Six1 (SIX homeobox 1) - Rat Genome Database

Name: Six1
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Six1 (SIX homeobox 1) Rattus norvegicus

Analyze

Symbol:

Six1

Name:

SIX homeobox 1

RGD ID:

620906

Description:

Enables transcription coactivator binding activity. Involved in cellular response to 3,3',5-triiodo-L-thyronine. Predicted to be located in nucleolus and nucleoplasm. Predicted to be part of transcription regulator complex. Predicted to be active in nucleus. Human ortholog(s) of this gene implicated in autosomal dominant nonsyndromic deafness 23; branchiootorenal syndrome; and nephroblastoma. Orthologous to human SIX1 (SIX homeobox 1); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran; 3,4-methylenedioxymethamphetamine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

homeobox protein SIX1; sine oculis homeobox (Drosophila) homolog 1; sine oculis homeobox homolog 1; sine oculis homeobox homolog 1 (Drosophila); sine oculis-related homeobox 1 homolog; sine oculis-related homeobox 1 homolog (Drosophila)

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SIX1 (SIX homeobox 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Six1 (sine oculis-related homeobox 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Six1 (SIX homeobox 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SIX1 (SIX homeobox 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SIX1 (SIX homeobox 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Six1 (SIX homeobox 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SIX1 (SIX homeobox 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SIX1 (SIX homeobox 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Six1 (SIX homeobox 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	SIX2 (SIX homeobox 2)	HGNC	OrthoDB
Homo sapiens (human):	LRRC56 (leucine rich repeat containing 56)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	SIX1 (SIX homeobox 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Six1 (sine oculis-related homeobox 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	six1b (SIX homeobox 1b)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	ceh-33	Alliance	DIOPT (InParanoid\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	so	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	six1	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	6	91,746,739 - 91,751,975 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	91,746,739 - 91,751,975 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	6	92,137,046 - 92,142,281 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	92,436,544 - 92,441,778 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	91,864,445 - 91,869,679 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	95,929,060 - 95,934,296 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	95,929,060 - 95,934,296 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	6	105,364,372 - 105,369,608 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	6	95,470,153 - 95,475,389 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	6	95,475,346 - 95,478,212 (-)	NCBI
Celera	6	90,209,553 - 90,214,789 (-)	NCBI		Celera
Cytogenetic Map	6	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

22q11 Deletion Syndrome (ISO)

autosomal dominant nonsyndromic deafness (ISO)

autosomal dominant nonsyndromic deafness 23 (ISO)

Branchiootic Syndrome 1 (ISO)

Branchiootic Syndrome 3 (ISO)

branchiootorenal syndrome (ISO,ISS)

branchiootorenal syndrome 1 (ISO)

breast cancer (ISO)

Congenital Abnormalities (ISO)

Craniofacial Abnormalities (ISO)

Endometrial Neoplasms (ISO)

genetic disease (ISO)

Hearing Loss (ISO)

hepatocellular carcinoma (ISO)

Lung Agenesis (IEP,ISO)

Neoplasm Metastasis (ISO)

nephroblastoma (ISO)

neurilemmoma (ISO)

Nonsyndromic Sensorineural Hearing Loss (ISO)

ovarian carcinoma (ISO)

Unilateral Hearing Loss (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-demecolcine (ISO)

1,2-dichloroethane (ISO)

15-acetyldeoxynivalenol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

3,4-methylenedioxymethamphetamine (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

amiodarone (ISO)

ammonium chloride (EXP)

antimycin A (ISO)

antirheumatic drug (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

C60 fullerene (EXP)

carbamazepine (ISO)

carbon nanotube (ISO)

chlordecone (ISO)

choline (ISO)

copper atom (ISO)

copper(0) (ISO)

dexamethasone (ISO)

diallyl trisulfide (ISO)

dibenz[a,h]anthracene (ISO)

diethylstilbestrol (ISO)

dioxygen (ISO)

dorsomorphin (ISO)

folic acid (ISO)

fulvestrant (ISO)

genistein (ISO)

gentamycin (EXP)

indometacin (ISO)

