitus 20 46966814 46966815 Human 597058736 GWAS1154810_H BMI-adjusted waist circumference QTL GWAS1154810 (human) 7e-09 body size trait (VT:0100005) 20 46928830 46928831 Human 597308083 GWAS1404157_H BMI-adjusted hip circumference QTL GWAS1404157 (human) 3e-15 BMI-adjusted hip circumference hip circumference (CMO:0000014) 20 46928812 46928813 Human 597467319 GWAS1563393_H waist-hip ratio QTL GWAS1563393 (human) 2e-30 waist-hip ratio waist to hip ratio (WHR) (CMO:0000020) 20 46900932 46900933 Human 597044413 GWAS1140487_H myelodysplastic syndrome QTL GWAS1140487 (human) 7e-08 myelodysplastic syndrome 20 47077153 47077154 Human 597308084 GWAS1404158_H BMI-adjusted hip circumference QTL GWAS1404158 (human) 2e-20 BMI-adjusted hip circumference hip circumference (CMO:0000014) 20 46928378 46928379 Human 597308085 GWAS1404159_H BMI-adjusted hip circumference QTL GWAS1404159 (human) 1e-09 BMI-adjusted hip circumference hip circumference (CMO:0000014) 20 46944571 46944575 Human 597224104 GWAS1320178_H BMI-adjusted waist circumference QTL GWAS1320178 (human) 1e-11 body size trait (VT:0100005) 20 46944571 46944575 Human 597261487 GWAS1357561_H high density lipoprotein cholesterol measurement QTL GWAS1357561 (human) 4e-12 high density lipoprotein cholesterol measurement blood high density lipoprotein cholesterol level (CMO:0000052) 20 46973999 46974000 Human 597058735 GWAS1154809_H BMI-adjusted waist circumference QTL GWAS1154809 (human) 2e-18 body size trait (VT:0100005) 20 46897482 46897483 Human 597056687 GWAS1152761_H allergic rhinitis QTL GWAS1152761 (human) 5e-11 allergic rhinitis 20 47053702 47053703 Human 406998910 GWAS647886_H reticulocyte measurement QTL GWAS647886 (human) 4e-09 reticulocyte morphology trait (VT:0002424) red blood cell measurement (CMO:0001356) 20 46906280 46906281 Human 597265575 GWAS1361649_H cup-to-disc ratio measurement QTL GWAS1361649 (human) 3e-13 cup-to-disc ratio measurement 20 47168014 47168015 Human 597224103 GWAS1320177_H BMI-adjusted waist circumference QTL GWAS1320177 (human) 4e-14 body size trait (VT:0100005) 20 46921850 46921851 Human 597190872 GWAS1286946_H sex hormone-binding globulin measurement QTL GWAS1286946 (human) 2e-09 sex hormone-binding globulin measurement 20 46965656 46965657 Human 597292251 GWAS1388325_H respiratory system disease QTL GWAS1388325 (human) 3e-12 respiratory system disease 20 47052639 47052640 Human 597097695 GWAS1193769_H sex hormone-binding globulin measurement QTL GWAS1193769 (human) 4e-10 sex hormone-binding globulin measurement 20 46928426 46928427 Human 406969615 GWAS618591_H triglyceride measurement, trait in response to hydrochlorothiazide QTL GWAS618591 (human) 0.000004 triglyceride measurement, trait in response to hydrochlorothiazide blood triglyceride level (CMO:0000118) 20 47051863 47051864 Human 597291734 GWAS1387808_H size QTL GWAS1387808 (human) 2e-20 size 20 46903808 46903810 Human 597289677 GWAS1385751_H body weight QTL GWAS1385751 (human) 1e-08 body mass (VT:0001259) body weight (CMO:0000012) 20 46897768 46897769 Human 597460683 GWAS1556757_H waist-hip ratio QTL GWAS1556757 (human) 2e-17 waist-hip ratio waist to hip ratio (WHR) (CMO:0000020) 20 47161314 47161315 Human 597620471 GWAS1677331_H triglyceride measurement