L-methionine (ISO)

lithium chloride (ISO)

mercury dibromide (ISO)

methimazole (EXP)

methylmercury chloride (ISO)

oxaliplatin (EXP)

p-chloromercuribenzoic acid (ISO)

panobinostat (ISO)

paracetamol (EXP)

phenylmercury acetate (ISO)

pirinixic acid (ISO)

rotenone (ISO)

SB 431542 (ISO)

sodium arsenite (ISO)

temozolomide (ISO)

testosterone (ISO)

tetrachloromethane (EXP)

titanium dioxide (ISO)

topotecan (EXP)

triazines (ISO)

trichloroethene (EXP)

trichostatin A (ISO)

troglitazone (ISO)

trovafloxacin (ISO)

urethane (ISO)

valproic acid (ISO)

vanadyl sulfate (ISO)

vincristine (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

anatomical structure development (ISO)

aorta morphogenesis (ISO)

branching involved in ureteric bud morphogenesis (ISO)

cellular response to 3,3',5-triiodo-L-thyronine (IDA)

cochlea morphogenesis (ISO)

embryonic cranial skeleton morphogenesis (ISO)

embryonic skeletal system morphogenesis (ISO)

endothelin receptor signaling pathway (ISO)

epithelial cell differentiation (ISO)

facial nerve morphogenesis (ISO)

fungiform papilla morphogenesis (ISO)

gene expression (ISO)

generation of neurons (ISO)

inner ear development (ISO)

inner ear morphogenesis (ISO)

kidney development (ISO)

mesenchymal cell proliferation involved in ureter development (ISO)

mesonephric tubule formation (ISO)

metanephric mesenchyme development (ISO)

middle ear morphogenesis (ISO)

myoblast migration (ISO)

myoblast proliferation (ISO)

myotome development (ISO)

negative regulation of apoptotic process (ISO)

negative regulation of neuron apoptotic process (ISO)

negative regulation of transcription by RNA polymerase II (ISO)

neural crest cell differentiation (ISO)

neurogenesis (ISO)

neuron fate specification (ISO)

Notch signaling pathway (ISO)

olfactory placode formation (ISO)

organ induction (ISO)

otic vesicle development (ISO)

outflow tract morphogenesis (ISO)

pattern specification process (ISO)

pharyngeal system development (ISO)

positive regulation of branching involved in ureteric bud morphogenesis (ISO)

positive regulation of brown fat cell differentiation (ISO)

positive regulation of DNA-templated transcription (ISO)

positive regulation of mesenchymal cell proliferation involved in ureter development (ISO)

positive regulation of myoblast proliferation (ISO)

positive regulation of secondary heart field cardioblast proliferation (ISO)

positive regulation of transcription by RNA polymerase II (ISO)

positive regulation of ureteric bud formation (ISO)

protein localization to nucleus (ISO)

regulation of branch elongation involved in ureteric bud branching (ISO)

regulation of DNA-templated transcription (ISO)

regulation of epithelial cell proliferation (ISO)

regulation of gene expression (ISO)

regulation of neuron differentiation (ISO)

regulation of protein localization (ISO)

regulation of skeletal muscle cell differentiation (ISO)

regulation of skeletal muscle cell proliferation (IBA)

regulation of skeletal muscle satellite cell proliferation (ISO)

regulation of synaptic assembly at neuromuscular junction (ISO)

regulation of transcription by RNA polymerase II (IBA)

sensory perception of sound (ISO)

skeletal muscle fiber development (IBA)

skeletal muscle tissue development (ISO)

skeletal system morphogenesis (ISO)

thymus development (ISO)

thyroid gland development (ISO)

tongue development (ISO)

trigeminal ganglion development (ISO)

ureter smooth muscle cell differentiation (ISO)

ureteric bud development (ISO)

Cellular Component

nucleolus (IEA,ISO)

nucleoplasm (IEA,ISO)

nucleus (IBA,ISO)

transcription regulator complex (IBA,ISO)

Molecular Function

chromatin binding (ISO)

DNA binding (ISO)

DNA-binding transcription activator activity, RNA polymerase II-specific (ISO)

DNA-binding transcription factor activity (ISO)

DNA-binding transcription factor activity, RNA polymerase II-specific (IBA)

protein binding (ISO)

RNA polymerase II cis-regulatory region sequence-specific DNA binding (IBA,ISO)

sequence-specific DNA binding (ISO)

sequence-specific double-stranded DNA binding (ISO)

transcription cis-regulatory region binding (ISO)

transcription coactivator binding (IPI)

References

References - curated

#	Reference Title	Reference Citation
1.	Six1 overexpression in ovarian carcinoma causes resistance to TRAIL-mediated apoptosis and is associated with poor survival.	Behbakht K, etal., Cancer Res. 2007 Apr 1;67(7):3036-42.
2.	Catweasel mice: a novel role for Six1 in sensory patch development and a model for branchio-oto-renal syndrome.	Bosman EA, etal., Dev Biol. 2009 Apr 15;328(2):285-96. doi: 10.1016/j.ydbio.2009.01.030. Epub 2009 Feb 2.
3.	Transcriptional activation of the SALL1 by the human SIX1 homeodomain during kidney development.	Chai L, etal., J Biol Chem. 2006 Jul 14;281(28):18918-26. Epub 2006 May 2.
4.	Six1 transcription factor is critical for coordination of epithelial, mesenchymal and vascular morphogenesis in the mammalian lung.	El-Hashash AH, etal., Dev Biol. 2011 May 15;353(2):242-58. doi: 10.1016/j.ydbio.2011.02.031. Epub 2011 Mar 6.
5.	Abrogation of the G2 cell cycle checkpoint associated with overexpression of HSIX1: a possible mechanism of breast carcinogenesis.	Ford HL, etal., Proc Natl Acad Sci U S A. 1998 Oct 13;95(21):12608-13.
6.	Expression of Eya1 and Six1 is decreased in distal airways of rats with experimental pulmonary hypoplasia.	Friedmacher F, etal., J Pediatr Surg. 2014 Feb;49(2):301-4. doi: 10.1016/j.jpedsurg.2013.11.043. Epub 2013 Nov 18.
7.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
8.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
9.	A Tbx1-Six1/Eya1-Fgf8 genetic pathway controls mammalian cardiovascular and craniofacial morphogenesis.	Guo C, etal., J Clin Invest. 2011 Apr;121(4):1585-95. doi: 10.1172/JCI44630.
10.	SIX1 mutation screening in 247 branchio-oto-renal syndrome families: a recurrent missense mutation associated with BOR.	Kochhar A, etal., Hum Mutat. 2008 Apr;29(4):565. doi: 10.1002/humu.20714.
11.	Mutation screening of the EYA1, SIX1, and SIX5 genes in a large cohort of patients harboring branchio-oto-renal syndrome calls into question the pathogenic role of SIX5 mutations.	Krug P, etal., Hum Mutat. 2011 Feb;32(2):183-90. doi: 10.1002/humu.21402.
12.	Thymus, kidney and craniofacial abnormalities in Six 1 deficient mice.	Laclef C, etal., Mech Dev. 2003 Jun;120(6):669-79.
13.	Transcription coactivator Eya2 is a critical regulator of physiological hypertrophy.	Lee SH, etal., J Mol Cell Cardiol. 2012 Mar;52(3):718-26. doi: 10.1016/j.yjmcc.2011.12.002. Epub 2011 Dec 14.
14.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
15.	Inhibition of Eyes Absent Homolog 4 expression induces malignant peripheral nerve sheath tumor necrosis.	Miller SJ, etal., Oncogene. 2010 Jan 21;29(3):368-79. doi: 10.1038/onc.2009.360. Epub 2009 Nov 9.
16.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
17.	Clinicopathological significance of homeoprotein Six1 in hepatocellular carcinoma.	Ng KT, etal., Br J Cancer. 2006 Oct 23;95(8):1050-5. Epub 2006 Sep 26.
18.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
19.	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.	Patrick AN, etal., Nat Struct Mol Biol. 2013 Apr;20(4):447-53. doi: 10.1038/nsmb.2505. Epub 2013 Feb 24.
20.	GOA pipeline	RGD automated data pipeline
21.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
22.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
23.	Information Derived from GenBank Report	RGD, Sept. 2003
24.	SIX1 mutations cause branchio-oto-renal syndrome by disruption of EYA1-SIX1-DNA complexes.	Ruf RG, etal., Proc Natl Acad Sci U S A. 2004 May 25;101(21):8090-5. Epub 2004 May 12.
25.	Branchio-oto-renal syndrome: detection of EYA1 and SIX1 mutations in five out of six Danish families by combining linkage, MLPA and sequencing analyses.	Sanggaard KM, etal., Eur J Hum Genet. 2007 Nov;15(11):1121-31. Epub 2007 Jul 18.
26.	SIX1 protein expression selectively identifies blastemal elements in Wilms tumor.	Sehic D, etal., Pediatr Blood Cancer. 2012 Jul 15;59(1):62-8. doi: 10.1002/pbc.24025. Epub 2011 Dec 16.
27.	Mutations in the SIX1/2 pathway and the DROSHA/DGCR8 miRNA microprocessor complex underlie high-risk blastemal type Wilms tumors.	Wegert J, etal., Cancer Cell. 2015 Feb 9;27(2):298-311. doi: 10.1016/j.ccell.2015.01.002.
28.	Eya4 Induces Hypertrophy via Regulation of p27kip1.	Williams T, etal., Circ Cardiovasc Genet. 2015 Dec;8(6):752-64. doi: 10.1161/CIRCGENETICS.115.001134. Epub 2015 Oct 23.