QTL GWAS1677331 (human) 1e-15 triglyceride measurement blood triglyceride level (CMO:0000118) 20 46964203 46964204 Human 597594356 GWAS1651216_H calcium measurement QTL GWAS1651216 (human) 3e-14 calcium measurement blood calcium level (CMO:0000502) 20 46998212 46998213 Human 597070074 GWAS1166148_H smoking behavior, BMI-adjusted waist-hip ratio QTL GWAS1166148 (human) 0.0000003 body size trait (VT:0100005) 20 46930192 46930193 Human 597035256 GWAS1131330_H heel bone mineral density QTL GWAS1131330 (human) 2e-12 heel bone mineral density bone mineral density (CMO:0001226) 20 46949739 46949740 Human 597035257 GWAS1131331_H heel bone mineral density QTL GWAS1131331 (human) 8e-39 heel bone mineral density bone mineral density (CMO:0001226) 20 46975781 46975782 Human 597175530 GWAS1271604_H vital capacity QTL GWAS1271604 (human) 7e-11 vital capacity 20 46943721 46943722 Human 597075682 GWAS1171756_H heel bone mineral density QTL GWAS1171756 (human) 0.000001 heel bone mineral density bone mineral density (CMO:0001226) 20 46976909 46976911 Human 597019360 GWAS1115434_H BMI-adjusted waist-hip ratio QTL GWAS1115434 (human) 4e-10 body size trait (VT:0100005) 20 46909795 46909796 Human 407110962 GWAS759938_H waist-hip ratio QTL GWAS759938 (human) 2e-50 waist-hip ratio waist to hip ratio (WHR) (CMO:0000020) 20 46923095 46923096 Human 597270255 GWAS1366329_H type 2 diabetes mellitus QTL GWAS1366329 (human) 7e-10 type 2 diabetes mellitus 20 46967739 46967740 Human 407110963 GWAS759939_H waist-hip ratio QTL GWAS759939 (human) 1e-12 waist-hip ratio waist to hip ratio (WHR) (CMO:0000020) 20 47129619 47129620 Human 597205216 GWAS1301290_H open-angle glaucoma QTL GWAS1301290 (human) 1e-08 open-angle glaucoma 20 46905414 46905415 Human 597029101 GWAS1125175_H BMI-adjusted waist-hip ratio QTL GWAS1125175 (human) 4e-43 body size trait (VT:0100005) 20 46907424 46907425 Human 597106413 GWAS1202487_H reticulocyte count QTL GWAS1202487 (human) 2e-09 reticulocyte quantity (VT:0003135) total reticulocyte count (CMO:0003020) 20 46906280 46906281 Human 597075179 GWAS1171253_H heel bone mineral density QTL GWAS1171253 (human) 1e-16 heel bone mineral density bone mineral density (CMO:0001226) 20 46976909 46976911 Human 597209114 GWAS1305188_H triglyceride measurement, body fat percentage QTL GWAS1305188 (human) 2e-12 body fat mass (VT:0010482) body fat percentage (CMO:0000302) 20 46964203 46964204 Human 597341212 GWAS1437286_H serum alanine aminotransferase measurement QTL GWAS1437286 (human) 4e-11 serum alanine aminotransferase measurement serum alanine aminotransferase activity level (CMO:0000575) 20 46928426 46928427 Human 597269010 GWAS1365084_H triglyceride measurement QTL GWAS1365084 (human) 3e-19 triglyceride measurement blood triglyceride level (CMO:0000118) 20 46966072 46966073 Human 597074443 GWAS1170517_H infant intracranial volume measurement QTL GWAS1170517 (human) 0.0000008 cranium size trait (VT:0010613) 20 47023438 47023439 Human 596963338 GWAS1082857_H type 2 diabetes mellitus QTL GWAS1082857 (human) 3e-10 type 2 diabetes mellitus 20 46962019 46962020 Human 597229625 GWAS1325699_H heel bone mineral density QTL GWAS1325699 (human) 6e-44 heel bone mineral density bone mineral density (CMO:0001226) 20 46976389 46976411 Human 597252152 GWAS1348226_H BMI-adjusted waist-hip ratio QTL GWAS1348226 (human) 6e-13 body size trait (VT:0100005) 20 46928812 46928813 Human 597229624 GWAS1325698_H heel bone mineral density QTL GWAS1325698 (human) 4e-19 heel bone mineral density bone mineral density (CMO:0001226) 20 46948268 46948269 Human 597169721 GWAS1265795_H serum alanine aminotransferase measurement QTL GWAS1265795 (human) 3e-09 serum alanine aminotransferase measurement serum alanine aminotransferase activity level (CMO:0000575) 20 46973999 46974000 Human 597133872 GWAS1229946_H waist-hip ratio QTL GWAS1229946 (human) 1e-08 waist-hip ratio waist to hip ratio (WHR) (CMO:0000020) 20 46930098 46930099 Human 597090878 GWAS1186952_H type 2 diabetes mellitus QTL GWAS1186952 (human) 2e-18 type 2 diabetes mellitus 20 46966072 46966073 Human 597070906 GWAS1166980_H smoking behavior, BMI-adjusted waist-hip ratio QTL GWAS1166980 (human) 0.0000002 body size trait (VT:0100005) 20 46930192 46930193 Human 597117499 GWAS1213573_H mathematical ability QTL GWAS1213573 (human) 2e-09 mathematical ability 20 47131444 47131445 Human 597314615 GWAS1410689_H triglyceride measurement QTL GWAS1410689 (human) 2e-14 triglyceride measurement blood triglyceride level (CMO:0000118) 20 46966072 46966073 Human 597270068 GWAS1366142_H type 2 diabetes mellitus QTL GWAS1366142 (human) 8e-11 type 2 diabetes mellitus 20 46967739 46967740 Human 597252151 GWAS1348225_H BMI-adjusted waist-hip ratio QTL GWAS1348225 (human) 4e-16 body size trait (VT:0100005) 20 46903483 46903484 Human 597070905 GWAS1166979_H smoking behavior, BMI-adjusted waist-hip ratio QTL GWAS1166979 (human) 1e-08 body size trait (VT:0100005) 20 46930192 46930193 Human 597298217 GWAS1394291_H cardiac troponin T measurement QTL GWAS1394291 (human) 0.000002 cardiac troponin T measurement blood troponin T level (CMO:0001284) 20 47114062 47114063 Human 597458472 GWAS1554546_H BMI-adjusted waist-hip ratio QTL GWAS1554546 (human) 2e-33 body size trait (VT:0100005) 20 46900932 46900933 Human 597277221 GWAS1373295_H insomnia QTL GWAS1373295 (human) 4e-13 insomnia 20 47160340 47160341 Human 597096535 GWAS1192609_H sex hormone-binding globulin measurement QTL GWAS1192609 (human) 0.0000001 sex hormone-binding globulin measurement 20 46921850 46921851 Human 597190747 GWAS1286821_H sex hormone-binding globulin measurement QTL GWAS1286821 (human) 8e-09 sex hormone-binding globulin measurement 20 46928830 46928831 Human 597247568 GWAS1343642_H BMI-adjusted waist-hip ratio QTL GWAS1343642 (human) 5e-11 body size trait (VT:0100005) 20 46938867 46938868 Human 597057119 GWAS1153193_H Eczematoid dermatitis, allergic rhinitis QTL GWAS1153193 (human) 7e-16 Eczematoid dermatitis, allergic rhinitis 20 47055837 47055838 Human 597064796 GWAS1160870_H type 2 diabetes mellitus QTL GWAS1160870 (human) 0.000005 type 2 diabetes mellitus 20 47129016 47129017 Human 597145692 GWAS1241766_H posterior thigh muscle fat infiltration measurement QTL GWAS1241766 (human) 6e-11 posterior thigh muscle fat infiltration measurement 20 46928830 46928831 Human 597272148 GWAS1368222_H triglyceride measurement QTL GWAS1368222 (human) 3e-28 triglyceride measurement blood triglyceride level (CMO:0000118) 20 46966072 46966073 