Additional References at PubMed

PMID:9826681	PMID:12783782	PMID:12874121	PMID:14628042	PMID:15496442	PMID:15788460	PMID:15955062	PMID:16018995	PMID:16530750	PMID:16916509	PMID:16934795	PMID:16938278
PMID:17098221	PMID:17300925	PMID:17592144	PMID:19008232	PMID:19027001	PMID:19497856	PMID:19962975	PMID:20110314	PMID:20515681	PMID:20696153	PMID:21281623	PMID:21884692
PMID:21978088	PMID:22513373	PMID:27923061	PMID:35180623	PMID:37479098

Genomics

Comparative Map Data

Six1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	6	91,746,739 - 91,751,975 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	91,746,739 - 91,751,975 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	6	92,137,046 - 92,142,281 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	92,436,544 - 92,441,778 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	91,864,445 - 91,869,679 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	95,929,060 - 95,934,296 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	95,929,060 - 95,934,296 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	6	105,364,372 - 105,369,608 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	6	95,470,153 - 95,475,389 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	6	95,475,346 - 95,478,212 (-)	NCBI
Celera	6	90,209,553 - 90,214,789 (-)	NCBI		Celera
Cytogenetic Map	6	q24	NCBI

SIX1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	14	60,643,421 - 60,649,477 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	14	60,643,421 - 60,658,259 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	14	61,110,139 - 61,116,195 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	14	60,182,506 - 60,185,933 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	14	60,182,505 - 60,185,933	NCBI
Celera	14	41,161,682 - 41,166,417 (-)	NCBI		Celera
Cytogenetic Map	14	q23.1	NCBI
HuRef	14	41,274,621 - 41,279,356 (-)	NCBI		HuRef
CHM1_1	14	61,050,553 - 61,055,290 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	14	54,849,879 - 54,855,949 (-)	NCBI		T2T-CHM13v2.0

Six1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	12	73,088,601 - 73,093,486 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	12	73,086,789 - 73,100,661 (-)	Ensembl		GRCm39 Ensembl
GRCm38	12	73,041,827 - 73,046,712 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	12	73,040,015 - 73,053,887 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	12	74,142,814 - 74,147,699 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	12	73,960,668 - 73,965,302 (-)	NCBI		MGSCv36	mm8
Celera	12	74,158,405 - 74,163,290 (-)	NCBI		Celera
Cytogenetic Map	12	C3	NCBI
cM Map	12	30.34	NCBI

Six1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955466	8,961,597 - 8,966,069 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955466	8,961,597 - 8,966,069 (+)	NCBI	ChiLan1.0	ChiLan1.0

SIX1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	14	60,997,057 - 61,003,141 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	14	41,250,512 - 41,256,567 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	14	59,515,324 - 59,518,740 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	14	59,515,324 - 59,527,494 (-)	Ensembl	panpan1.1		panPan2

SIX1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	8	35,676,705 - 35,679,534 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	8	35,676,479 - 35,679,534 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	8	35,430,686 - 35,433,517 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	8	35,909,922 - 35,912,747 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	8	35,909,922 - 35,913,208 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	8	35,522,041 - 35,524,863 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	8	35,599,806 - 35,602,627 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	8	35,960,733 - 35,963,565 (-)	NCBI		UU_Cfam_GSD_1.0

Six1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	69,348,816 - 69,353,683 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936495	4,838,051 - 4,842,994 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936495	4,839,496 - 4,842,906 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SIX1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	189,619,855 - 189,624,651 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	189,620,430 - 189,624,652 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	210,729,818 - 210,734,041 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SIX1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	24	37,840,399 - 37,855,801 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	24	37,840,309 - 37,845,192 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666053	26,090,242 - 26,095,370 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Six1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624734	40,453,420 - 40,459,671 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624734	40,453,445 - 40,457,551 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Six1
11 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	222
Count of miRNA genes:	152
Interacting mature miRNAs:	188
Transcripts:	ENSRNOT00000034338
Prediction methods:	Microtar, Miranda, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
4145119	Mcs25	Mammary carcinoma susceptibility QTL 25		0.0001	mammary gland integrity trait (VT:0010552)	ratio of deaths to total study population during a period of time (CMO:0001023)	6	10894415	110548006	Rat
1576309	Emca7	Estrogen-induced mammary cancer QTL 7	4		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	6	15107216	107351382	Rat
634330	Pia16	Pristane induced arthritis QTL 16	3.9		joint integrity trait (VT:0010548)	arthritic paw count (CMO:0001460)	6	45790088	104200226	Rat
6893332	Cm74	Cardiac mass QTL 74	0.4	0.64	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	6	57730540	104085867	Rat
1558641	Cm47	Cardiac mass QTL 47	2.9	0.001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	6	57730540	104085867	Rat
70176	Mcsm1	Mammary carcinoma susceptibility modifier QTL 1			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	6	58632962	103632962	Rat
12801471	Schws9	Schwannoma susceptibility QTL 9			nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	6	61747639	106747639	Rat
731173	Uae22	Urinary albumin excretion QTL 22	10.1		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	65531555	140994061	Rat
2290393	Uae37	Urinary albumin excretion QTL 37		0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	65531555	140994061	Rat
1641904	Alcrsp4	Alcohol response QTL 4			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	6	67262953	112262953	Rat
1300075	Glom7	Glomerulus QTL 7	5.6	0.0000002	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	6	71201409	116201409	Rat
1331789	Rf37	Renal function QTL 37	3.224		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	6	72202632	115200186	Rat
70196	BpQTLcluster7	Blood pressure QTL cluster 7	6.82		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	6	72202632	117202632	Rat
724536	Uae7	Urinary albumin excretion QTL 7	3.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	6	72202632	130729475	Rat
1331799	Bp211	Blood pressure QTL 211	3.66407		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	6	72202632	130919985	Rat
1581550	Pur8	Proteinuria QTL 8			urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	6	72227641	130729205	Rat
1581563	Uae33	Urinary albumin excretion QTL 33			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	72227641	130729205	Rat
724524	Uae2	Urinary albumin excretion QTL 2	2.7	0.0005	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	73463459	109394713	Rat
2293837	Kiddil1	Kidney dilation QTL 1	3.7		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	6	81132889	104393926	Rat
2293842	Kiddil3	Kidney dilation QTL 3	4.3		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	6	81132889	104393926	Rat
737827	Hcar11	Hepatocarcinoma resistance QTL 11	4.4		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	6	82523650	110548006	Rat
1576302	Schws4	Schwannoma susceptibility QTL 4		0.0078	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	6	83190345	106747639	Rat
738034	Anxrr5	Anxiety related response QTL 5	5.9		exploratory behavior trait (VT:0010471)	percentage of entries into a discrete space in an experimental apparatus (CMO:0000961)	6	84130881	129130881	Rat
10054138	Gmadr3	Adrenal mass QTL 3	3.68	0.00045	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	6	85140138	130140138	Rat
10054123	Srcrt6	Stress Responsive Cort QTL 6	2.5	0.0043	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	6	85140138	130140138	Rat
724513	Uae14	Urinary albumin excretion QTL 14	6.5		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	85311061	133478515	Rat
1300076	Glom8	Glomerulus QTL 8	7	0.000000009	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli directly contacting the kidney surface (CMO:0001001)	6	86894788	131894788	Rat
2303624	Vencon5	Ventilatory control QTL 5	4.45		respiration trait (VT:0001943)	minute ventilation (CMO:0000132)	6	88047916	133047916	Rat
1331722	Thshl1	Thyroid stimulating hormone level QTL 1	11.7	0.0001	blood thyroid-stimulating hormone amount (VT:0005119)	serum thyroid stimulating hormone level (CMO:0001248)	6	89762877	106752806	Rat