Human 597065816 GWAS1161890_H triglyceride measurement QTL GWAS1161890 (human) 2e-09 triglyceride measurement blood triglyceride level (CMO:0000118) 20 46968907 46968908 Human 597399636 GWAS1495710_H BMI-adjusted hip circumference QTL GWAS1495710 (human) 8e-17 BMI-adjusted hip circumference hip circumference (CMO:0000014) 20 46900932 46900933 Human 597051481 GWAS1147555_H triglyceride measurement, physical activity QTL GWAS1147555 (human) 2e-10 triglyceride measurement, physical activity blood triglyceride level (CMO:0000118) 20 46975185 46975186 Human 597251141 GWAS1347215_H BMI-adjusted hip circumference QTL GWAS1347215 (human) 3e-08 BMI-adjusted hip circumference hip circumference (CMO:0000014) 20 47129016 47129017 Human 597468277 GWAS1564351_H BMI-adjusted waist-hip ratio QTL GWAS1564351 (human) 4e-58 body size trait (VT:0100005) 20 46900932 46900933 Human 407305133 GWAS954109_H asthma QTL GWAS954109 (human) 2e-08 asthma 20 47053149 47053150 Human 597117049 GWAS1213123_H mathematical ability QTL GWAS1213123 (human) 5e-09 mathematical ability 20 47131444 47131445 Human 597157478 GWAS1253552_H triglyceride:HDL cholesterol ratio QTL GWAS1253552 (human) 4e-12 blood triglyceride amount (VT:0002644) 20 46970451 46970452 Human 597062243 GWAS1158317_H BMI-adjusted waist-hip ratio, physical activity measurement QTL GWAS1158317 (human) 3e-08 wellness/fitness trait (VT:1000152) voluntary body movement measurement (CMO:0000954) 20 46930192 46930193 Human 597320300 GWAS1416374_H otosclerosis QTL GWAS1416374 (human) 5e-08 otosclerosis 20 46941020 46941021 Human 597588579 GWAS1645439_H glucose measurement QTL GWAS1645439 (human) 4e-14 glucose measurement blood glucose level (CMO:0000046) 20 46964203 46964204 Human
WI-14748
Human Assembly Chr Position (strand) Source JBrowse GRCh37 20 45,817,349 - 45,817,477 UniSTS GRCh37 Build 36 20 45,250,756 - 45,250,884 RGD NCBI36 Celera 20 42,531,045 - 42,531,173 RGD Cytogenetic Map 20 q13.1 UniSTS HuRef 20 42,560,896 - 42,561,024 UniSTS GeneMap99-GB4 RH Map 20 261.05 UniSTS GeneMap99-GB4 RH Map 20 263.98 UniSTS Whitehead-RH Map 20 298.1 UniSTS NCBI RH Map 20 487.3 UniSTS
D20S1107
Human Assembly Chr Position (strand) Source JBrowse GRCh37 20 45,746,492 - 45,746,685 UniSTS GRCh37 Build 36 20 45,179,899 - 45,180,092 RGD NCBI36 Celera 20 42,460,212 - 42,460,405 RGD Cytogenetic Map 20 q13.1 UniSTS HuRef 20 42,489,879 - 42,490,072 UniSTS GeneMap99-GB4 RH Map 20 268.73 UniSTS GeneMap99-G3 RH Map 20 2399.0 UniSTS
SHGC-8524
Human Assembly Chr Position (strand) Source JBrowse GRCh37 20 45,660,869 - 45,660,979 UniSTS GRCh37 Build 36 20 45,094,276 - 45,094,386 RGD NCBI36 Celera 20 42,374,616 - 42,374,726 RGD Cytogenetic Map 20 q13.1 UniSTS HuRef 20 42,404,008 - 42,404,118 UniSTS Stanford-G3 RH Map 20 2366.0 UniSTS NCBI RH Map 20 484.1 UniSTS
D20S796
Human Assembly Chr Position (strand) Source JBrowse GRCh37 20 45,687,720 - 45,687,886 UniSTS GRCh37 Build 36 20 45,121,127 - 45,121,293 RGD NCBI36 Celera 20 42,401,441 - 42,401,607 RGD Cytogenetic Map 20 q13.1 UniSTS HuRef 20 42,430,839 - 42,431,005 UniSTS
G05261
Human Assembly Chr Position (strand) Source JBrowse GRCh37 20 45,809,921 - 45,810,020 UniSTS GRCh37 Build 36 20 45,243,328 - 45,243,427 RGD NCBI36 Celera 20 42,523,633 - 42,523,732 RGD Cytogenetic Map 20 q13.1 UniSTS HuRef 20 42,553,486 - 42,553,585 UniSTS
RH16187
Human Assembly Chr Position (strand) Source JBrowse GRCh37 20 45,664,307 - 45,664,436 UniSTS GRCh37 Build 36 20 45,097,714 - 45,097,843 RGD NCBI36 Celera 20 42,378,054 - 42,378,183 RGD Cytogenetic Map 20 q13.1 UniSTS HuRef 20 42,407,446 - 42,407,575 UniSTS
SHGC-145586
Human Assembly Chr Position (strand) Source JBrowse GRCh37 20 45,537,477 - 45,537,762 UniSTS GRCh37 Build 36 20 44,970,884 - 44,971,169 RGD NCBI36 Celera 20 42,251,165 - 42,251,446 RGD Cytogenetic Map 20 q13.1 UniSTS HuRef 20 42,280,611 - 42,280,897 UniSTS TNG Radiation Hybrid Map 20 21330.0 UniSTS
G01530
Human Assembly Chr Position (strand) Source JBrowse GRCh37 20 45,760,431 - 45,760,583 UniSTS GRCh37 Build 36 20 45,193,838 - 45,193,990 RGD NCBI36 Celera 20 42,474,152 - 42,474,304 RGD Cytogenetic Map 20 q13.1 UniSTS HuRef 20 42,503,820 - 42,503,972 UniSTS
AL021632
Human Assembly Chr Position (strand) Source JBrowse GRCh37 20 45,682,631 - 45,682,814 UniSTS GRCh37 Build 36 20 45,116,038 - 45,116,221 RGD NCBI36 Celera 20 42,396,351 - 42,396,534 RGD Cytogenetic Map 20 q13.1 UniSTS HuRef 20 42,425,753 - 42,425,936 UniSTS
EYA2_8337
Human Assembly Chr Position (strand) Source JBrowse GRCh37 20 45,816,769 - 45,817,581 UniSTS GRCh37 Build 36 20 45,250,176 - 45,250,988 RGD NCBI36 Celera 20 42,530,465 - 42,531,277 RGD HuRef 20 42,560,316 - 42,561,128 UniSTS
D20S817
Human Assembly Chr Position (strand) Source JBrowse GRCh37 20 45,687,791 - 45,687,923 UniSTS GRCh37 Build 36 20 45,121,198 - 45,121,330 RGD NCBI36 Celera 20 42,401,512 - 42,401,644 RGD Cytogenetic Map 20 q13.1 UniSTS HuRef 20 42,430,910 - 42,431,042 UniSTS
D20S797
Human Assembly Chr Position (strand) Source JBrowse GRCh37 20 45,687,867 - 45,688,028 UniSTS GRCh37 Build 36 20 45,121,274 - 45,121,435 RGD NCBI36 Celera 20 42,401,588 - 42,401,749 RGD Cytogenetic Map 20 q13.1 UniSTS HuRef 20 42,430,986 - 42,431,147 UniSTS
AL021631
Human Assembly Chr Position (strand) Source JBrowse GRCh37 20 45,764,828 - 45,764,951 UniSTS GRCh37 Build 36 20 45,198,235 - 45,198,358 RGD NCBI36 Celera 20 42,478,547 - 42,478,670 RGD Cytogenetic Map 20 q13.1 UniSTS HuRef 20 42,508,218 - 42,508,341 UniSTS
D20S791
Human Assembly Chr Position (strand) Source JBrowse GRCh37 20 45,687,546 - 45,687,671 UniSTS GRCh37 Build 36 20 45,120,953 - 45,121,078 RGD NCBI36 Celera 20 42,401,267 - 42,401,392 RGD Cytogenetic Map 20 q13.1 UniSTS HuRef 20 42,430,665 - 42,430,790 UniSTS TNG Radiation Hybrid Map 10 30673.0 UniSTS TNG Radiation Hybrid Map 20 21422.0 UniSTS Stanford-G3 RH Map 20 2362.0 UniSTS NCBI RH Map 20 484.1 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
entire extraembryonic component
1204
2340
2788
2227
4899
1694
2257
3
601
1529
440
2233
6767
6049
37
3687
1
826
1708
1549
173
1
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENST00000317304 ⟹ ENSP00000321590
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 20 46,990,001 - 47,188,136 (+) Ensembl
Ensembl Acc Id:
ENST00000327619 ⟹ ENSP00000333640
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 20 46,894,843 - 47,188,844 (+) Ensembl
Ensembl Acc Id:
ENST00000357410 ⟹ ENSP00000349986
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 20 46,894,624 - 47,188,844 (+) Ensembl