Markers in Region

RH139816

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	91,747,144 - 91,747,340 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	95,929,466 - 95,929,661	NCBI	Rnor6.0
Rnor_5.0	6	105,364,778 - 105,364,973	UniSTS	Rnor5.0
RGSC_v3.4	6	95,470,559 - 95,470,754	UniSTS	RGSC3.4
Celera	6	90,209,959 - 90,210,154	UniSTS
RH 3.4 Map	6	658.5	UniSTS
Cytogenetic Map	6	q24	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium		1		1		8	11	6		4		8
Low	8	18	4	7	4			29	12	17	11
Below cutoff	30	15	14	4	14			36	19	12

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_053759	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF323957	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473947	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000164	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000034338 ⟹ ENSRNOP00000037345

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	91,746,739 - 91,751,975 (-)	Ensembl
Rnor_6.0 Ensembl	6	95,929,060 - 95,934,296 (-)	Ensembl

RefSeq Acc Id:

NM_053759 ⟹ NP_446211

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	6	91,746,739 - 91,751,975 (-)	NCBI
Rnor_6.0	6	95,929,060 - 95,934,296 (-)	NCBI
Rnor_5.0	6	105,364,372 - 105,369,608 (-)	NCBI
RGSC_v3.4	6	95,470,153 - 95,475,389 (-)	RGD
Celera	6	90,209,553 - 90,214,789 (-)	RGD

Sequence:

show sequence

TGAGAAGTGTGAGATTCCCTTTAGGTGACACCGAAGAGGGCGCCGCTTCCCTAGGTCCGGACTT
GGTCACCACCCTCTTCAGCACCCTAGTTCCCTCCCCCTCCCGACCCCACCTCACTTCCCACCTC
TCCAGGTCCTTCTCCTCCCACCACTCCTTATCCCAGGGCTCGGCAGCTTCGCCCTCCCCACGCG
GGGCGGCACGCTGGCGCGGCTTTGCTGCCCGTCCGGGCGGCGCACAGGCTGGCCAGCTTCGGAT
AGGCGCCGCTCACAGCCAATCAGAGTGCCGGGGACTCTGCGCGCTTTAAGGCCGCAGCGGGGAG
AACAGAAACCAAGTTCCCCGGCAACCAGCAGCATCCACCCGGCGGCCGGCAGGCAGGAGCCAGC
GAGGCCCGGAAGGCTGTAGAGTGCGCCAGCCACTCGGAGTCTAGCGCACCCCTACTTCGTTTTC
CTTCGCCTCCTACCCGCCAAGGTCCGACTGGTTTCTTCGCCTGCGCCAAGCCTAGGGAGGGGGT
TAGGAGCAGCCGCGCCCCCCTCCCCGCGGCAGCCGCCCCCTGCTCTCCCAGCTCTGCTCGCTGC
CGCGTGCGCCCGGGCCGGTGCGCCCCGGCAGCGCCAGCCATGTCGATGCTGCCGTCGTTTGGTT
TTACTCAAGAGCAAGTGGCGTGCGTGTGCGAGGTTCTGCAGCAAGGAGGGAACCTGGAACGCCT
GGGCAGGTTCTTGTGGTCGTTGCCCGCCTGCGATCACCTGCACAAGAACGAGAGCGTGCTCAAG
GCCAAGGCGGTGGTCGCCTTCCACCGCGGCAACTTCCGCGAGCTCTACAAGATCCTGGAGAGCC
ACCAGTTCTCGCCTCACAACCATCCCAAATTGCAGCAGCTGTGGCTGAAAGCGCACTACGTGGA
GGCCGAGAAACTTCGCGGCCGACCCCTGGGTGCCGTGGGCAAATATCGGGTGCGCCGAAAATTC
CCGTTGCCGCGCACCATCTGGGATGGCGAAGAGACTAGCTACTGTTTTAAGGAGAAGTCTCGGG
GCGTGCTGAGGGAGTGGTACGCGCACAACCCCTACCCCTCGCCGCGGGAGAAGCGGGAGCTGGC
CGAGGCTACGGGCCTCACCACCACCCAGGTCAGCAACTGGTTTAAGAACCGGAGGCAAAGAGAC
CGGGCCGCCGAGGCCAAGGAAAGGGAGAACACCGAAAACAATAACTCCTCCTCCAACAAGCAGA
ATCAACTCTCTCCTCTGGAAGGGGGCAAGCCGCTCATGTCCAGCTCAGAAGAGGAATTCTCACC
TCCCCAAAGTCCAGACCAGAACTCGGTCCTCCTGCTCCAGAGCAATATGGGCCATGCCAGGAGC
TCAAACTATTCTCTTCCGGGCCTAACGGCCTCACAGCCCAGCCATGGCCTGCAGGCTCATCAGC
ACCAGCTCCAGGACTCTCTGCTGGGCCCGCTCACCTCCAGTCTGGTGGACTTGGGTTCCTAAGT
GGGGGAGATACTGGGGCCTTGAAGGGATGACCGGAGCAGCAACCAACCGCAGCATCTAGGGACA
CTTGTACATAGAAGCCAGGGGCAATTCTGCAGCTTGATTCTGGGGTTCTTTGCGCAGAAAGCAA
CCACAGGCTTTCACAATTGTCTTTTTAAAAATTACAGTCGACAGTGATCTCAGTTGAGCCTACT
CTCCCTCTTCTCTTCGGCTCTTAATACCCTCGCATCGCATTTCCCCTCTCACTAAAAGGTCAGG
AAACAACAAAAACACCCAGGCTTGGTTCTGGGCAACCCAGGTATCCTTTTCAGTAGTCCCTTCT
TCCATGTCTTCCTCCCCCTCTCCCTCCTCCTCCTCTTTGTCTTCTTTTAATGAACAGAGATTAC
AAATCAACTGGATTTTAATTATTTTCTTTTAATTTATTTATGGAGAAACGGTTTAGGGAAGAGG
AAAAGGAAATGAAGAGAAAGAGAGAGAGACATATCAAAATAATGAAAACAAGAAACCTCCAGTC
TGAGAGGAACTGGCTGCCTTCTTAAGATGAATAGGAAAAATATAATCATAATGGTTTTTTGATG
GGAAGATTAAGTTTACATTTTTCATATTTAGTGTTAAATAATTTTACGTAGGTTAAAATAAAAG
AGCAGTATTAGTGAGGGAAACAAGTGCCTAAATGTCTTCATGCTCTCTATGTGAGGCGGTTAGA
GTAGAAGCGATGTTAGTAACGCAACAAACTATTTTTGTCAATTTTAATGGGGGTTTTGGTGATT
GTTTTCTTGTTTTTTTTTTTTTATGACAAACTCCAAATGTGTACCAATGGGGGGAGGGGAGGGA
ACCACTTTCCTAAATGTCATCACTTCTTCCTCAGAAACTTTCCTACCTGTAGGCTGCCTCTGTC
TACTCCTAGTTTCTACGTGACAGAGGGTGCCAACCAACCTGGCAACCTGGTATTTGTTACTAAA
ACGGCATGTGTTTTTAGGTTTCATTTCTATTGTACCTAAACCAGTCTAAATTAAAACTCAGTAG
ACCAGCAGGAGTTTGATTCTGTTTCTGAAAGGTGAGTTATGTATTGCTGTCATTGGGCCTATTT
AAAAACAAGTTTTCTTGCTTTCTTAGTGGTAGTCATGAATTGCAGGGTATTTTTGAAGTCTATC
ACCTGAAGCCAAGAATAGTGGCTAGGTTAATGCTATGATGAAAGAAAAGAAATTTAGCCTTGGG
TATTTATTTATTTTTTTTTGTTATTTAGAAATGCAGTCTTGTTTACCACTGTTTCTTCTCCACA
GCCTTCGTATGTTGGCTCAGCTCTCTTGTGTTAGCAACTTATGAAAAGACTGTGAAAGCAAACG
TAATTTATCTGTTTTTTTTTAAGGGAACTCGAACCAGAATTTAAAATTATGAATTGATTTGTAC
AAATAAAAAAGCAGGCCATCGGAAACTCTTTTGTCAGATAGTGTCCAGGAAAACAAATCTCAGT
ACATGAAGGCTCCATGTTCTTTTTGCCTGGGGCAAAATGATGTATCTTCTGTATTTAGCTTTTA
AGACTAGTGAAACAAATGGCATTATTTATTAAAATTCTACTCAGAATAACAGGATTGGCTTGTT
CGTGCTTTGTAAAATATTGTTCCCCAGGGAGAGTTTTTTTTTCTGACATGACAGTTTCATAATT
TTGATTTTTCCTCATCTATAAGTGTCAATATTAATATATTTCTTACCTTTCC