Ensembl Acc Id:
ENST00000458636 ⟹ ENSP00000395427
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 20 47,001,460 - 47,143,149 (+) Ensembl
Ensembl Acc Id:
ENST00000471081
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 20 46,979,692 - 46,990,025 (+) Ensembl
Ensembl Acc Id:
ENST00000475856
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 20 47,089,239 - 47,096,080 (+) Ensembl
Ensembl Acc Id:
ENST00000479843
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 20 46,979,483 - 46,990,025 (+) Ensembl
Ensembl Acc Id:
ENST00000497062 ⟹ ENSP00000417105
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 20 46,894,870 - 47,188,844 (+) Ensembl
Ensembl Acc Id:
ENST00000497428
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 20 46,978,235 - 46,990,070 (+) Ensembl
Ensembl Acc Id:
ENST00000611592 ⟹ ENSP00000483392
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 20 46,894,624 - 47,188,844 (+) Ensembl
RefSeq Acc Id:
NM_005244 ⟹ NP_005235
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 20 46,894,843 - 47,188,844 (+) NCBI GRCh37 20 45,523,263 - 45,817,492 (+) ENTREZGENE Build 36 20 44,956,916 - 45,250,899 (+) NCBI Archive HuRef 20 42,266,395 - 42,561,039 (+) ENTREZGENE CHM1_1 20 45,426,259 - 45,720,382 (+) NCBI T2T-CHM13v2.0 20 48,632,937 - 48,926,940 (+) NCBI
Sequence:
AGCAGCCGCGGCAGCCCAGGAGGCGGAGGCAGCGGCAACGGCAGAGACAGCAACGTGCCCGCCGCAGTCAGCCCGGCCTCGTCGGACCCGCACCGGCCCGCCCGCCCGCCCGCACCGCGTCGGGGCGC
hide sequence
RefSeq Acc Id:
NM_172110 ⟹ NP_742108
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 20 46,894,843 - 47,188,844 (+) NCBI GRCh37 20 45,523,263 - 45,817,492 (+) ENTREZGENE Build 36 20 44,956,916 - 45,250,899 (+) NCBI Archive HuRef 20 42,266,395 - 42,561,039 (+) ENTREZGENE CHM1_1 20 45,426,259 - 45,720,382 (+) NCBI T2T-CHM13v2.0 20 48,632,937 - 48,926,940 (+) NCBI
Sequence:
AGCAGCCGCGGCAGCCCAGGAGGCGGAGGCAGCGGCAACGGCAGAGACAGCAACGTGCCCGCCG
hide sequence
RefSeq Acc Id:
XM_005260327 ⟹ XP_005260384
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 20 46,894,843 - 47,188,844 (+) NCBI GRCh37 20 45,523,263 - 45,817,492 (+) NCBI
Sequence:
CGCACCGGCCCGCCCGCCCGCCCGCACCGCGTCGGGGCGCCCTCTCCACTGCGCGCGGTACAAG
hide sequence
RefSeq Acc Id:
XM_017027721 ⟹ XP_016883210
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 20 46,894,843 - 47,188,844 (+) NCBI
Sequence:
AGACAGCAACGTGCCCGCCGCAGTCAGCCCGGCCTCGTCGGACCCGCACCGGCCCGCCCGCCCG
hide sequence
RefSeq Acc Id:
XM_047440010 ⟹ XP_047295966
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 20 46,945,937 - 47,188,844 (+) NCBI
RefSeq Acc Id:
XM_054323191 ⟹ XP_054179166
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 20 48,632,937 - 48,926,940 (+) NCBI
RefSeq Acc Id:
XM_054323192 ⟹ XP_054179167
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 20 48,632,937 - 48,926,940 (+) NCBI
RefSeq Acc Id:
NP_005235 ⟸ NM_005244
- Peptide Label:
isoform a
- UniProtKB:
Q9NPZ4 (UniProtKB/Swiss-Prot), Q9H4S9 (UniProtKB/Swiss-Prot), Q9H4S3 (UniProtKB/Swiss-Prot), Q9BWF6 (UniProtKB/Swiss-Prot), Q99812 (UniProtKB/Swiss-Prot), Q99503 (UniProtKB/Swiss-Prot), Q96H97 (UniProtKB/Swiss-Prot), Q96CV6 (UniProtKB/Swiss-Prot), Q86U84 (UniProtKB/Swiss-Prot), Q5JSW8 (UniProtKB/Swiss-Prot), Q9UIX7 (UniProtKB/Swiss-Prot), O00167 (UniProtKB/Swiss-Prot), A8KAG7 (UniProtKB/TrEMBL)
- Sequence:
MVELVISPSLTVNSDCLDKLKFNRADAAVWTLSDRQGITKSAPLRVSQLFSRSCPRVLPRQPSTAMAAYGQTQYSAGIQQATPYTAYPPPAQAYGIPSYSIKTEDSLNHSPGQSGFLSYGSSFSTSPT
hide sequence
RefSeq Acc Id:
NP_742108 ⟸ NM_172110
- Peptide Label:
isoform c
- UniProtKB:
A8KAG7 (UniProtKB/TrEMBL)
- Sequence:
MVELVISPSLTVNSDCLDKLKFNRADAAVWTLSDRQGITKSAPLRVSQLFSRSCPRVLPRQPST
hide sequence
RefSeq Acc Id:
XP_005260384 ⟸ XM_005260327
- Peptide Label:
isoform X3
- UniProtKB:
A8KAG7 (UniProtKB/TrEMBL)
- Sequence:
MVELVISPSLTVNSDCLDKLKFNRADAAVWTLSDRQGITKSAPLRVSQLFSRSCPRVLPRQPST
hide sequence
RefSeq Acc Id:
XP_016883210 ⟸ XM_017027721
- Peptide Label:
isoform X2
- UniProtKB:
E7ETN2 (UniProtKB/TrEMBL), Q66T69 (UniProtKB/TrEMBL)
- Sequence:
MVELVISPSLTVNSDCLDKLKFNRADAAVWTLSDRQGITKSAPLRVSQLFSRSCPRVLPRQPST
hide sequence
Ensembl Acc Id:
ENSP00000483392 ⟸ ENST00000611592
Ensembl Acc Id:
ENSP00000417105 ⟸ ENST00000497062
Ensembl Acc Id:
ENSP00000395427 ⟸ ENST00000458636
Ensembl Acc Id:
ENSP00000333640 ⟸ ENST00000327619
Ensembl Acc Id:
ENSP00000321590 ⟸ ENST00000317304
Ensembl Acc Id:
ENSP00000349986 ⟸ ENST00000357410
RefSeq Acc Id:
XP_047295966 ⟸ XM_047440010
- Peptide Label:
isoform X1
- UniProtKB:
Q9NPZ4 (UniProtKB/Swiss-Prot), Q9H4S9 (UniProtKB/Swiss-Prot), Q9H4S3 (UniProtKB/Swiss-Prot), Q9BWF6 (UniProtKB/Swiss-Prot), Q99812 (UniProtKB/Swiss-Prot), Q99503 (UniProtKB/Swiss-Prot), Q96H97 (UniProtKB/Swiss-Prot), Q96CV6 (UniProtKB/Swiss-Prot), Q86U84 (UniProtKB/Swiss-Prot), Q5JSW8 (UniProtKB/Swiss-Prot), O00167 (UniProtKB/Swiss-Prot), Q9UIX7 (UniProtKB/Swiss-Prot), A8KAG7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_054179166 ⟸ XM_054323191
- Peptide Label:
isoform X2
- UniProtKB:
E7ETN2 (UniProtKB/TrEMBL), Q66T69 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_054179167 ⟸ XM_054323192
- Peptide Label:
isoform X3
- UniProtKB:
A8KAG7 (UniProtKB/TrEMBL)
RGD ID: 6798767 Promoter ID: HG_KWN:39702 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Lymphoblastoid Transcripts: ENST00000317304, OTTHUMT00000080324, OTTHUMT00000080326, UC010GHP.1 Position: Human Assembly Chr Position (strand) Source Build 36 20 44,956,561 - 44,957,061 (+) MPROMDB
RGD ID: 6798768 Promoter ID: HG_KWN:39706 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: K562 Transcripts: UC002XSQ.1 Position: Human Assembly Chr Position (strand) Source Build 36 20 45,052,206 - 45,052,706 (+) MPROMDB
RGD ID: 13207179 Promoter ID: EPDNEW_H27170 Type: initiation region Name: EYA2_2 Description: EYA transcriptional coactivator and phosphatase 2 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_H27171 Experiment Methods: Single-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 20 46,894,616 - 46,894,676 EPDNEW
RGD ID: 13207181 Promoter ID: EPDNEW_H27171 Type: initiation region Name: EYA2_1 Description: EYA transcriptional coactivator and phosphatase 2 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_H27170 Experiment Methods: Single-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 20 46,894,843 - 46,894,903 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2014-06-24
EYA2
EYA transcriptional coactivator and phosphatase 2
EYA2
eyes absent homolog 2 (Drosophila)
Symbol and/or name change
5135510 APPROVED