hide sequence

Protein Sequences


Protein RefSeqs	NP_446211	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAK11607	(Get FASTA)	NCBI Sequence Viewer
	EDM03607	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_446211 ⟸ NM_053759

- UniProtKB:

G3V970 (UniProtKB/TrEMBL), A6HC52 (UniProtKB/TrEMBL), Q99P83 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSMLPSFGFTQEQVACVCEVLQQGGNLERLGRFLWSLPACDHLHKNESVLKAKAVVAFHRGNFR
ELYKILESHQFSPHNHPKLQQLWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETS
YCFKEKSRGVLREWYAHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAKERENTEN
NNSSSNKQNQLSPLEGGKPLMSSSEEEFSPPQSPDQNSVLLLQSNMGHARSSNYSLPGLTASQP
SHGLQAHQHQLQDSLLGPLTSSLVDLGS

hide sequence

RefSeq Acc Id:

ENSRNOP00000037345 ⟸ ENSRNOT00000034338

Protein Domains

Homeobox

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-G3V970-F1-model_v2	AlphaFold	G3V970	1-284	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620906	AgrOrtholog
BioCyc Gene	G2FUF-37120	BioCyc
Ensembl Genes	ENSRNOG00000022777	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000037345	ENTREZGENE
	ENSRNOP00000037345.4	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000034338	ENTREZGENE
	ENSRNOT00000034338.5	UniProtKB/TrEMBL
Gene3D-CATH	Homeodomain-like	UniProtKB/TrEMBL
InterPro	Homeobox	UniProtKB/TrEMBL
	Homeobox_CS	UniProtKB/TrEMBL
	Homeodomain-like	UniProtKB/TrEMBL
	SIX1_SD	UniProtKB/TrEMBL
KEGG Report	rno:114634	UniProtKB/TrEMBL
NCBI Gene	114634	ENTREZGENE
PANTHER	HOMEOBOX PROTEIN SIX	UniProtKB/TrEMBL
	PTHR10390:SF13	UniProtKB/TrEMBL
Pfam	Homeobox	UniProtKB/TrEMBL
	SIX1_SD	UniProtKB/TrEMBL
PhenoGen	Six1	PhenoGen
PROSITE	HOMEOBOX_1	UniProtKB/TrEMBL
	HOMEOBOX_2	UniProtKB/TrEMBL
SMART	HOX	UniProtKB/TrEMBL
Superfamily-SCOP	Homeodomain_like	UniProtKB/TrEMBL
UniProt	A6HC52	ENTREZGENE, UniProtKB/TrEMBL
	G3V970	ENTREZGENE, UniProtKB/TrEMBL
	Q99P83	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-10-23	Six1	SIX homeobox 1	Six1	sine oculis-related homeobox 1 homolog (Drosophila)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-02-25	Six1	sine oculis-related homeobox 1 homolog (Drosophila)	Six1	sine oculis homeobox homolog 1 (Drosophila)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-20	Six1	sine oculis homeobox homolog 1 (Drosophila)	Six1	sine oculis homeobox (Drosophila) homolog 1	Name updated	1299863	APPROVED
2005-01-20	Six1	sine oculis homeobox homolog 1 (Drosophila)		sine oculis homeobox (Drosophila) homolog 1	Name updated	1299863	APPROVED
2002-08-07	Six1	sine oculis homeobox (Drosophila) homolog 1			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_regulation	expression is upregulated in retinal ganglion cells after optic nerve transection	634611

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM