HMOX1 (heme oxygenase 1) - Rat Genome Database

Name: HMOX1
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Gene: HMOX1 (heme oxygenase 1) Homo sapiens

Analyze

Symbol:

HMOX1

Name:

heme oxygenase 1

RGD ID:

730901

HGNC Page

HGNC:5013

Description:

Enables several functions, including heme binding activity; heme oxygenase (decyclizing) activity; and protein homodimerization activity. Involved in several processes, including multicellular organismal-level iron ion homeostasis; porphyrin-containing compound catabolic process; and regulation of smooth muscle cell proliferation. Located in endoplasmic reticulum membrane and perinuclear region of cytoplasm. Implicated in several diseases, including artery disease (multiple); cerebrovascular disease (multiple); factor VIII deficiency; lung disease (multiple); and type 2 diabetes mellitus. Biomarker of several diseases, including Behcet's disease; Henoch-Schoenlein purpura; cystic fibrosis; lung disease (multiple); and obstructive sleep apnea.

Type:

protein-coding

RefSeq Status:

REVIEWED

Previously known as:

bK286B10; heat shock protein, 32-kD; heme oxygenase (decycling) 1; HMOX1D; HO-1; HSP32

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Mus musculus (house mouse):	Hmox1 (heme oxygenase 1)	HGNC	EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):	Hmox1 (heme oxygenase 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Chinchilla lanigera (long-tailed chinchilla):	Hmox1 (heme oxygenase 1)	NCBI	Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):	HMOX1 (heme oxygenase 1)	NCBI	Ortholog
Canis lupus familiaris (dog):	HMOX1 (heme oxygenase 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Hmox1 (heme oxygenase 1)	NCBI	Ortholog
Sus scrofa (pig):	HMOX1 (heme oxygenase 1)	HGNC	Ensembl, Inparanoid, NCBI, OrthoDB, Panther
Chlorocebus sabaeus (green monkey):	HMOX1 (heme oxygenase 1)	NCBI	Ortholog
Heterocephalus glaber (naked mole-rat):	Hmox1 (heme oxygenase 1)	NCBI	Ortholog
Other homologs ²
Rattus norvegicus (Norway rat):	Plxna1 (plexin A1)	HGNC	OMA
Alliance orthologs ³
Rattus norvegicus (Norway rat):	Hmox1 (heme oxygenase 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Hmox1 (heme oxygenase 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	hmox1b (heme oxygenase 1b)	Alliance	DIOPT (ZFIN)
Danio rerio (zebrafish):	hmox1a (heme oxygenase 1a)	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB\|ZFIN)
Saccharomyces cerevisiae (baker's yeast):	HMX1	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|PhylomeDB)
Drosophila melanogaster (fruit fly):	Ho	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus laevis (African clawed frog):	hmox1.S	Alliance	DIOPT (Xenbase)
Xenopus laevis (African clawed frog):	hmox1.L	Alliance	DIOPT (Xenbase)
Xenopus tropicalis (tropical clawed frog):	hmox1	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Allele / Splice:

See ClinVar data

Latest Assembly:

GRCh38 - Human Genome Assembly GRCh38

Position:

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	22	35,381,096 - 35,394,207 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	22	35,380,361 - 35,394,214 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	22	35,777,089 - 35,790,200 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	22	34,107,087 - 34,120,194 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	22	34,101,640 - 34,114,748	NCBI
Celera	22	19,579,740 - 19,592,881 (+)	NCBI		Celera
Cytogenetic Map	22	q12.3	NCBI
HuRef	22	18,737,577 - 18,750,716 (+)	NCBI		HuRef
CHM1_1	22	35,735,791 - 35,748,937 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	22	35,839,114 - 35,852,226 (+)	NCBI		T2T-CHM13v2.0

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

abdominal aortic aneurysm (IAGP)

acute chest syndrome (IAGP)

acute kidney failure (EXP,ISO)

Acute Lung Injury (ISO)

acute myeloid leukemia (ISO)

adenocarcinoma (IAGP)

adenylosuccinase lyase deficiency (IAGP)

adrenoleukodystrophy (EXP)

adult respiratory distress syndrome (IAGP)

Altitude Sickness (ISO)

Alzheimer's disease (EXP,IEP)

arteriosclerosis (ISO)

asthma (EXP,IEP,ISO)

Behcet's disease (IEP)

berylliosis (IEP)

Blast Crisis (IEP)

blood coagulation disease (EXP)

Brain Death (ISO)

brain edema (ISO)

Brain Hypoxia-Ischemia (ISO)

Brain Injuries (ISO)

brain ischemia (ISO)

Breast Neoplasms (EXP)

bronchiolitis obliterans (ISO)

Carbon Monoxide Poisoning (ISO)

Carbon Tetrachloride Poisoning (ISO)

Cardiomegaly (EXP)

carotid artery disease (EXP)

carotid artery thrombosis (ISO)

Cerebral Hemorrhage (EXP)

cerebral infarction (ISO)

Chemical and Drug Induced Liver Injury (EXP,ISO)

chronic myeloid leukemia (ISO)

chronic obstructive pulmonary disease (EXP,IAGP,ISO)

Chronic Tubulointerstitial Nephropathy (ISO)

colitis (EXP,ISO)

congestive heart failure (EXP,ISO)

contact dermatitis (EXP)

coronary artery disease (EXP,IAGP)

Coronary Disease (IEP)

coronary restenosis (IAGP,TAS)

cystic fibrosis (IEP)

diabetic angiopathy (EXP)

Diabetic Cardiomyopathies (ISO)

Diabetic Nephropathies (ISO)

Dilatation, Pathologic (ISO)

end stage renal disease (EXP)

Endotoxemia (ISO)

esophageal cancer (ISO)

Experimental Diabetes Mellitus (EXP,ISO)

Experimental Liver Cirrhosis (EXP,ISO)

Experimental Mammary Neoplasms (EXP,ISO)

Experimental Radiation Injuries (ISO)

factor VIII deficiency (IAGP)

Fever (ISO)

Fibrosis (EXP)

gastroparesis (EXP)

genetic disease (IAGP)

Graft Occlusion, Vascular (ISO)

Growth Disorders (EXP)

Helicobacter Infections (IEP)

Heme Oxygenase 1 Deficiency (EXP,IAGP)

hemochromatosis (ISS)

Hemolysis (EXP)

hemolytic anemia (EXP)

Hemorrhagic Shock (ISO)

Henoch-Schoenlein purpura (IEP)

hepatic encephalopathy (ISO)

hepatic veno-occlusive disease (ISO)

hepatitis (EXP)

hepatopulmonary syndrome (ISO)

hepatorenal syndrome (EXP)

hyperinsulinism (EXP)

Hyperoxic Lung Injury (ISO)

Hyperplasia (EXP)

hypertension (EXP,IAGP,IMP,ISO)

hyperthyroidism (ISO)

hypertrophic cardiomyopathy (ISO)

ileus (ISO)

Inflammation (EXP)

Insulin Resistance (EXP,IEP)

interstitial lung disease (IEP)

Intestinal Reperfusion Injury (ISO)

intracranial vasospasm (IDA,IMP,ISO)

iron metabolism disease (EXP)

ischemia (EXP)

Kawasaki disease (IAGP)

Kidney Reperfusion Injury (ISO)

learning disability (EXP)

limb ischemia (ISO)

liver disease (EXP)

Liver Neoplasms (EXP)

Liver Reperfusion Injury (ISO)

lung disease (ISO)

Lung Injury (EXP)

Lung Neoplasms (EXP)

Lung Reperfusion Injury (ISO)

malaria (ISS)

Metabolic Syndrome (ISO)

middle cerebral artery infarction (IMP,ISO)

myocardial infarction (ISO)

Myocardial Ischemia (EXP,IAGP,ISO)

Myocardial Reperfusion Injury (IMP,ISO)

Neointima (ISO)

Neonatal Hyperbilirubinemia (ISO)

Neoplasm Invasiveness (EXP)

neurodegenerative disease (EXP)

newborn respiratory distress syndrome (IEP)

obesity (EXP)

obstructive sleep apnea (IEP)

pancreas disease (EXP)

Paraparesis (ISO)

Parkinson's disease (EXP)

Parkinsonism (ISO)

Pathologic Constriction (ISO)

peptic ulcer disease (ISO)

Perennial Allergic Rhinitis (IEP)

Pneumococcal Pneumonia (ISO)

pneumonia (EXP,IAGP)

pneumothorax (IEP)

portal hypertension (ISO)

pre-eclampsia (EXP)

Pregnancy-Induced Hypertension (ISO)

primary biliary cholangitis (ISO)

Prostatic Neoplasms (EXP)

Pulmonary Edema of Mountaineers (ISO)

pulmonary emphysema (EXP,IAGP)

pulmonary fibrosis (EXP)

pulmonary hypertension (IDA,ISO)

pulmonary sarcoidosis (IEP)

pulmonary venoocclusive disease (IEP,ISO)

renal hypertension (ISO)

Reperfusion Injury (EXP,ISO)

Retina Reperfusion Injury (ISO)

retinal disease (EXP)

retinal ischemia (ISO)

Rhabdomyolysis (ISO)

Right Ventricular Hypertrophy (IEP,ISO)

sciatic neuropathy (ISO)

sickle cell anemia (IEP,ISO)

silicosis (IEP,ISO)

Sjogren's syndrome (ISO)

Spinal Cord Injuries (ISO)

spinocerebellar ataxia type 17 (EXP)

status epilepticus (EXP,ISO)

Stomach Neoplasms (EXP)

Stroke (IDA)

Subarachnoid Hemorrhage (IDA,ISO)

systemic mastocytosis (EXP)

Testis Reperfusion Injury (ISO)

thrombosis (EXP,ISO)

toxic shock syndrome (ISO)

type 2 diabetes mellitus (EXP,IAGP,ISO)

varicocele (IEP)

Vascular System Injuries (EXP)

Ventricular Fibrillation (ISO)

viral pneumonia (ISO)

visceral leishmaniasis (EXP,IEP)

Wounds and Injuries (EXP)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-albicanol (ISO)

(+)-alpha-viniferin (ISO)

(+)-catechin (EXP)

(+)-epicatechin-3-O-gallate (EXP)

(+)-pilocarpine (EXP,ISO)

(+)-schisandrin B (EXP)

(+)-taxifolin (EXP,ISO)

(+)-trans-(S)-allethrin (EXP)

(-)-citrinin (EXP)

(-)-epigallocatechin 3-gallate (EXP,ISO)

(-)-selegiline (EXP)

(1->4)-beta-D-glucan (ISO)

(1S)-bornane-2,3-dione (EXP)

(2,4,5-trichlorophenoxy)acetic acid (ISO)

(25R)-cholest-5-ene-3beta,26-diol (EXP)

(E)-cinnamyl alcohol (EXP,ISO)

(R)-carnitine (ISO)

(R)-lipoic acid (EXP,ISO)

(R)-noradrenaline (EXP)

(R)-pantothenic acid (EXP)

(R,R,R)-alpha-tocopherol (EXP,ISO)

(S)-AMPA (ISO)

(S)-colchicine (EXP,ISO)

(S)-duloxetine hydrochloride (EXP)

(S)-naringenin (EXP,ISO)

(S)-nicotine (ISO)

(S)-ropivacaine (EXP)

(Z)-ligustilide (EXP,ISO)

1,1'-azobis(N,N-dimethylformamide) (EXP)

1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (ISO)

1,1,1-trichloroethane (ISO)

1,1-dichloroethene (ISO)

1,10-phenanthroline (EXP)

1,2,4-trichlorobenzene (ISO)

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

1,2-naphthoquinone (EXP)

1,3-benzothiazole-2-thiol (EXP,ISO)

1,3-dichloropropan-2-ol (EXP,ISO)

1,3-dinitrobenzene (ISO)

1,4-benzoquinone (EXP,ISO)

1,4-dichlorobenzene (ISO)

1,4-dithiothreitol (EXP,ISO)

1,4-phenylenediamine (EXP,ISO)

1-(5-isoquinolinesulfonyl)-2-methylpiperazine (EXP)

1-[(2,3,4-trimethoxyphenyl)methyl]piperazine (ISO)

1-bromopropane (ISO)

1-chloro-2,4-dinitrobenzene (EXP,ISO)

1-fluoro-2,4-dinitrobenzene (EXP,ISO)

1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (ISO)

1-naphthyl isothiocyanate (ISO)

1-nitropyrene (EXP)

1-phenyl-1,2-propanedione (EXP)

15-deoxy-Delta(12,14)-prostaglandin J2 (EXP,ISO)

15-oxo-ETE (EXP)

17-hydroxyjolkinolide B (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP,ISO)

17beta-estradiol 3-benzoate (ISO)

1H-[1,2,4]oxadiazolo[4,3-a]quinoxalin-1-one (EXP)

1H-pyrazole (ISO)

2''-galloylhyperin (EXP,ISO)

2',4'-dihydroxy-6'-methoxy-3',5'-dimethylchalcone (ISO)

2'-hydroxychalcone (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (EXP)

2,2',5,5'-tetrachlorobiphenyl (EXP)

2,2'-bipyridine (EXP)

2,2,2-tetramine (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (ISO)

2,3-dimethoxynaphthalene-1,4-dione (EXP)

2,4,6-tribromophenol (EXP)

2,4,6-trinitrobenzenesulfonic acid (ISO)

2,4-D (ISO)

2,4-dinitrotoluene (ISO)

2,6-di-tert-butyl-4-methylphenol (EXP,ISO)

2,6-dichloroindophenol (EXP)

2-(3,4-dimethoxyphenyl)-5-\{[2-(3,4-dimethoxyphenyl)ethyl](methyl)amino\}-2-(propan-2-yl)pentanenitrile (EXP,ISO)

2-(octylamino)-1-[4-(propan-2-ylthio)phenyl]-1-propanol (EXP)

2-acetamidofluorene (ISO)

2-amino-2-deoxy-D-galactopyranose (ISO)

2-amino-2-deoxy-D-glucopyranose (EXP)

2-aminophenol (EXP)

2-bromo-2-(bromomethyl)pentanedinitrile (EXP,ISO)

2-butoxyethanol (ISO)

2-chloroethanol (ISO)

2-deoxy-D-glucose (EXP)

2-hexenal (EXP)

2-Hydroxy-6-(8,11,14-pentadecatrienyl)benzoic acid (ISO)

2-hydroxyethyl methacrylate (EXP)

2-hydroxypropanoic acid (EXP)

2-methyl-2-[4-(1,2,3,4-tetrahydronaphthalen-1-yl)phenoxy]propanoic acid (ISO)

2-nitrofluorene (ISO)

2-palmitoylglycerol (EXP)

2-tert-butylhydroquinone (EXP,ISO)

20-hydroxyecdysone (ISO)

22-Hydroxycholesterol (EXP)

26-hydroxycholesterol (EXP)

3'-amino-3'-deoxy-N(6),N(6)-dimethyladenosine (ISO)

3,3',4,4',5-pentachlorobiphenyl (EXP,ISO)

3,3',5,5'-tetrabromobisphenol A (EXP,ISO)

3,3',5-triiodo-L-thyronine (ISO)

3,3'-diindolylmethane (EXP)

3,4-dihydroxybenzoate (ISO)

3,4-dihydroxybenzoic acid (ISO)

3-\{1-[3-(dimethylamino)propyl]-1H-indol-3-yl\}-4-(1H-indol-3-yl)-1H-pyrrole-2,5-dione (ISO)

3-chloropropane-1,2-diol (ISO)

3-isobutyl-1-methyl-7H-xanthine (EXP)

3-methylcholanthrene (EXP,ISO)

3-Nitrofluoranthene (EXP)

3-nitropropanoic acid (ISO)

3-O-Caffeoyl-1-O-methylquinic acid (EXP)

3-phenylprop-2-enal (EXP,ISO)

3H-1,2-dithiole-3-thione (ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (EXP,ISO)

4,6-dioxoheptanoic acid (ISO)

4-(ethoxymethylene)-2-phenyloxazol-5-one (EXP)

4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one (EXP,ISO)

4-amino-2,6-dinitrotoluene (ISO)

4-aminophenol (EXP)

4-hydroxy-TEMPO (ISO)

4-Hydroxybenzyl isothiocyanate (ISO)

4-hydroxynon-2-enal (EXP,ISO)

4-hydroxyphenyl retinamide (EXP)

4-methoxyacetophenone (EXP)

4-nitrobenzyl bromide (EXP,ISO)

4-nitrophenol (ISO)

4-nitroquinoline N-oxide (EXP)

4-phenylbutylamine (ISO)

5,5-diethylbarbituric acid (ISO)

5-(2-methylpiperazine-1-sulfonyl)isoquinoline (EXP)

5-aminolevulinic acid (ISO)

5-aza-2'-deoxycytidine (EXP)

5-bromo-2'-deoxyuridine (ISO)

5-chloro-7-iodoquinolin-8-ol (EXP)

5-fluorouracil (ISO)

5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP)

6-aminonicotinamide (EXP)

6-chloro-2,3,4,9-tetrahydro-1H-carbazole-1-carboxamide (EXP,ISO)

6-propyl-2-thiouracil (ISO)

6alpha-methylprednisolone (ISO)

7,12-dimethyltetraphene (ISO)

7,8-dihydroxycoumarin (EXP)

7beta-aminocephalosporanic acid (EXP)

7H-xanthine (ISO)

8-Br-cAMP (ISO)

8-bromo-3',5'-cyclic GMP (EXP)

9,10-phenanthroquinone (EXP)

9-cis-retinoic acid (EXP)

9H-xanthine (ISO)

[2,8-bis(trifluoromethyl)quinolin-4-yl]-(2-piperidyl)methanol (EXP)

[6]-Shogaol (EXP,ISO)

abamectin (ISO)

acetamide (ISO)

acetic acid (ISO)

acetylcholine (ISO)

acetylsalicylic acid (EXP,ISO)

acrolein (EXP,ISO)

acrylamide (EXP,ISO)

acrylonitrile (EXP)

actinomycin D (EXP,ISO)

adefovir pivoxil (EXP)

Aescin (EXP,ISO)

aflatoxin B1 (EXP,ISO)

Aflatoxin G1 (ISO)

AL 8810 (EXP)

alachlor (ISO)

aldehydo-D-glucosamine (EXP)

aldehydo-D-glucose (EXP,ISO)

aldosterone (ISO)

aldrin (ISO)

alexidine (EXP)

all-trans-retinal (EXP)

all-trans-retinoic acid (EXP,ISO)

allethrin (ISO)

allicin (EXP)

allopurinol (EXP)

alloxan (ISO)

alloxanthine (EXP)

allyl isothiocyanate (ISO)

alpha,alpha-trehalose (ISO)

alpha-D-galactose (ISO)

alpha-hexylcinnamaldehyde (EXP)

alpha-linolenic acid (EXP,ISO)

alpha-Solamarine (ISO)

AM-251 (EXP)

aminoguanidine (EXP,ISO)

amiodarone (EXP,ISO)

amitrole (ISO)

amlexanox (ISO)

ammonia (EXP)

ammonium acetate (ISO)

ammonium chloride (EXP,ISO)

ammonium hexachloroplatinate (EXP)

ammonium hydroxide (EXP)

ammonium sulfate (ISO)

Ammothamnine (ISO)

amphetamine (ISO)

amphibole asbestos (EXP)

amphotericin B (EXP)

ampicillin (EXP)

andrographolide (EXP,ISO)

anethole (ISO)

anthra[1,9-cd]pyrazol-6(2H)-one (EXP,ISO)

antimonite (EXP)

antimony(0) (EXP)

antimycin A (EXP)

apigenin (ISO)

apocynin (EXP,ISO)

arachidonic acid (EXP,ISO)

aristolochic acid A (EXP,ISO)

aristolochic acids (ISO)

Aroclor 1254 (ISO)

arotinoid acid (EXP)

arsane (EXP,ISO)

arsenic acid (ISO)

arsenic atom (EXP,ISO)

arsenic trichloride (EXP,ISO)

arsenite(3-) (EXP,ISO)

arsenous acid (EXP,ISO)

asbestos (EXP)

asperuloside (ISO)

astaxanthin (EXP,ISO)

astemizole (EXP)

astragaloside IV (ISO)

atazanavir sulfate (EXP)

atorvastatin calcium (EXP,ISO)

ATP (EXP)

atrazine (ISO)

aucubin (ISO)

auranofin (EXP,ISO)

aureusidin (ISO)

Aurin (EXP)

azoxystrobin (EXP)

bacitracin (ISO)

bafilomycin A1 (EXP)

baicalein (EXP,ISO)

baicalin (ISO)

Bandrowski's base (EXP)

BAPTA (EXP)

Bardoxolone methyl (EXP,ISO)

bathocuproine disulfonic acid (EXP)

bellidifolin (ISO)

benfotiamine (ISO)

benzene (EXP,ISO)

benzene-1,2,4-triol (EXP)

benzo[a]pyrene (EXP,ISO)

benzo[a]pyrene diol epoxide I (EXP)

benzo[a]pyrene-7,8-dione (EXP)

benzo[b]fluoranthene (ISO)

Benzo[k]fluoranthene (EXP,ISO)

benzoic acid (EXP)

benzoquinones (ISO)

benzyl bromide (EXP)

benzyl isothiocyanate (ISO)

benzylideneacetone (ISO)

beraprost (ISO)

berberine (EXP,ISO)

bergaptol (EXP)

Bergenin (ISO)

beta-D-glucosamine (EXP)

beta-hexachlorocyclohexane (ISO)

beta-naphthoflavone (EXP,ISO)

beta-tocopherol (ISO)

betulin (ISO)

bifenthrin (ISO)

bilirubin IXalpha (EXP,ISO)

biliverdin (ISO)

bis(2-chloroethyl) sulfide (ISO)

bis(2-ethylhexyl) phthalate (EXP,ISO)

bisdemethoxycurcumin (EXP,ISO)

bisphenol A (EXP,ISO)

Bisphenol A diglycidyl ether (ISO)

Bisphenol A glycidylmethacrylate (EXP)

Bisphenol B (EXP)

bisphenol F (EXP,ISO)

bleomycin A2 (ISO)

boric acid (EXP,ISO)

boron nitride (EXP)

bortezomib (EXP,ISO)

bosentan (EXP)

bromoacetate (EXP)

bromobenzene (ISO)

Bromochloroacetonitrile (EXP)

bromocriptine (EXP)

Brusatol (EXP,ISO)

Bucillamine (EXP)

buspirone (ISO)

buta-1,3-diene (ISO)

butan-1-ol (EXP)

butane-2,3-dione (ISO)

butein (EXP)

butylated hydroxyanisole (EXP,ISO)

Butylbenzyl phthalate (ISO)

cadmium atom (EXP,ISO)

cadmium dichloride (EXP,ISO)

cadmium selenide (EXP)

cadmium sulfate (EXP,ISO)

Calcimycin (EXP)

calciol (ISO)

calcitriol (EXP,ISO)

calcium atom (EXP)

calcium dichloride (EXP,ISO)

calcium oxalate (EXP)

calcium(0) (EXP)

Calphostin C (EXP)

cannabidiol (EXP,ISO)

capsaicin (EXP,ISO)

captan (EXP)

carbamazepine (EXP,ISO)

carbaryl (EXP)

carbendazim (ISO)

carbon disulfide (ISO)

carbon monoxide (EXP,ISO)

carbon nanotube (EXP,ISO)

carbonyl cyanide p-trifluoromethoxyphenylhydrazone (EXP)

carboplatin (EXP,ISO)

carmustine (EXP)

carnosic acid (EXP,ISO)

Carnosol (EXP,ISO)

carrageenan (ISO)

carvedilol (EXP)

catalpol (EXP,ISO)

cefaloridine (ISO)

celastrol (EXP,ISO)

celecoxib (ISO)

ceric oxide (EXP)

cerium trichloride (EXP)

ceruletide (ISO)

CGP 52608 (EXP)

chenodeoxycholic acid (EXP)

CHIR 99021 (EXP)

chitosan (EXP,ISO)

chloral hydrate (ISO)

chloramine T (EXP)

chloroacetaldehyde (EXP)

chloroacetic acid (ISO)

Chloroacetonitrile (EXP)

chlorobenzene (EXP,ISO)

chloroethene (ISO)

chloroform (ISO)

chlorogenic acid (EXP,ISO)

chloromethylisothiazolinone (EXP)

chloropicrin (EXP)

chloroprene (ISO)

chlorpromazine (EXP,ISO)

chlorpyrifos (EXP,ISO)

cholesterol (ISO)

choline (ISO)

chromium atom (EXP,ISO)

chromium trinitrate (EXP)

chromium trioxide (ISO)

chromium(6+) (EXP,ISO)

chrysin (EXP,ISO)

ciclopirox (EXP)

cidofovir anhydrous (EXP)

ciglitazone (EXP)

cilostazol (EXP,ISO)

cimetidine (ISO)

cinnamyl alcohol (EXP,ISO)

cisplatin (EXP,ISO)

citraconic acid (ISO)

citral (EXP)

clodronic acid (EXP,ISO)

clofibrate (ISO)

Clofop (EXP)

clozapine (EXP)

cobalt atom (EXP,ISO)

cobalt dichloride (EXP,ISO)

cobalt(2+) sulfate (EXP)

coenzyme Q10 (ISO)

colforsin daropate hydrochloride (EXP,ISO)

colistin (ISO)

coniferyl aldehyde (EXP,ISO)

copper atom (EXP,ISO)

copper(0) (EXP,ISO)

copper(II) chloride (EXP)

copper(II) sulfate (EXP,ISO)

corilagin (ISO)

cortisol (EXP)

corynoline (ISO)

coumermycin A1 (ISO)

crocidolite asbestos (EXP,ISO)

crocin-1 (ISO)

crotonaldehyde (EXP)

CU-O LINKAGE (EXP,ISO)

cucurbitacin I (ISO)

cumene hydroperoxide (ISO)

Cuprizon (ISO)

curcumin (EXP,ISO)

cyanidin cation (ISO)

cyanocob(III)alamin (EXP,ISO)

cyanuric chloride (EXP)

cycloheximide (EXP,ISO)

cyclophosphamide (EXP,ISO)

cyclosporin A (EXP,ISO)

cyhalothrin (ISO)

cypermethrin (ISO)

cysteamine (ISO)

D-glucose (EXP,ISO)

D-mannitol (ISO)

D-penicillamine (EXP)

daidzein 7-O-beta-D-glucoside (ISO)

dantrolene (ISO)

dapagliflozin (ISO)

DDT (EXP)

decabromodiphenyl ether (EXP,ISO)

deguelin (EXP)

dehydroascorbic acid (EXP)

dehydrocostus lactone (ISO)

delphinidin (ISO)

delta-tocopherol (ISO)

demethoxycurcumin (EXP,ISO)

Dendrobine (EXP)

deoxycholic acid (EXP)

Deoxycorticosterone acetate (ISO)

deoxynivalenol (EXP,ISO)

desferrioxamine B (EXP,ISO)

dexamethasone (EXP,ISO)

dexmedetomidine (EXP,ISO)

dextran sulfate (ISO)

Di-n-octyl phthalate (EXP,ISO)

diallyl disulfide (EXP,ISO)

Diallyl sulfide (ISO)

diallyl trisulfide (EXP,ISO)

Diallyltetrasulfane (EXP)

diarsenic trioxide (EXP,ISO)

diazepam (ISO)

diazinon (ISO)

diazoxide (EXP)

dibenziodolium (EXP,ISO)

Dibromoacetonitrile (EXP)

dibutyl phthalate (ISO)

dichlorine (ISO)

Dichloroacetonitrile (EXP)

dichloroacetyl chloride (ISO)

dichloromethane (EXP,ISO)

dichlorvos (ISO)

diclofenac (EXP,ISO)

Didecyldimethylammonium (EXP)

dieldrin (ISO)

diethyl maleate (EXP,ISO)

diethyl phthalate (ISO)

diethyl sulfate (EXP)

diethyldithiocarbamic acid (ISO)

diethylene glycol (ISO)

diethylstilbestrol (ISO)

Diglycolic acid (EXP,ISO)

dihydroactinidiolide (EXP)

dihydroartemisinin (EXP)

dihydroxyacetone (EXP,ISO)

Diisodecyl phthalate (ISO)

diisononyl phthalate (ISO)

dimercaprol (ISO)

dimethyl fumarate (EXP,ISO)

dimethyl sulfate (EXP)

dimethyl sulfoxide (EXP,ISO)

dimethylarsinic acid (EXP,ISO)

dimethylarsinous acid (EXP)

dimethyldithiocarbamate (EXP)

dinoseb (ISO)

dioscin (ISO)

diosmetin (ISO)

dioxygen (EXP,ISO)

diphenylcyclopropenone (EXP)

dipotassium bis[mu-tartrato(4-)]diantimonate(2-) trihydrate (EXP)

diprotium oxide (ISO)

dipyridamole (ISO)

diquat (EXP,ISO)

disodium selenite (ISO)

disulfiram (EXP)

dithianon (EXP)

dithionite(2-) (EXP)

dobutamine (ISO)

dopamine (EXP,ISO)

dorsomorphin (EXP,ISO)

doxorubicin (EXP,ISO)

duroquinone (EXP)

ebselen (ISO)

echinacoside (EXP)

edaravone (ISO)

elemental selenium (EXP,ISO)

elesclomol (EXP)

ellagic acid (EXP,ISO)

emodin (EXP,ISO)

enalapril (ISO)

endosulfan (ISO)

enflurane (ISO)

entinostat (EXP)

epalrestat (ISO)

epichlorohydrin (EXP)

epoxiconazole (ISO)

erastin (ISO)

erdosteine (ISO)

ergosta-4,6,8(14),22-tetraen-3-one (EXP,ISO)

eriodictyol (EXP,ISO)

erythromycin A (EXP)

esmolol (ISO)

etacrynic acid (EXP)

ethanol (EXP,ISO)

ethionamide (EXP)

ethoxyquin (ISO)

Ethyl maltol (EXP)

ethyl methanesulfonate (EXP)

ethylbenzene (EXP,ISO)

ethylene glycol bis(2-aminoethyl)tetraacetic acid (EXP)

ethylene glycol dimethacrylate (EXP)

eugenol (EXP,ISO)

farnesol (EXP)

farrerol (ISO)

fasudil (ISO)

felbamate (ISO)

fenamidone (ISO)

fenofibrate (EXP,ISO)

fenpyroximate (EXP)

fenvalerate (ISO)

ferric ammonium citrate (EXP,ISO)

ferric oxide (ISO)

ferricyanide (ISO)

ferroheme b (EXP,ISO)

ferrosoferric oxide (EXP)

ferrostatin-1 (EXP,ISO)

fisetin (EXP,ISO)

flavonol (ISO)

fluoranthene (ISO)

fluorescein 5-isothiocyanate (ISO)

fluoxetine (ISO)

fluprostenol (EXP)

flutamide (ISO)

fluvastatin (ISO)

folic acid (EXP,ISO)

formaldehyde (ISO)

formononetin (EXP)

fructose (EXP,ISO)

fucoxanthin (EXP,ISO)

fulvestrant (EXP,ISO)

fumonisin B1 (ISO)

furan (ISO)

furazolidone (EXP)

furosemide (ISO)

gabapentin (ISO)

galactose (ISO)

galangin (ISO)

gallic acid (EXP,ISO)

gallocatechin (EXP,ISO)

gamma-linolenic acid (EXP)

gamma-tocopherol (ISO)

Ganoderiol F (ISO)

Garcinol (EXP)

Gastrodin (EXP,ISO)

gedunin (EXP)

gefitinib (ISO)

geldanamycin (EXP)

gemcitabine (EXP)

Genipin (EXP)

genistein (EXP,ISO)

gentamycin (EXP,ISO)

geranial (EXP)

Geraniin (ISO)

geraniol (EXP,ISO)

Gingerenone A (EXP,ISO)

ginkgolide B (EXP,ISO)

Ginkgolide C (ISO)

ginsenoside Rb1 (EXP,ISO)

ginsenoside Rg1 (ISO)

Ginsenoside Rh4 (ISO)

gliclazide (ISO)

glucose (EXP,ISO)

glutathione (EXP,ISO)

Glutathione ethyl ester (EXP)

glyburide (ISO)

glycerol (EXP,ISO)

glycerol 2-phosphate (ISO)

glycochenodeoxycholic acid (EXP)

glycocholic acid (EXP)

glycodeoxycholic acid (EXP)

glycyrrhetinate (ISO)

glycyrrhetinic acid (ISO)

glycyrrhizinic acid (ISO)

glyoxal (EXP,ISO)

glyoxylic acid (ISO)

glyphosate (EXP)

Goe 6976 (EXP)

gold atom (EXP)

gold(0) (EXP)

gossypin (ISO)

gossypol (ISO)

griseofulvin (ISO)

GW 6471 (ISO)

halothane (ISO)

harman (EXP)

heme b (EXP,ISO)

hemin (EXP,ISO)

heparin (ISO)

herbimycin (EXP,ISO)

hesperetin (EXP,ISO)

hesperidin (ISO)

Hexachloro-1,3-butadiene (ISO)

hexachlorobenzene (ISO)

hexadecanoic acid (EXP,ISO)

hexaflumuron (ISO)

hexamethylene diisocyanate (EXP)

hexanal (EXP)

hexane (EXP)

hydralazine (EXP)

hydrogen chloride (ISO)

hydrogen peroxide (EXP,ISO)

hydroquinone (EXP,ISO)

hydroquinone O-beta-D-glucopyranoside (ISO)

hydroxycitronellal (EXP)

hydroxysafflor yellow A (ISO)

hypochlorous acid (EXP,ISO)

iberin (ISO)

idarubicin (EXP)

imidacloprid (ISO)

imidazoles (ISO)

Indeno[1,2,3-cd]pyrene (EXP)

indirubin-3'-monoxime (EXP)

indole-3-methanol (ISO)

indolin-2-one (EXP,ISO)

indoline (EXP)

indometacin (EXP,ISO)

iodixanol (ISO)

iohexol (EXP,ISO)

irinotecan (EXP)

iron atom (EXP,ISO)

iron dextran (ISO)

iron dichloride (EXP)

iron trichloride (EXP,ISO)

iron(0) (EXP,ISO)

iron(2+) sulfate (anhydrous) (EXP,ISO)

iron(III) citrate (EXP)

iron(III) nitrilotriacetate (ISO)

isobutyl nitrite (ISO)

isoeugenol (EXP,ISO)

isoflurane (ISO)

isoimperatorin (EXP)

isoliquiritigenin (ISO)

isoniazide (ISO)

isoprenaline (EXP,ISO)

isorhamnetin (EXP,ISO)

ivermectin (EXP)

kaempferol (EXP,ISO)

kahweol (EXP)

kainic acid (ISO)

ketamine (ISO)

ketoconazole (EXP,ISO)

KN-93 (EXP)

KT 5720 (ISO)

L-1,4-dithiothreitol (EXP,ISO)

L-arginine (ISO)

L-ascorbic acid (EXP,ISO)

L-ascorbic acid 2-phosphate (EXP)

L-cysteine (ISO)

L-dehydroascorbic acid (EXP)

L-glutamic acid (EXP,ISO)

L-methionine (ISO)

lactacystin (ISO)

lactulose (ISO)

lansoprazole (EXP,ISO)

lapatinib (EXP)

lead diacetate (EXP,ISO)

lead nitrate (EXP,ISO)

lead(0) (EXP,ISO)

lead(II) chloride (ISO)

Leonurine (ISO)

letrozole (ISO)

leukotriene B4 (ISO)

leukotriene C4 (ISO)

levetiracetam (ISO)

Licochalcone B (EXP)

lidocaine (ISO)

lignan (ISO)

limonene (EXP,ISO)

limonin (ISO)

linagliptin (ISO)

linalool (EXP)

linoleic acid (EXP,ISO)

linsidomine (EXP)

lipoic acid (EXP,ISO)

lipopolysaccharide (EXP,ISO)

lipoteichoic acid (ISO)

lipoxin A4 (ISO)

liquiritigenin (ISO)

liquiritin (ISO)

liraglutide (ISO)

lithium atom (EXP,ISO)

lithium chloride (EXP,ISO)

lithium hydride (EXP,ISO)

lithocholic acid (EXP,ISO)

loganin (ISO)

loliolide (EXP)

lopinavir (EXP)

losartan (EXP,ISO)

lovastatin (EXP,ISO)

lucidenic acid N (ISO)

Lucidenic acid P (ISO)

Lucidone (EXP)

lutein (ISO)

luteolin (EXP,ISO)

LY294002 (EXP,ISO)

lycopene (EXP,ISO)

lysophosphatidylcholine (EXP)

Macrosphelide B (ISO)

magnesium dichloride (ISO)

Magnolol (ISO)

malaoxon (ISO)

malathion (ISO)

maleic acid (ISO)

malonaldehyde (EXP)

maneb (ISO)

manganese atom (EXP,ISO)

manganese(0) (EXP,ISO)

manganese(II) chloride (ISO)

mangiferin (ISO)

manidipine (EXP)

masoprocol (ISO)

mechlorethamine (ISO)

mefloquine (EXP)

meglumine amidotrizoate (ISO)

MeIQx (EXP)

melatonin (EXP,ISO)

menadione (EXP,ISO)

mercaptoethanol (ISO)

mercury atom (EXP,ISO)

mercury dibromide (EXP)

mercury dichloride (EXP,ISO)

mercury(0) (EXP,ISO)

mesalamine (EXP,ISO)

mesoporphyrin IX (ISO)

metformin (EXP,ISO)

methamphetamine (ISO)

Methanandamide (EXP)

methapyrilene (ISO)

methimazole (ISO)

methotrexate (EXP,ISO)

methyl 3,4,5-trihydroxybenzoate (ISO)

methyl beta-cyclodextrin (ISO)

methyl methacrylate (ISO)

methyl methanesulfonate (EXP,ISO)

methyl non-2-ynoate (EXP)

methyl salicylate (EXP)

methylarsonic acid (EXP,ISO)

methylene blue (ISO)

methylglyoxal (EXP,ISO)

methylisothiazolinone (EXP)

methylmercury chloride (EXP,ISO)

methylparaben (EXP)

Methysticin (ISO)

metoprolol (ISO)

metronidazole (ISO)

metyrapone (ISO)

mevinphos (ISO)

microcystin-LR (EXP,ISO)

midostaurin (EXP)

mifepristone (ISO)

miquelianin (EXP,ISO)

monascin (EXP)

mono(2-ethylhexyl) phthalate (EXP,ISO)

monocrotaline (ISO)

monosodium L-glutamate (ISO)

monothioglycerol (EXP)

montelukast (ISO)

morin (ISO)

morphine (ISO)

Morroniside (ISO)

motexafin gadolinium (EXP)

myricetin (EXP)

N(4)-hydroxycytidine (ISO)

N,N-diethyl-m-toluamide (ISO)

N,N-dimethylformamide (EXP)

N-(6-acetamidohexyl)acetamide (ISO)

N-[2-(4-bromocinnamylamino)ethyl]isoquinoline-5-sulfonamide (EXP,ISO)

N-[3,5-bis(trifluoromethyl)phenyl]-5-chloro-2-hydroxybenzamide (EXP)

N-[3-(aminomethyl)benzyl]acetamidine (ISO)

N-acetyl-L-cysteine (EXP,ISO)

N-acetylsphingosine (ISO)

N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (EXP,ISO)

N-ethyl-N-nitrosourea (ISO)

N-isopropyl-N'-phenyl-p-phenylenediamine (ISO)

N-methyl-4-phenylpyridinium (EXP,ISO)

N-methyl-N-nitrosourea (ISO)

N-methylformamide (ISO)

N-methylnicotinate (EXP)

N-nitrosodiethylamine (ISO)

N-nitrosodimethylamine (ISO)

N-Nitrosopyrrolidine (EXP)

n-propyl gallate (EXP)

N-tosyl-L-phenylalanyl chloromethyl ketone (EXP,ISO)

N1'-[2-[[5-[(dimethylamino)methyl]-2-furanyl]methylthio]ethyl]-N1-methyl-2-nitroethene-1,1-diamine (ISO)

nafenopin (ISO)

naphthalene (ISO)

naphthalene-1,2-diol (EXP)

naringin (ISO)

nefazodone (ISO)

Neferine (EXP)

nelfinavir (ISO)

neomycin (ISO)

nickel atom (EXP,ISO)

nickel dichloride (EXP,ISO)

nickel subsulfide (ISO)

nickel sulfate (EXP,ISO)

nicorandil (ISO)

nicotinamide (ISO)

nicotine (ISO)

nicotinic acid (ISO)

nifedipine (EXP)

nilotinib (ISO)

nimesulide (ISO)

nitisinone (ISO)

nitric oxide (EXP,ISO)

nitrites (ISO)

nitrofen (ISO)

nitrofurantoin (ISO)

nitrogen dioxide (EXP,ISO)

nitroglycerin (EXP,ISO)

nitroprusside (EXP,ISO)

nobiletin (ISO)

Nodosin (ISO)

Nonidet P-40 (EXP)

Nonylphenol (ISO)

norswertianolin (ISO)

notoginsenoside R1 (ISO)

NS-398 (EXP,ISO)

NSC 23766 (ISO)

O-acetyl-L-carnitine (ISO)

o-xylene (EXP)

ochratoxin A (EXP,ISO)

Octachlorostyrene (EXP)

octadecanoic acid (EXP)

octreotide (ISO)

olanzapine (ISO)

oleanolic acid (EXP,ISO)

oleic acid (EXP)

Olmesartan medoxomil (ISO)

Olprinone hydrochloride (ISO)

omeprazole (EXP)

Ophiopogonin D (EXP)

organoselenium compound (EXP)

oridonin (ISO)

oxaliplatin (ISO)

oxidopamine (EXP,ISO)

ozone (EXP,ISO)

p-chloromercuribenzoic acid (EXP)

p-cresol (EXP)

Pachymic acid (EXP,ISO)

paclitaxel (ISO)

paeoniflorin (EXP)

Paeonol (ISO)

Palbinone (ISO)

palmatine (ISO)

panobinostat (EXP)

paracetamol (EXP,ISO)

paraquat (EXP,ISO)

parathion (ISO)

pelargonidin (ISO)

pentachlorophenol (EXP)

pentaerythritol tetranitrate (EXP,ISO)

pentetrazol (ISO)

Pentoxifylline (EXP)

perfluorodecanoic acid (EXP)

perfluorododecanoic acid (EXP)

perfluorohexanesulfonic acid (EXP)

perfluorononanoic acid (EXP)

perfluorooctane-1-sulfonic acid (EXP,ISO)

perfluorooctanoic acid (EXP,ISO)

perfluoroundecanoic acid (EXP)

permethrin (ISO)

peroxides (ISO)

peroxynitrous acid (ISO)

phalloidin (ISO)

phenacetin (ISO)

phencyclidine (ISO)

phenethyl caffeate (EXP,ISO)

phenethyl isothiocyanate (EXP,ISO)

phenobarbital (EXP,ISO)

phenol (EXP)

phenylarsine oxide (ISO)

phenylarsonic acid (ISO)

phenylhydrazine (ISO)

phenylmercury acetate (EXP)

phenytoin (ISO)

PhIP (EXP,ISO)

phlorizin (ISO)

phlorizin chalcone (EXP)

phorbol 13-acetate 12-myristate (EXP,ISO)

phorone (ISO)

phosgene (EXP,ISO)

phosphane (ISO)

physostigmine (ISO)

phytoestrogen (ISO)

picoxystrobin (EXP)

pinostrobin (EXP)

pioglitazone (EXP,ISO)

piperine (ISO)

piperonyl butoxide (ISO)

pipoxolan (ISO)

pirfenidone (ISO)

pirinixic acid (ISO)

platycodin D (EXP)

plumbagin (EXP,ISO)

pluronic P-123 (EXP)

Poloxamer (EXP)

Polpunonic acid (EXP,ISO)

poly(I:C) (ISO)

poly(vinylpyrrolidone) (ISO)

polymyxin B2 (EXP,ISO)

polysorbate 40 (EXP)

potassium bromate (EXP)

potassium chloride (ISO)

potassium dichromate (EXP,ISO)

potassium iodide (ISO)

pravastatin (ISO)

prazosin (ISO)

pregnenolone 16alpha-carbonitrile (ISO)

probucol (ISO)

procyanidin B1 (EXP)

procyanidin B2 (ISO)

procyanidin B3 (ISO)

prodigiosin (ISO)

progesterone (EXP,ISO)

propacetamol (ISO)

propan-2-ol (EXP)

propiconazole (ISO)

propofol (ISO)

propranolol (EXP)

prostaglandin A1 (ISO)

prostaglandin E2 (EXP,ISO)

protein kinase inhibitor (EXP)

protoporphyrin (ISO)

pterostilbene (EXP,ISO)

puerarin (ISO)

Punicalagin (ISO)

puromycin (EXP)

pyrazinecarboxamide (ISO)

pyrazoles (ISO)

pyrethrins (ISO)

pyridine (ISO)

Pyridostigmine bromide (ISO)

pyrimidifen (EXP)

pyrithione (ISO)

pyrrolidine dithiocarbamate (EXP,ISO)

pyrrolidines (ISO)

pyrroloquinoline quinone (ISO)

quartz (ISO)

quercetin (EXP,ISO)

quercetin 3-O-beta-D-glucofuranoside (ISO)

quercetin 3-O-beta-D-glucopyranoside (ISO)

quercetin 4'-O-beta-D-glucopyranoside (EXP)

quinolin-8-ol (EXP,ISO)

rac-lactic acid (EXP)

raloxifene (EXP,ISO)

ranitidine (ISO)

raspberry ketone (ISO)

razoxane (ISO)

reactive oxygen species (EXP,ISO)

resolvin D1 (ISO)

resorcinol (EXP)

resveratrol (EXP,ISO)

Rhynchophylline (ISO)

rifampicin (EXP,ISO)

rimonabant (ISO)

ritonavir (EXP)

Ro 31-8220 (EXP)

roflumilast (EXP,ISO)

rosmarinic acid (EXP)

rotenone (EXP,ISO)

rottlerin (EXP,ISO)

Rutecarpine (EXP)

rutin (ISO)

ryanodine (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (EXP)

S-(1,2-Dichlorovinyl)glutathione (EXP)

S-allylcysteine (EXP)

S-butyl-DL-homocysteine (S,R)-sulfoximine (EXP,ISO)

S-nitroso-N-acetyl-D-penicillamine (ISO)

S-nitrosoglutathione (EXP)

salvianolic acid B (ISO)

saxagliptin (ISO)

SB 203580 (EXP,ISO)

SB 431542 (EXP)

SCH 23390 (ISO)

SCH772984 (EXP)

scopolamine (ISO)

selenium atom (EXP,ISO)

serpentine asbestos (EXP,ISO)

sesquiterpene (EXP,ISO)

sevoflurane (ISO)

sildenafil citrate (ISO)

silibinin (ISO)

silicon atom (EXP)

silicon dioxide (EXP,ISO)

silver atom (EXP,ISO)

silver(0) (EXP,ISO)

silver(1+) nitrate (EXP)

simvastatin (EXP,ISO)

sinapic acid (ISO)

sirolimus (ISO)

sodium arsenate (EXP,ISO)

sodium arsenite (EXP,ISO)

sodium chloride (ISO)

sodium cholate (ISO)

sodium dichromate (EXP,ISO)

sodium dodecyl sulfate (EXP,ISO)

sodium fluoride (EXP,ISO)

solanesol (EXP)

Soman (ISO)

spironolactone (ISO)

staurosporine (EXP,ISO)

sterigmatocystin (ISO)

streptozocin (EXP,ISO)

styrene (ISO)

styrene oxide (EXP)

succimer (EXP,ISO)

sulfadimethoxine (ISO)

sulfaphenazole (ISO)

sulfasalazine (ISO)

sulforaphane (EXP,ISO)

sulfur dioxide (ISO)

sulindac (EXP)

sunitinib (EXP)

superoxide (EXP,ISO)

surfactin (EXP)

surfactin C (EXP)

T-2 toxin (ISO)

tacrine (ISO)

tacrolimus hydrate (EXP,ISO)

tadalafil (ISO)

tamoxifen (EXP,ISO)

tangeretin (ISO)

Tanshinone I (EXP,ISO)

taurine (ISO)

tebufenpyrad (EXP)

tectorigenin (ISO)

temozolomide (EXP)

TEMPO (EXP)

tert-butyl hydroperoxide (EXP,ISO)

Tesaglitazar (ISO)

testosterone (EXP,ISO)

tetrachloro-1,4-benzoquinone (ISO)

tetrachloromethane (EXP,ISO)

tetracycline (ISO)

tetrahydropalmatine (EXP)

tetramethylpyrazine (EXP)

tetrathiomolybdate(2-) (EXP,ISO)

thallium sulfate (ISO)

thapsigargin (EXP)

Theaflavin 3,3'-digallate (ISO)

thiazoles (EXP)

thifluzamide (EXP)

thimerosal (EXP)

thioacetamide (ISO)

thiostrepton (EXP)

thiram (EXP,ISO)

thymidine (EXP)

thymine (EXP)

thymoquinone (EXP)

ticlopidine (EXP)

tideglusib (EXP)

tienilic acid (EXP)

tin(II) chloride (anhydrous) (ISO)

Tiopronin (EXP)

Tiron (EXP,ISO)

titanium dioxide (EXP,ISO)

tobramycin (EXP)

toluene (EXP,ISO)

topotecan (ISO)

trans-anethole (ISO)

trans-isoeugenol (EXP,ISO)

trans-rhaponticin (ISO)

tranylcypromine (ISO)

triacetin (EXP)

triacsin C (EXP)

tributylstannane (ISO)

Tributyltin oxide (ISO)

tricalcium bis(phosphate) (ISO)

tricetin (EXP)

Tricetinidin (ISO)

trichloroacetaldehyde (EXP)

trichloroacetic acid (EXP)

Trichloroacetonitrile (EXP)

trichloroethene (EXP,ISO)

trichostatin A (EXP,ISO)

triclosan (EXP,ISO)

trilobatin (ISO)

trimethylarsine oxide (ISO)

trimethyltin (EXP,ISO)

triphenyl phosphate (ISO)

Triptolide (EXP,ISO)

Tris(1-aziridinyl)phosphine oxide (ISO)

tris(2-butoxyethyl) phosphate (EXP,ISO)

troglitazone (EXP,ISO)

tropisetron (ISO)

trovafloxacin (ISO)

Tungsten carbide (EXP)

tunicamycin (EXP,ISO)

tyrphostin AG 1478 (EXP)

undecan-2-one (ISO)

urea (EXP,ISO)

urethane (EXP)

valproic acid (EXP,ISO)

valsartan (ISO)

vancomycin (ISO)

vanillin (EXP)

verapamil (EXP,ISO)

verteporfin (ISO)

vincaleukoblastine (ISO)

vinclozolin (ISO)

vincristine (EXP,ISO)

vitamin E (EXP,ISO)

vitexin (ISO)

warfarin (ISO)

water (ISO)

withaferin A (ISO)

wortmannin (EXP,ISO)

Xamoterol (ISO)

Xanthatin (EXP)

xanthohumol (EXP)

XAV939 (EXP)

yttrium chloride (ISO)

zearalenone (ISO)

zidovudine (ISO)

zinc acetate (EXP,ISO)

zinc atom (EXP,ISO)

zinc dichloride (EXP,ISO)

zinc molecular entity (EXP)

zinc oxide (EXP,ISO)

zinc protoporphyrin (EXP,ISO)

zinc pyrithione (EXP,ISO)

zinc sulfate (EXP,ISO)

zinc(0) (EXP,ISO)

ziprasidone (ISO)

ziram (EXP)

zoledronic acid (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

angiogenesis (ISO,TAS)

apoptotic process (IEA)

cellular response to arsenic-containing substance (IEA,ISO)

cellular response to cadmium ion (IEA,ISO)

cellular response to cisplatin (IEA,ISO)

cellular response to heat (IMP)

cellular response to nutrient (ISO)

endothelial cell proliferation (TAS)

epithelial cell apoptotic process (IEA,ISO)

erythrocyte homeostasis (IMP)

heme catabolic process (IBA,IDA,IEA,ISO)

heme metabolic process (IEA,ISO)

heme oxidation (IBA,IDA,IEA)

intracellular iron ion homeostasis (IDA,IMP)

intracellular signal transduction (ISO,TAS)

intrinsic apoptotic signaling pathway in response to DNA damage (ISO)

liver regeneration (ISO)

low-density lipoprotein particle clearance (TAS)

macroautophagy (IEA,ISO)

multicellular organismal-level iron ion homeostasis (IMP)

negative regulation by host of viral transcription (ISO)

negative regulation of cell population proliferation (ISO)

negative regulation of DNA binding (ISO)

negative regulation of DNA-binding transcription factor activity (ISO)

negative regulation of epithelial cell apoptotic process (ISO)

negative regulation of extrinsic apoptotic signaling pathway via death domain receptors (IMP)

negative regulation of ferroptosis (IMP)

negative regulation of leukocyte migration (TAS)

negative regulation of macroautophagy (IEA,ISO)

negative regulation of mast cell cytokine production (ISO)

negative regulation of mast cell degranulation (ISO)

negative regulation of muscle cell apoptotic process (ISO)

negative regulation of neuron apoptotic process (ISO)

negative regulation of smooth muscle cell proliferation (IDA,ISO)

negative regulation of vascular associated smooth muscle cell proliferation (ISO)

negative regulation of viral life cycle (ISO)

positive regulation of angiogenesis (IDA,ISO)

positive regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis (IGI)

positive regulation of canonical NF-kappaB signal transduction (HMP)

positive regulation of cell migration involved in sprouting angiogenesis (IGI)

positive regulation of chemokine production (TAS)

positive regulation of epithelial cell apoptotic process (IEA,ISO)

positive regulation of macroautophagy (IEA,ISO)

positive regulation of smooth muscle cell proliferation (IDA)

regulation of angiogenesis (TAS)

regulation of blood pressure (ISO)

regulation of transcription by RNA polymerase II (ISS)

response to 3-methylcholanthrene (ISO)

response to arachidonic acid (ISO)

response to estrogen (ISO)

response to hydrogen peroxide (ISS)

response to hypoxia (ISO)

response to nicotine (IDA)

response to oxidative stress (IBA,IEA,IMP,ISO)

response to xenobiotic stimulus (ISO)

small GTPase-mediated signal transduction (ISO)

smooth muscle hyperplasia (TAS)

wound healing involved in inflammatory response (IMP)

Cellular Component

caveola (ISO)

cytosol (IEA,ISO,TAS)

endoplasmic reticulum (IDA,IEA,ISS,TAS)

endoplasmic reticulum membrane (IDA,IEA,IMP,TAS)

extracellular space (TAS)

membrane (IEA,TAS)

mitochondrial outer membrane (TAS)

nucleoplasm (TAS)

nucleus (IEA,ISS)

perinuclear region of cytoplasm (IDA)

Molecular Function

arachidonic acid omega-hydroxylase activity (ISO)

enzyme binding (ISS)

heme binding (IBA,IDA,IEA,ISO)

heme oxygenase (decyclizing) activity (IBA,IDA,IEA,IMP,ISO,TAS)

identical protein binding (IPI)

metal ion binding (IEA)

oxidoreductase activity (IEA)

phospholipase D activity (ISO)

protein binding (IPI,ISO)

protein homodimerization activity (IDA)

structural molecule activity (IMP)

Molecular Pathway Annotations Click to see Annotation Detail View

acute intermittent porphyria pathway (EXP)

erythropoietic porphyria pathway (EXP)

heme degradation pathway (ISO)

hereditary coproporphyria pathway (EXP)

hypertension pathway (ISO)

hypoxia inducible factor pathway (EXP)

oxidative stress response pathway (ISO)

porphyrin and chlorophyll metabolic pathway (IEA)

porphyrin metabolic pathway (EXP)

variegate porphyria pathway (EXP)

Phenotype Annotations Click to see Annotation Detail View

Human Phenotype

Abnormality of the liver (IAGP)

Absent vas deferens (IAGP)

Airway obstruction (IAGP)

Anxiety (IAGP)

Asplenia (IAGP)

Asthma (IAGP)

Autosomal recessive inheritance (IAGP)

Bronchiectasis (IAGP)

Cervical lymphadenopathy (IAGP)

Chemosis (IAGP)

Chronic pulmonary obstruction (IAGP)

Cirrhosis (IAGP)

Coombs-positive hemolytic anemia (IAGP)

Decreased body mass index (IAGP)

Depression (IAGP)

Diffuse alveolar hemorrhage (IAGP)

Elevated circulating alanine aminotransferase concentration (IAGP)

Elevated circulating aspartate aminotransferase concentration (IAGP)

Elevated circulating C-reactive protein concentration (IAGP)

Elevated circulating hepatic transaminase concentration (IAGP)

Elevated sweat chloride (IAGP)

Epistaxis (IAGP)

Exocrine pancreatic insufficiency (IAGP)

Failure to thrive (IAGP)

Gastroesophageal reflux (IAGP)

Global developmental delay (IAGP)

Growth delay (IAGP)

Hearing impairment (IAGP)

Hematuria (IAGP)

Hemolytic anemia (IAGP)

Hemoptysis (IAGP)

Hepatomegaly (IAGP)

Hyperbilirubinemia (IAGP)

Hypertension (IAGP)

Hypotriglyceridemia (IAGP)

Increased circulating ferritin concentration (IAGP)

Increased circulating interleukin 6 concentration (IAGP)

Increased circulating lactate dehydrogenase concentration (IAGP)

Increased HDL cholesterol concentration (IAGP)

Lymphadenopathy (IAGP)

Malabsorption (IAGP)

Male infertility (IAGP)

Meconium ileus (IAGP)

Nasal polyposis (IAGP)

Nephritis (IAGP)

Nephrolithiasis (IAGP)

Nontuberculous mycobacterial pulmonary infection (IAGP)

Osteopenia (IAGP)

Osteoporosis (IAGP)

Pneumothorax (IAGP)

Proteinuria (IAGP)

Rectal prolapse (IAGP)

Recurrent Aspergillus infections (IAGP)

Recurrent Burkholderia cepacia infections (IAGP)

Recurrent Haemophilus influenzae infections (IAGP)

Recurrent lower respiratory tract infections (IAGP)

Recurrent respiratory infections (IAGP)

Recurrent Staphylococcus aureus infections (IAGP)

Reduced forced expiratory volume in one second (IAGP)

Sepsis (IAGP)

Sinusitis (IAGP)

Steatorrhea (IAGP)

Thrombocytosis (IAGP)

References

References - curated

#	Reference Title	Reference Citation
1.	3-methylcholanthrene and benzo(a)pyrene modulate cardiac cytochrome P450 gene expression and arachidonic acid metabolism in male Sprague Dawley rats.	Aboutabl ME, etal., Br J Pharmacol. 2009 Dec;158(7):1808-19. doi: 10.1111/j.1476-5381.2009.00461.x.
2.	Heme oxygenase-1 is expressed in carotid atherosclerotic plaques infected by Helicobacter pylori and is more prevalent in asymptomatic subjects.	Ameriso SF, etal., Stroke. 2005 Sep;36(9):1896-900. Epub 2005 Aug 11.
3.	Role of heme oxygenase-1 in protection of the kidney after hemorrhagic shock.	Arimori Y, etal., Int J Mol Med. 2010 Jul;26(1):27-32.
4.	Microsatellite polymorphism in the heme oxygenase-1 gene promoter is associated with iron status in persons with type 2 diabetes mellitus.	Arredondo M, etal., Am J Clin Nutr. 2007 Nov;86(5):1347-53.
5.	Heme oxygenase-1-related carbon monoxide production and ventricular fibrillation in isolated ischemic/reperfused mouse myocardium.	Bak I, etal., FASEB J. 2003 Nov;17(14):2133-5. Epub 2003 Sep 4.
6.	The role of AT1-receptor blockade on reactive oxygen species and cardiac autonomic drive in experimental hyperthyroidism.	Baraldi D, etal., Auton Neurosci. 2013 Oct;177(2):163-9. doi: 10.1016/j.autneu.2013.04.003. Epub 2013 Apr 26.
7.	Heme oxygenase-1 gene promoter polymorphism is associated with reduced incidence of acute chest syndrome among children with sickle cell disease.	Bean CJ, etal., Blood. 2012 Nov 1;120(18):3822-8. doi: 10.1182/blood-2011-06-361642. Epub 2012 Sep 10.
8.	Induction of Hsp27 and Hsp32 stress proteins and vimentin in glial cells of the rat hippocampus following hyperthermia.	Bechtold DA and Brown IR, Neurochem Res 2003 Aug;28(8):1163-73.
9.	Heme oxygenase-1 gene delivery by Sleeping Beauty inhibits vascular stasis in a murine model of sickle cell disease.	Belcher JD, etal., J Mol Med (Berl). 2010 Jul;88(7):665-75. doi: 10.1007/s00109-010-0613-6. Epub 2010 Mar 23.
10.	Pharmacological activation of heme oxygenase (HO)-1/carbon monoxide pathway prevents the development of peripheral neuropathic pain in Wistar rats.	Bijjem KR, etal., Naunyn Schmiedebergs Arch Pharmacol. 2013 Jan;386(1):79-90. doi: 10.1007/s00210-012-0816-1. Epub 2012 Dec 9.
11.	Hemin induction of HO-1 protects against LPS-induced septic ileus.	Bortscher S, etal., J Surg Res. 2012 Dec;178(2):866-73. doi: 10.1016/j.jss.2012.07.064. Epub 2012 Aug 15.
12.	Increase in heme oxygenase-1 levels ameliorates renovascular hypertension.	Botros FT, etal., Kidney Int. 2005 Dec;68(6):2745-55.
13.	Intramuscular heat shock protein 72 and heme oxygenase-1 mRNA are reduced in patients with type 2 diabetes: evidence that insulin resistance is associated with a disturbed antioxidant defense mechanism.	Bruce CR, etal., Diabetes. 2003 Sep;52(9):2338-45.
14.	Lentiviral-human heme oxygenase targeting endothelium improved vascular function in angiotensin II animal model of hypertension.	Cao J, etal., Hum Gene Ther. 2011 Mar;22(3):271-82. doi: 10.1089/hum.2010.059. Epub 2011 Jan 27.
15.	High-fat diet exacerbates renal dysfunction in SHR: reversal by induction of HO-1-adiponectin axis.	Cao J, etal., Obesity (Silver Spring). 2012 May;20(5):945-53. doi: 10.1038/oby.2011.365. Epub 2011 Dec 22.
16.	Regulation of heme oxygenase-1 by nitric oxide during hepatopulmonary syndrome.	Carter EP, etal., Am J Physiol Lung Cell Mol Physiol 2002 Aug;283(2):L346-53.
17.	Heme oxygenase-1 inhibition prevents intimal hyperplasia enhancing nitric oxide-dependent apoptosis of vascular smooth muscle cells.	Cerrito MG, etal., Biol Pharm Bull. 2011;34(8):1204-14.
18.	Baicalein protects against retinal ischemia by antioxidation, antiapoptosis, downregulation of HIF-1alpha, VEGF, and MMP-9 and upregulation of HO-1.	Chao HM, etal., J Ocul Pharmacol Ther. 2013 Jul-Aug;29(6):539-49. doi: 10.1089/jop.2012.0179. Epub 2013 Mar 28.
19.	Study on changes of heme oxygenase-1 expression in patients with coronary heart disease.	Chen SM, etal., Clin Cardiol. 2005 Apr;28(4):197-201.
20.	Elevated serum heme oxygenase-1 and insulin-like growth factor-1 levels in patients with Henoch-Schonlein purpura.	Chen T, etal., Rheumatol Int. 2011 Mar;31(3):321-6. doi: 10.1007/s00296-009-1254-3. Epub 2009 Dec 16.
21.	Increased vascular heme oxygenase-1 expression contributes to arterial vasodilation in experimental cirrhosis in rats.	Chen YC, etal., Hepatology. 2004 Apr;39(4):1075-87.
22.	Microsatellite polymorphism in promoter of heme oxygenase-1 gene is associated with susceptibility to coronary artery disease in type 2 diabetic patients.	Chen YH, etal., Hum Genet. 2002 Jul;111(1):1-8. Epub 2002 Jun 19.
23.	Oxidant stress responses in influenza virus pneumonia: gene expression and transcription factor activation.	Choi AM, etal., Am J Physiol. 1996 Sep;271(3 Pt 1):L383-91.
24.	Beneficial effect of prolonged heme oxygenase 1 activation in a rat model of chronic heart failure.	Collino M, etal., Dis Model Mech. 2013 Jul;6(4):1012-20. doi: 10.1242/dmm.011528. Epub 2013 Apr 16.
25.	Heme oxygenase-1 plays a pro-life role in experimental brain stem death via nitric oxide synthase I/protein kinase G signaling at rostral ventrolateral medulla.	Dai KY, etal., J Biomed Sci. 2010 Sep 7;17:72. doi: 10.1186/1423-0127-17-72.
26.	Effectiveness of miltefosine treatment in targeting anti-leishmanial HO-1/Nrf-2-mediated oxidative responses in visceral leishmaniasis patients.	Das S, etal., J Antimicrob Chemother. 2013 Sep;68(9):2059-65. doi: 10.1093/jac/dkt162. Epub 2013 May 31.
27.	The protection by heme oxygenase-1 induction against thioacetamide-induced liver toxicity is associated with changes in arginine and asymmetric dimethylarginine.	Develi-Is S, etal., Cell Biochem Funct. 2013 Mar;31(2):122-8. doi: 10.1002/cbf.2866. Epub 2012 Aug 13.
28.	Hyperglycemia in streptozotocin-induced diabetic rat increases infarct size associated with low levels of myocardial HO-1 during ischemia/reperfusion.	Di Filippo C, etal., Diabetes. 2005 Mar;54(3):803-10.
29.	Therapeutic effect of placenta-derived mesenchymal stem cells on hypoxic-ischemic brain damage in rats.	Ding HF, etal., World J Pediatr. 2015 Feb;11(1):74-82. doi: 10.1007/s12519-014-0531-8. Epub 2014 Dec 1.
30.	Transient elevation of serum bilirubin (a heme oxygenase-1 metabolite) level in hemorrhagic stroke: bilirubin is a marker of oxidant stress.	Dohi K, etal., Acta Neurochir Suppl. 2003;86:247-9.
31.	Heme oxygenase (HO)-1 is upregulated in the nasal mucosa with allergic rhinitis.	Elhini A, etal., Laryngoscope. 2006 Mar;116(3):446-50.
32.	A microsatellite polymorphism in the heme oxygenase-1 gene promoter is associated with increased bilirubin and HDL levels but not with coronary artery disease.	Endler G, etal., Thromb Haemost. 2004 Jan;91(1):155-61.
33.	The protective effect of salvianolic acid B on blood-spinal cord barrier after compression spinal cord injury in rats.	Fan ZK, etal., J Mol Neurosci. 2013 Nov;51(3):986-93. doi: 10.1007/s12031-013-0083-8. Epub 2013 Aug 14.
34.	Increased heme oxygenase-1 expression in premature infants with respiratory distress syndrome.	Farkas I, etal., Eur J Pediatr. 2008 Dec;167(12):1379-83. Epub 2008 Feb 27.
35.	Absence of heme oxygenase-1 expression in the lung parenchyma exacerbates endotoxin-induced acute lung injury and decreases surfactant protein-B levels.	Fredenburgh LE, etal., Cell Mol Biol (Noisy-le-grand). 2005 Oct 3;51(5):513-20.
36.	Expression of heme oxygenase-1 protein and messenger RNA in permanent cerebral ischemia in rats.	Fu R, etal., Neurol Res. 2006 Jan;28(1):38-45.
37.	Heme oxygenase-1 polymorphism associated with severity of chronic obstructive pulmonary disease.	Fu WP, etal., Chin Med J (Engl). 2007 Jan 5;120(1):12-6.
38.	Relationship between COPD and polymorphisms of HOX-1 and mEPH in a Chinese population.	Fu WP, etal., Oncol Rep. 2007 Feb;17(2):483-8.
39.	Systemic perfluorohexane attenuates lung injury induced by lipopolysaccharide in rats: the role of heme oxygenase-1.	Ge ZJ, etal., Pharmacol Rep. 2010 Jan-Feb;62(1):170-7.
40.	Induction of heme oxygenase 1 attenuates placental ischemia-induced hypertension.	George EM, etal., Hypertension. 2011 May;57(5):941-8. doi: 10.1161/HYPERTENSIONAHA.111.169755. Epub 2011 Mar 7.
41.	GOAs Human GO annotations	GOA_HUMAN data from the GO Consortium
42.	Antioxidant role of heme oxygenase-1 in prehepatic portal hypertensive rats.	Gonzales S, etal., World J Gastroenterol. 2006 Jul 14;12(26):4149-55.
43.	The systemic administration of oleoylethanolamide exerts neuroprotection of the nigrostriatal system in experimental Parkinsonism.	Gonzalez-Aparicio R, etal., Int J Neuropsychopharmacol. 2014 Mar;17(3):455-68. doi: 10.1017/S1461145713001259. Epub 2013 Oct 29.
44.	Heme oxygenase-1 reduces murine monocrotaline-induced pulmonary inflammatory responses and resultant right ventricular overload.	Goto J, etal., Antioxid Redox Signal. 2002 Aug;4(4):563-8.
45.	Induction of heme oxygenase-1, biliverdin reductase and H-ferritin in lung macrophage in smokers with primary spontaneous pneumothorax: role of HIF-1alpha.	Goven D, etal., PLoS One. 2010 May 28;5(5):e10886.
46.	Dynamic Changes of Heme Oxygenase-1 in the Hippocampus of Rats After Acute Carbon Monoxide Poisoning.	Guan L, etal., Arch Environ Contam Toxicol. 2010 Apr 27.
47.	Induction of heme oxygenase-1 with hemin attenuates hippocampal injury in rats after acute carbon monoxide poisoning.	Guan L, etal., Toxicology. 2009 Aug 3;262(2):146-52. Epub 2009 Jun 9.
48.	Clinical restenosis after coronary stent implantation is associated with the heme oxygenase-1 gene promoter polymorphism and the heme oxygenase-1 +99G/C variant.	Gulesserian T, etal., Clin Chem. 2005 Sep;51(9):1661-5. Epub 2005 Jul 14.
49.	Effects of heme oxygenase-1 on pulmonary function and structure in rats with liver cirrhosis.	Guo SB, etal., Chin Med J (Engl). 2011 Mar;124(6):918-22.
50.	Transduction of PEP-1-heme oxygenase-1 fusion protein reduces myocardial ischemia/reperfusion injury in rats.	He XH, etal., J Cardiovasc Pharmacol. 2013 Nov;62(5):436-42. doi: 10.1097/FJC.0b013e3182a0b638.
51.	Microarray studies of genomic oxidative stress and cell cycle responses in obstructive sleep apnea.	Hoffmann MS, etal., Antioxid Redox Signal. 2007 Jun;9(6):661-9.
52.	Simvastatin ameliorates established pulmonary hypertension through a heme oxygenase-1 dependent pathway in rats.	Hsu HH, etal., Respir Res. 2009 May 2;10:32.
53.	2-methoxycinnamaldehyde from Cinnamomum cassia reduces rat myocardial ischemia and reperfusion injury in vivo due to HO-1 induction.	Hwa JS, etal., J Ethnopharmacol. 2012 Jan 31;139(2):605-15. doi: 10.1016/j.jep.2011.12.001. Epub 2011 Dec 9.
54.	Combinational therapy of ischemic brain stroke by delivery of heme oxygenase-1 gene and dexamethasone.	Hyun H, etal., Biomaterials. 2011 Jan;32(1):306-15. doi: 10.1016/j.biomaterials.2010.08.116.
55.	Hemin prevents in-stent stenosis in rat and rabbit models by inducing heme-oxygenase-1.	Hyvelin JM, etal., J Vasc Surg. 2010 Feb;51(2):417-28.
56.	Dietary alpha-linolenic acid-rich formula reduces adhesion molecules in rats with experimental colitis.	Ibrahim A, etal., Nutrition. 2012 Jul;28(7-8):799-802. doi: 10.1016/j.nut.2011.10.008. Epub 2012 Jan 20.
57.	Heme oxygenase-1 against vascular insufficiency: roles of atherosclerotic disorders.	Ishikawa K Curr Pharm Des. 2003;9(30):2489-97.
58.	Upregulation of cytoprotective defense mechanisms and hypoxia-responsive proteins imparts tolerance to acute hypobaric hypoxia.	Jain K, etal., High Alt Med Biol. 2013 Mar;14(1):65-77. doi: 10.1089/ham.2012.1064.
59.	Activation of hypoxia-inducible factor-1alpha via nuclear factor-kappa B in rats with chronic obstructive pulmonary disease.	Jiang H, etal., Acta Biochim Biophys Sin (Shanghai). 2010 Jul;42(7):483-8. doi: 10.1093/abbs/gmq041. Epub 2010 Jun 10.
60.	Postischemic cardiac recovery in heme oxygenase-1 transgenic ischemic/reperfused mouse myocardium.	Juhasz B, etal., J Cell Mol Med. 2010 Aug 16.
61.	Epigallocatechin-3-gallate protects kidneys from ischemia reperfusion injury by HO-1 upregulation and inhibition of macrophage infiltration.	Kakuta Y, etal., Transpl Int. 2011 May;24(5):514-22. doi: 10.1111/j.1432-2277.2011.01224.x. Epub 2011 Feb 3.
62.	Polymorphisms of heme oxygenase-1 and bilirubin UDP-glucuronosyltransferase genes are not associated with Kawasaki disease susceptibility.	Kanai M, etal., Tohoku J Exp Med. 2003 Jul;200(3):155-9.
63.	Heme oxygenase-1 gene promoter polymorphism is associated with coronary artery disease in Japanese patients with coronary risk factors.	Kaneda H, etal., Arterioscler Thromb Vasc Biol. 2002 Oct 1;22(10):1680-5.
64.	Heme oxygenase 1 modulates thrombomodulin and endothelial protein C receptor levels to attenuate septic kidney injury.	Kang K, etal., Shock. 2013 Aug;40(2):136-43. doi: 10.1097/SHK.0b013e31829d23f5.
65.	Vascular insult accompanied by overexpressed heme oxygenase-1 as a pathophysiological mechanism in experimental neurolathyrism with hind-leg paraparesis.	Kawaguchi K, etal., Biochem Biophys Res Commun. 2012 Nov 9;428(1):160-6. doi: 10.1016/j.bbrc.2012.10.032. Epub 2012 Oct 12.
66.	Hydrogen gas reduces hyperoxic lung injury via the Nrf2 pathway in vivo.	Kawamura T, etal., Am J Physiol Lung Cell Mol Physiol. 2013 May 15;304(10):L646-56. doi: 10.1152/ajplung.00164.2012. Epub 2013 Mar 8.
67.	Cytoprotective and antiapoptotic effects of IL-13 in hepatic cold ischemia/reperfusion injury are heme oxygenase-1 dependent.	Ke B, etal., Am J Transplant. 2003 Sep;3(9):1076-82.
68.	KEGG: Kyoto Encyclopedia of Genes and Genomes	KEGG
69.	Association of susceptibility to the development of lung adenocarcinoma with the heme oxygenase-1 gene promoter polymorphism.	Kikuchi A, etal., Hum Genet. 2005 Apr;116(5):354-60. Epub 2005 Feb 2.
70.	Phenolic antioxidants tert-butyl-bisphenol and vitamin E decrease oxidative stress and enhance vascular function in an animal model of rhabdomyolysis yet do not improve acute renal dysfunction.	Kim HB, etal., Free Radic Res. 2011 Sep;45(9):1000-12. doi: 10.3109/10715762.2011.590137. Epub 2011 Jul 5.
71.	Caveolae compartmentalization of heme oxygenase-1 in endothelial cells.	Kim HP, etal., FASEB J 2004 Jul;18(10):1080-9.
72.	Association of reduced heme oxygenase-1 with excessive Toll-like receptor 4 expression in peripheral blood mononuclear cells in Behcet's disease.	Kirino Y, etal., Arthritis Res Ther. 2008;10(1):R16. doi: 10.1186/ar2367. Epub 2008 Jan 31.
73.	High extracellular induced sputum haem oxygenase-1 in sarcoidosis and chronic beryllium disease.	Kokturk N, etal., Eur J Clin Invest. 2009 Jul;39(7):584-90. Epub 2009 Apr 27.
74.	Sunitinib Inhibits Breast Cancer Cell Proliferation by Inducing Apoptosis, Cell-cycle Arrest and DNA Repair While Inhibiting NF-κB Signaling Pathways.	Korashy HM, etal., Anticancer Res. 2017 Sep;37(9):4899-4909. doi: 10.21873/anticanres.11899.
75.	Evaluation of the heme oxygenase-1 expression in esophagitis and esophageal cancer induced by different reflux experimental models and diethylnitrosamine.	Kruel CR, etal., Acta Cir Bras. 2010 Jun;25(3):304-10.
76.	Transient limb ischemia induces remote preconditioning in liver among rats: the protective role of heme oxygenase-1.	Lai IR, etal., Transplantation. 2006 May 15;81(9):1311-7.
77.	Expression and regulation of hemeoxygenase 1 in healthy human lung and interstitial lung disorders.	Lakari E, etal., Hum Pathol. 2001 Nov;32(11):1257-63.
78.	Expression of heme oxygenase-1 in response to myocardial infarction in rats.	Lakkisto P, etal., J Mol Cell Cardiol. 2002 Oct;34(10):1357-65.
79.	Heme oxygenase-1 mediated memorial and revivable protective effect of ischemic preconditioning on brain injury.	Le LL, etal., CNS Neurosci Ther. 2013 Dec;19(12):963-8. doi: 10.1111/cns.12152. Epub 2013 Jul 22.
80.	Anti-asthmatic effect of Sanguisorba officinalis L. and potential role of heme oxygenase-1 in an ovalbumin-induced murine asthma model.	Lee NH, etal., Int J Mol Med. 2010 Aug;26(2):201-8.
81.	Baicalein, an active component of Scutellaria baicalensis Georgi, improves cardiac contractile function in endotoxaemic rats via induction of heme oxygenase-1 and suppression of inflammatory responses.	Lee YM, etal., J Ethnopharmacol. 2011 Apr 26;135(1):179-85. doi: 10.1016/j.jep.2011.03.009. Epub 2011 Mar 17.
82.	Hypoxia inducible factor-1 alpha correlates the expression of heme oxygenase 1 gene in pulmonary arteries of rat with hypoxia-induced pulmonary hypertension.	Li QF and Dai AG, Acta Biochim Biophys Sin (Shanghai). 2004 Feb;36(2):133-40.
83.	Tin chloride enhances parvalbumin-positive interneuron survival by modulating heme metabolism in a model of cerebral ischemia.	Li Volti G, etal., Neurosci Lett. 2011 Mar 29;492(1):33-8. doi: 10.1016/j.neulet.2011.01.048. Epub 2011 Jan 27.
84.	Mesenchymal Stromal Cells Expressing Heme Oxygenase-1 Reverse Pulmonary Hypertension.	Liang OD, etal., Stem Cells. 2010 Oct 18.
85.	Lesional accumulation of heme oxygenase-1+ microglia/macrophages in rat traumatic brain injury.	Liu Y, etal., Neuroreport. 2013 Apr 17;24(6):281-6. doi: 10.1097/WNR.0b013e32835f2810.
86.	Induction of heat shock proteins in the adult rat cerebral cortex following pilocarpine-induced status epilepticus.	Lively S and Brown IR, Brain Res. 2010 Oct 21.
87.	Effect of hypertonic saline resuscitation on heme oxygenase-1 mRNA expression and apoptosis of the intestinal mucosa in a rat model of hemorrhagic shock.	Lu YQ, etal., Chin Med J (Engl). 2010 Jun;123(11):1453-8.
88.	Ischemic preconditioning of small bowel mitigates the late phase of reperfusion injury: heme oxygenase mediates cytoprotection.	Mallick IH, etal., Am J Surg. 2010 Feb;199(2):223-31. doi: 10.1016/j.amjsurg.2009.01.011. Epub 2009 Apr 11.
89.	Comparison of Human and Experimental Pulmonary Veno-Occlusive Disease.	Manaud G, etal., Am J Respir Cell Mol Biol. 2020 Jul;63(1):118-131. doi: 10.1165/rcmb.2019-0015OC.
90.	Heme oxygenase-1 and the ischemia-reperfusion injury in the rat heart.	Masini E, etal., Exp Biol Med (Maywood). 2003 May;228(5):546-9.
91.	Expression of heme oxygenase-1 in the peripheral blood mononuclear cells from asthmatic patients.	Mo B, etal., J Huazhong Univ Sci Technolog Med Sci. 2005;25(4):385-8.
92.	A phosphodiesterase III inhibitor protects rat liver from sinusoidal obstruction syndrome through heme oxygenase-1 induction.	Narita M, etal., Ann Surg. 2009 May;249(5):806-13.
93.	Oxidative stress and induction of heme oxygenase-1 in the kidney in sickle cell disease.	Nath KA, etal., Am J Pathol. 2001 Mar;158(3):893-903.
94.	Heme protein-induced chronic renal inflammation: suppressive effect of induced heme oxygenase-1.	Nath KA, etal., Kidney Int. 2001 Jan;59(1):106-17.
95.	Hemin therapy suppresses inflammation and retroperitoneal adipocyte hypertrophy to improve glucose metabolism in obese rats co-morbid with insulin-resistant type-2 diabetes.	Ndisang JF and Jadhav A, Diabetes Obes Metab. 2013 Nov;15(11):1029-39. doi: 10.1111/dom.12130. Epub 2013 Jun 30.
96.	Selective regulation of blood pressure by heme oxygenase-1 in hypertension.	Ndisang JF, etal., Hypertension. 2002 Sep;40(3):315-21.
97.	Protein therapy using heme-oxygenase-1 fused to a polyarginine transduction domain attenuates cerebral vasospasm after experimental subarachnoid hemorrhage.	Ogawa T, etal., J Cereb Blood Flow Metab. 2011 Nov;31(11):2231-42. doi: 10.1038/jcbfm.2011.87. Epub 2011 Jun 8.
98.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
99.	A promoter variant of the heme oxygenase-1 gene may reduce the incidence of ischemic heart disease in Japanese.	Ono K, etal., Atherosclerosis. 2004 Apr;173(2):315-9.
100.	Association of a promoter variant of the haeme oxygenase-1 gene with hypertension in women.	Ono K, etal., J Hypertens. 2003 Aug;21(8):1497-503.
101.	Protective effect of heme oxygenase-1 on lung injury induced by erythrocyte instillation in rats.	Pang QF, etal., Chin Med J (Engl). 2008 Sep 5;121(17):1688-92.
102.	Evaluation of oxidative status and depression-like responses in Brown Norway rats with acute myeloid leukemia.	Papiez MA, etal., Prog Neuropsychopharmacol Biol Psychiatry. 2009 Jun 15;33(4):596-604. doi: 10.1016/j.pnpbp.2009.02.015. Epub 2009 Mar 3.
103.	The microglial alpha7-acetylcholine nicotinic receptor is a key element in promoting neuroprotection by inducing heme oxygenase-1 via nuclear factor erythroid-2-related factor 2.	Parada E, etal., Antioxid Redox Signal. 2013 Oct 10;19(11):1135-48. doi: 10.1089/ars.2012.4671. Epub 2013 Feb 25.
104.	Ischemia/reperfusion Lung Injury Increases Serum Ferritin and Heme Oxygenase-1 in Rats.	Park YY Korean J Physiol Pharmacol. 2009 Jun;13(3):181-7. Epub 2009 Jun 30.
105.	Induction of heme oxygenase-1 expression inhibits platelet-dependent thrombosis.	Peng L, etal., Antioxid Redox Signal. 2004 Aug;6(4):729-35.
106.	Heme Oxygenase-1 Mediates the Protective Effects of Ischemic Preconditioning on Mitigating Lung Injury Induced by Lower Limb Ischemia-Reperfusion in Rats.	Peng TC, etal., J Surg Res. 2010 Jun 30.
107.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
108.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
109.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
110.	Development of inhibitory antibodies to therapeutic factor VIII in severe hemophilia A is associated with microsatellite polymorphisms in the HMOX1 promoter.	Repesse Y, etal., Haematologica. 2013 Oct;98(10):1650-5. doi: 10.3324/haematol.2013.084665. Epub 2013 May 28.
111.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
112.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
113.	RGD HPO Phenotype Annotation Pipeline	RGD automated import pipeline for human HPO-to-gene-to-disease annotations
114.	Chronic tempol treatment attenuates the renal hemodynamic effects induced by a heme oxygenase inhibitor in streptozotocin diabetic rats.	Rodriguez F, etal., Am J Physiol Regul Integr Comp Physiol. 2011 Nov;301(5):R1540-8. doi: 10.1152/ajpregu.00847.2010. Epub 2011 Aug 17.
115.	Heme oxygenase-1, a potential biomarker of chronic silicosis, attenuates silica-induced lung injury.	Sato T, etal., Am J Respir Crit Care Med. 2006 Oct 15;174(8):906-14. Epub 2006 Jul 20.
116.	Heme oxygenase-1 gene promoter polymorphism is associated with abdominal aortic aneurysm.	Schillinger M, etal., Thromb Res. 2002 Apr 15;106(2):131-6.
117.	Expression of heme oxygenase-1 in the senescent and Alzheimer-diseased brain.	Schipper HM, etal., Ann Neurol 1995 Jun;37(6):758-68.
118.	Time course of Keap1-Nrf2 pathway expression after experimental intracerebral haemorrhage: correlation with brain oedema and neurological deficit.	Shang H, etal., Free Radic Res. 2013 May;47(5):368-75. doi: 10.3109/10715762.2013.778403. Epub 2013 Mar 21.
119.	Heme oxygenase-1 microsatellite polymorphism and haplotypes are associated with the development of acute respiratory distress syndrome.	Sheu CC, etal., Intensive Care Med. 2009 Aug;35(8):1343-51. Epub 2009 Jun 13.
120.	Synergistic induction of heme oxygenase-1 by nicaraven after subarachnoid hemorrhage to prevent delayed cerebral vasospasm.	Shimada Y, etal., Eur J Pharmacol. 2009 Oct 12;620(1-3):16-20. Epub 2009 Aug 15.
121.	Increased expression of Leydig cell haem oxygenase-1 preserves spermatogenesis in varicocele.	Shiraishi K and Naito K, Hum Reprod. 2005 Sep;20(9):2608-13. Epub 2005 May 5.
122.	Hypoxic preconditioning with cobalt ameliorates hypobaric hypoxia induced pulmonary edema in rat.	Shukla D, etal., Eur J Pharmacol. 2011 Apr 10;656(1-3):101-9. doi: 10.1016/j.ejphar.2011.01.038. Epub 2011 Feb 4.
123.	VEGF-induced heme oxygenase-1 confers cytoprotection from lethal hyperoxia in vivo.	Siner JM, etal., FASEB J. 2007 May;21(7):1422-32. Epub 2007 Jan 30.
124.	Inhibition of the NADPH oxidase regulates heme oxygenase 1 expression in chronic myeloid leukemia.	Singh MM, etal., Cancer. 2012 Jul 1;118(13):3433-45. doi: 10.1002/cncr.26621. Epub 2011 Dec 2.
125.	Induction of pro- and anti-inflammatory molecules in a mouse model of pneumococcal pneumonia after influenza.	Smith MW, etal., Comp Med. 2007 Feb;57(1):82-9.
126.	Zinc protoporphyrin aggravates cerebral ischemic injury following experimental subarachnoid hemorrhage.	Sun BL, etal., Clin Hemorheol Microcirc. 2006;34(1-2):241-6.
127.	Retinal protection from acute glaucoma-induced ischemia-reperfusion injury through pharmacologic induction of heme oxygenase-1.	Sun MH, etal., Invest Ophthalmol Vis Sci. 2010 Sep;51(9):4798-808. Epub 2010 Mar 31.
128.	Intracranial heme metabolism and cerebral vasospasm after aneurysmal subarachnoid hemorrhage.	Suzuki H, etal., Stroke. 2003 Dec;34(12):2796-800. Epub 2003 Dec 1.
129.	Facilitated angiogenesis induced by heme oxygenase-1 gene transfer in a rat model of hindlimb ischemia.	Suzuki M, etal., Biochem Biophys Res Commun. 2003 Feb 28;302(1):138-43.
130.	Right ventricle of patients undergoing congenital cardiac surgery differentially expresses haem oxygenase-1 and heat shock protein 70 genes.	Takeuchi M, etal., J Int Med Res. 2003 Sep-Oct;31(5):413-7.
131.	Induction of hepatic Bach1 mRNA expression by carbon tetrachloride-induced acute liver injury in rats.	Tanioka N, etal., Biomed Rep. 2014 May;2(3):359-363. Epub 2014 Feb 7.
132.	Antioxidant effects of diallyl trisulfide on high glucose-induced apoptosis are mediated by the PI3K/Akt-dependent activation of Nrf2 in cardiomyocytes.	Tsai CY, etal., Int J Cardiol. 2013 Sep 30;168(2):1286-97. doi: 10.1016/j.ijcard.2012.12.004. Epub 2013 Feb 27.
133.	Postconditioning with far-infrared irradiation increases heme oxygenase-1 expression and protects against ischemia/reperfusion injury in rat testis.	Tu YP, etal., Life Sci. 2013 Jan 17;92(1):35-41. doi: 10.1016/j.lfs.2012.10.019. Epub 2012 Nov 7.
134.	Role of melatonin and luzindole in rat mammary cancer.	Umit UM, etal., J Invest Surg. 2012 Dec;25(6):345-53. doi: 10.3109/08941939.2012.665570.
135.	Brain death induces renal expression of heme oxygenase-1 and heat shock protein 70.	van Dullemen LF, etal., J Transl Med. 2013 Jan 29;11:22. doi: 10.1186/1479-5876-11-22.
136.	Graft protective effects of heme oxygenase 1 in mouse tracheal transplant-related obliterative bronchiolitis.	Visner GA, etal., Transplantation. 2003 Aug 27;76(4):650-6.
137.	Influence of heme oxygenase-1 expression on immune liver fibrosis induced by cobalt protoporphyrin in rats.	Wang F, etal., World J Gastroenterol. 2009 Jun 28;15(24):3009-14.
138.	[Astragalus polysaccharides improved the cardiac function in Sjogren's syndrome model rats based on keap 1-Nrf2/ARE signaling pathway: a mechanism exploration].	Wang F, etal., Zhongguo Zhong Xi Yi Jie He Za Zhi. 2014 May;34(5):566-74.
139.	Paradoxical protection from atherosclerosis and thrombosis in a mouse model of sickle cell disease.	Wang H, etal., Br J Haematol. 2013 Jul;162(1):120-9. doi: 10.1111/bjh.12342. Epub 2013 Apr 17.
140.	Role of the heme oxygenase/carbon monoxide pathway in the pathogenesis and prevention of hepatic encephalopathy.	Wang QM, etal., Mol Med Rep. 2013 Jul;8(1):67-74. doi: 10.3892/mmr.2013.1472. Epub 2013 May 13.
141.	Targeted suppression of heme oxygenase-1 by small interference RNAs inhibits the production of bilirubin in neonatal rat with hyperbilirubinemia.	Wu J, etal., BMC Mol Biol. 2009 Aug 1;10:77.
142.	Ischemic postconditioning attenuates lung reperfusion injury and reduces systemic proinflammatory cytokine release via heme oxygenase 1.	Xu B, etal., J Surg Res. 2011 Apr;166(2):e157-64. doi: 10.1016/j.jss.2010.11.902. Epub 2010 Dec 21.
143.	Antioxidant N-acetylcysteine attenuates the reduction of Brg1 protein expression in the myocardium of type 1 diabetic rats.	Xu J, etal., J Diabetes Res. 2013;2013:716219. doi: 10.1155/2013/716219. Epub 2013 Jun 18.
144.	Microsatellite polymorphism in the heme oxygenase-1 gene promoter is associated with susceptibility to emphysema.	Yamada N, etal., Am J Hum Genet. 2000 Jan;66(1):187-95.
145.	Association of susceptibility to the development of pneumonia in the older Japanese population with haem oxygenase-1 gene promoter polymorphism.	Yasuda H, etal., J Med Genet. 2006 Apr;43(4):e17.
146.	Absence of heme oxygenase-1 exacerbates atherosclerotic lesion formation and vascular remodeling.	Yet SF, etal., FASEB J. 2003 Sep;17(12):1759-61. Epub 2003 Jul 3.
147.	Heme oxygenase-1 upregulation improves lipopolysaccharide-induced acute lung injury involving suppression of macrophage migration inhibitory factor.	Yin H, etal., Mol Immunol. 2010 Sep;47(15):2443-9. Epub 2010 Jul 16.
148.	Prevention by lansoprazole, a proton pump inhibitor, of indomethacin -induced small intestinal ulceration in rats through induction of heme oxygenase-1.	Yoda Y, etal., J Physiol Pharmacol. 2010 Jun;61(3):287-94.
149.	Protective effects of hemin pretreatment combined with ulinastatin on septic shock in rats.	Yu JB and Yao SL, Chin Med J (Engl). 2008 Jan 5;121(1):49-55.
150.	BTZO-15, an ARE-activator, ameliorates DSS- and TNBS-induced colitis in rats.	Yukitake H, etal., PLoS One. 2011;6(8):e23256. doi: 10.1371/journal.pone.0023256. Epub 2011 Aug 10.
151.	Protective role of heme oxygenase-1 against liver damage caused by hepatic ischemia and reperfusion in rats.	Yun N, etal., Antioxid Redox Signal. 2010 Nov 15;13(10):1503-12. doi: 10.1089/ars.2009.2873.
152.	Over-expression of HO-1 on mesenchymal stem cells promotes angiogenesis and improves myocardial function in infarcted myocardium.	Zeng B, etal., J Biomed Sci. 2010 Oct 7;17:80.
153.	Bicyclol upregulates transcription factor Nrf2, HO-1 expression and protects rat brains against focal ischemia.	Zhang J, etal., Brain Res Bull. 2014 Jan;100:38-43. doi: 10.1016/j.brainresbull.2013.11.001. Epub 2013 Nov 16.
154.	Amelioration of radiation-induced skin injury by adenovirus-mediated heme oxygenase-1 (HO-1) overexpression in rats.	Zhang S, etal., Radiat Oncol. 2012 Jan 17;7:4. doi: 10.1186/1748-717X-7-4.
155.	[A study of the role of heme oxygenase-1 expression in ventilator induced lung injury and its mechanism in rats.]	Zhao WJ and Hu WW, Zhongguo Wei Zhong Bing Ji Jiu Yi Xue. 2010 Jul;22(7):410-3.
156.	Protective effect of dioscin against thioacetamide-induced acute liver injury via FXR/AMPK signaling pathway in vivo.	Zheng L, etal., Biomed Pharmacother. 2018 Jan;97:481-488. doi: 10.1016/j.biopha.2017.10.153. Epub 2017 Nov 6.
157.	Heme oxygenase-1 expression in human lungs with cystic fibrosis and cytoprotective effects against Pseudomonas aeruginosa in vitro.	Zhou H, etal., Am J Respir Crit Care Med. 2004 Sep 15;170(6):633-40. Epub 2004 Jun 7.

Additional References at PubMed

PMID:2537723	PMID:2911585	PMID:3345742	PMID:7703255	PMID:8034330	PMID:8146161	PMID:8650873	PMID:9884342	PMID:9890653	PMID:10082382	PMID:10467099	PMID:10591208
PMID:10952020	PMID:11121422	PMID:11385506	PMID:11718398	PMID:11786534	PMID:11820797	PMID:11829463	PMID:11849436	PMID:11986386	PMID:12086318	PMID:12091240	PMID:12099373
PMID:12117910	PMID:12118938	PMID:12130498	PMID:12133007	PMID:12151344	PMID:12153964	PMID:12202863	PMID:12207883	PMID:12222997	PMID:12239590	PMID:12376298	PMID:12376363
PMID:12376366	PMID:12379283	PMID:12396617	PMID:12397597	PMID:12431619	PMID:12433915	PMID:12469218	PMID:12477932	PMID:12480749	PMID:12493432	PMID:12500973	PMID:12511571
PMID:12566526	PMID:12579334	PMID:12585963	PMID:12626517	PMID:12649161	PMID:12679469	PMID:12690112	PMID:12709566	PMID:12709568	PMID:12709569	PMID:12709590	PMID:12709592
PMID:12716475	PMID:12730098	PMID:12736395	PMID:12761501	PMID:12777398	PMID:12783778	PMID:12805077	PMID:12810075	PMID:12832044	PMID:12842469	PMID:12865654	PMID:12891549
PMID:12909459	PMID:12927812	PMID:12927819	PMID:12933701	PMID:12947311	PMID:12969148	PMID:13678532	PMID:14523007	PMID:14525760	PMID:14615405	PMID:14635185	PMID:14647439
PMID:14660632	PMID:14683741	PMID:14715242	PMID:14726403	PMID:14733911	PMID:14981149	PMID:14988408	PMID:14992466	PMID:15004156	PMID:15024026	PMID:15028349	PMID:15049686
PMID:15084931	PMID:15140586	PMID:15161530	PMID:15166181	PMID:15233805	PMID:15284058	PMID:15285018	PMID:15297453	PMID:15316927	PMID:15319861	PMID:15336443	PMID:15337692
PMID:15342556	PMID:15365571	PMID:15451051	PMID:15461802	PMID:15465821	PMID:15470195	PMID:15474356	PMID:15516695	PMID:15519649	PMID:15522396	PMID:15525643	PMID:15544924
PMID:15547665	PMID:15581622	PMID:15611319	PMID:15618017	PMID:15629867	PMID:15652505	PMID:15661856	PMID:15690204	PMID:15741166	PMID:15763346	PMID:15797262	PMID:15797755
PMID:15805230	PMID:15817713	PMID:15833736	PMID:15834587	PMID:15849554	PMID:15875813	PMID:15885363	PMID:15897578	PMID:15899048	PMID:15964514	PMID:16117883	PMID:16123320
PMID:16154535	PMID:16181102	PMID:16189191	PMID:16210136	PMID:16232329	PMID:16234431	PMID:16249618	PMID:16271489	PMID:16309585	PMID:16309586	PMID:16309588	PMID:16313248
PMID:16319139	PMID:16374439	PMID:16387424	PMID:16399210	PMID:16455537	PMID:16462769	PMID:16474202	PMID:16485041	PMID:16495813	PMID:16530877	PMID:16545694	PMID:16596642
PMID:16609364	PMID:16620829	PMID:16697692	PMID:16712795	PMID:16724942	PMID:16771696	PMID:16772700	PMID:16783602	PMID:16804400	PMID:16840713	PMID:16849502	PMID:16882737
PMID:16887359	PMID:16923960	PMID:16945925	PMID:16950787	PMID:16951197	PMID:16971418	PMID:16999951	PMID:17003650	PMID:17018578	PMID:17018862	PMID:17020887	PMID:17064313
PMID:17065227	PMID:17081983	PMID:17095719	PMID:17204476	PMID:17211576	PMID:17216339	PMID:17219054	PMID:17229906	PMID:17244614	PMID:17277740	PMID:17295091	PMID:17389623
PMID:17391133	PMID:17400606	PMID:17413033	PMID:17452746	PMID:17467999	PMID:17511591	PMID:17520317	PMID:17526019	PMID:17526500	PMID:17531161	PMID:17541213	PMID:17558910
PMID:17567933	PMID:17600318	PMID:17601350	PMID:17603281	PMID:17620093	PMID:17652371	PMID:17657593	PMID:17667816	PMID:17721824	PMID:17726138	PMID:17823375	PMID:17853070
PMID:17873285	PMID:17883332	PMID:17886034	PMID:17896171	PMID:17915953	PMID:17919491	PMID:17919492	PMID:17927807	PMID:17953374	PMID:17964723	PMID:17971338	PMID:18007994
PMID:18042465	PMID:18045827	PMID:18048809	PMID:18050210	PMID:18077487	PMID:18093274	PMID:18174022	PMID:18195184	PMID:18200441	PMID:18201862	PMID:18202225	PMID:18205746
PMID:18216050	PMID:18261117	PMID:18272347	PMID:18274635	PMID:18275848	PMID:18289072	PMID:18307065	PMID:18312299	PMID:18332044	PMID:18344023	PMID:18381758	PMID:18390757
PMID:18404535	PMID:18443197	PMID:18459998	PMID:18460015	PMID:18461097	PMID:18483307	PMID:18502573	PMID:18508827	PMID:18515325	PMID:18524839	PMID:18544348	PMID:18550526
PMID:18560362	PMID:18566988	PMID:18576916	PMID:18582925	PMID:18586007	PMID:18587252	PMID:18596041	PMID:18597895	PMID:18620357	PMID:18640487	PMID:18651163	PMID:18665050
PMID:18689604	PMID:18692581	PMID:18757839	PMID:18769149	PMID:18774956	PMID:18786476	PMID:18787101	PMID:18799519	PMID:18804049	PMID:18811919	PMID:18841019	PMID:18845641
PMID:18923065	PMID:18930811	PMID:18957281	PMID:18975324	PMID:18977241	PMID:18981090	PMID:18983509	PMID:19056482	PMID:19120903	PMID:19122175	PMID:19129475	PMID:19133325
PMID:19165391	PMID:19194559	PMID:19236506	PMID:19238116	PMID:19243019	PMID:19243105	PMID:19246912	PMID:19250338	PMID:19255063	PMID:19255829	PMID:19282863	PMID:19289500
PMID:19303319	PMID:19322201	PMID:19325051	PMID:19336475	PMID:19360326	PMID:19371606	PMID:19389234	PMID:19399816	PMID:19422386	PMID:19428335	PMID:19445907	PMID:19457084
PMID:19457866	PMID:19475336	PMID:19484149	PMID:19487598	PMID:19508729	PMID:19522732	PMID:19526463	PMID:19536150	PMID:19548360	PMID:19556236	PMID:19578796	PMID:19586801
PMID:19587144	PMID:19590927	PMID:19604147	PMID:19625608	PMID:19669099	PMID:19676145	PMID:19696228	PMID:19777608	PMID:19785642	PMID:19797297	PMID:19808663	PMID:19808972
PMID:19822148	PMID:19850937	PMID:19853072	PMID:19874887	PMID:19879747	PMID:19884647	PMID:19886851	PMID:19895178	PMID:19903700	PMID:19903769	PMID:19910578	PMID:19913121
PMID:19924377	PMID:19925812	PMID:19965783	PMID:20020468	PMID:20021945	PMID:20039940	PMID:20049130	PMID:20064636	PMID:20110814	PMID:20121710	PMID:20127796	PMID:20155807
PMID:20170613	PMID:20175935	PMID:20188821	PMID:20190330	PMID:20193368	PMID:20194081	PMID:20223113	PMID:20229611	PMID:20232486	PMID:20299368	PMID:20345481	PMID:20345975
PMID:20346360	PMID:20351094	PMID:20386498	PMID:20395442	PMID:20404253	PMID:20416077	PMID:20430037	PMID:20446774	PMID:20482362	PMID:20485444	PMID:20504881	PMID:20508205
PMID:20509889	PMID:20518850	PMID:20580464	PMID:20585394	PMID:20587610	PMID:20597111	PMID:20599261	PMID:20628086	PMID:20633528	PMID:20667089	PMID:20682519	PMID:20689807
PMID:20705711	PMID:20706680	PMID:20708634	PMID:20733275	PMID:20796278	PMID:20811623	PMID:20832528	PMID:20838751	PMID:20846452	PMID:20868356	PMID:20869265	PMID:20934533
PMID:20938987	PMID:21037234	PMID:21044950	PMID:21079975	PMID:21080099	PMID:21081499	PMID:21091076	PMID:21102410	PMID:21113640	PMID:21136273	PMID:21144518	PMID:21148661
PMID:21157922	PMID:21172416	PMID:21174817	PMID:21191307	PMID:21198350	PMID:21206978	PMID:21211285	PMID:21216973	PMID:21233593	PMID:21236443	PMID:21275653	PMID:21296438
PMID:21307400	PMID:21321939	PMID:21354100	PMID:21366594	PMID:21389316	PMID:21412259	PMID:21425334	PMID:21426408	PMID:21454555	PMID:21495030	PMID:21497776	PMID:21502755
PMID:21506927	PMID:21516116	PMID:21518986	PMID:21525764	PMID:21531452	PMID:21545264	PMID:21552291	PMID:21555518	PMID:21556890	PMID:21576421	PMID:21597468	PMID:21598088
PMID:21620964	PMID:21646819	PMID:21647550	PMID:21725851	PMID:21729576	PMID:21737788	PMID:21741353	PMID:21742584	PMID:21756955	PMID:21765894	PMID:21781496	PMID:21788589
PMID:21808062	PMID:21827279	PMID:21833623	PMID:21861350	PMID:21868703	PMID:21873635	PMID:21889036	PMID:21898994	PMID:21902835	PMID:21911884	PMID:21911919	PMID:21945498
PMID:21982894	PMID:21987660	PMID:21988832	PMID:21992109	PMID:22048453	PMID:22078849	PMID:22088544	PMID:22095074	PMID:22099756	PMID:22119785	PMID:22123460	PMID:22137262
PMID:22138245	PMID:22142473	PMID:22147556	PMID:22155307	PMID:22158875	PMID:22200625	PMID:22203790	PMID:22212955	PMID:22264017	PMID:22271370	PMID:22276118	PMID:22290142
PMID:22302482	PMID:22323644	PMID:22330859	PMID:22338608	PMID:22418244	PMID:22419571	PMID:22427825	PMID:22438807	PMID:22461696	PMID:22490514	PMID:22503972	PMID:22541814
PMID:22542718	PMID:22545110	PMID:22549002	PMID:22559824	PMID:22573121	PMID:22578468	PMID:22578957	PMID:22579918	PMID:22580187	PMID:22583702	PMID:22587389	PMID:22594519
PMID:22609818	PMID:22613607	PMID:22630328	PMID:22666428	PMID:22670665	PMID:22682876	PMID:22689053	PMID:22698995	PMID:22750196	PMID:22776971	PMID:22842631	PMID:22843690
PMID:22849380	PMID:22875919	PMID:22879597	PMID:22881289	PMID:22901690	PMID:22939811	PMID:22945906	PMID:22959128	PMID:22989377	PMID:23010497	PMID:23046979	PMID:23051580
PMID:23052192	PMID:23055342	PMID:23074199	PMID:23087099	PMID:23090292	PMID:23092328	PMID:23097500	PMID:23103292	PMID:23114386	PMID:23123430	PMID:23139759	PMID:23150184
PMID:23158494	PMID:23221079	PMID:23226098	PMID:23238643	PMID:23251661	PMID:23255485	PMID:23288142	PMID:23293173	PMID:23324179	PMID:23345623	PMID:23347118	PMID:23392716
PMID:23403148	PMID:23403272	PMID:23406266	PMID:23406650	PMID:23412940	PMID:23423194	PMID:23430116	PMID:23437133	PMID:23454680	PMID:23521418	PMID:23526997	PMID:23536693
PMID:23567851	PMID:23569422	PMID:23571756	PMID:23580430	PMID:23583371	PMID:23602216	PMID:23606537	PMID:23615401	PMID:23617628	PMID:23660665	PMID:23665328	PMID:23671274
PMID:23714423	PMID:23720344	PMID:23725037	PMID:23728734	PMID:23737527	PMID:23739547	PMID:23792437	PMID:23813560	PMID:23840483	PMID:23877636	PMID:23893806	PMID:23919806
PMID:23925400	PMID:23939757	PMID:23981612	PMID:24038461	PMID:24053646	PMID:24053682	PMID:24075775	PMID:24098580	PMID:24109237	PMID:24117426	PMID:24131232	PMID:24140555
PMID:24147608	PMID:24180257	PMID:24180287	PMID:24180608	PMID:24180625	PMID:24200599	PMID:24201221	PMID:24211270	PMID:24226420	PMID:24234335	PMID:24239896	PMID:24300974
PMID:24320035	PMID:24366007	PMID:24413553	PMID:24440642	PMID:24456890	PMID:24485305	PMID:24497084	PMID:24500083	PMID:24512908	PMID:24553299	PMID:24568186	PMID:24585089
PMID:24607880	PMID:24612419	PMID:24613679	PMID:24616552	PMID:24623722	PMID:24636201	PMID:24655000	PMID:24670375	PMID:24690955	PMID:24694788	PMID:24733848	PMID:24752012
PMID:24762402	PMID:24786516	PMID:24799610	PMID:24801208	PMID:24813593	PMID:24819505	PMID:24844779	PMID:24931165	PMID:24957789	PMID:24969894	PMID:24995976	PMID:25016572
PMID:25023856	PMID:25036905	PMID:25063314	PMID:25064159	PMID:25069505	PMID:25109682	PMID:25110805	PMID:25122478	PMID:25150395	PMID:25162226	PMID:25187885	PMID:25196646
PMID:25199502	PMID:25201427	PMID:25202977	PMID:25207998	PMID:25218961	PMID:25231232	PMID:25236576	PMID:25239913	PMID:25241054	PMID:25262300	PMID:25262966	PMID:25268359
PMID:25277974	PMID:25280089	PMID:25359861	PMID:25377948	PMID:25404134	PMID:25416956	PMID:25428780	PMID:25431258	PMID:25447985	PMID:25450361	PMID:25475440	PMID:25486479
PMID:25501830	PMID:25530680	PMID:25574604	PMID:25582460	PMID:25585641	PMID:25608140	PMID:25612606	PMID:25615876	PMID:25620054	PMID:25625535	PMID:25638774	PMID:25645920
PMID:25652861	PMID:25656973	PMID:25661467	PMID:25677507	PMID:25751573	PMID:25772769	PMID:25776458	PMID:25802333	PMID:25820186	PMID:25822459	PMID:25828744	PMID:25835554
PMID:25864768	PMID:25883219	PMID:25888733	PMID:25891083	PMID:25921464	PMID:25933176	PMID:25956277	PMID:25961023	PMID:25962859	PMID:26011640	PMID:26011642	PMID:26041409
PMID:26087182	PMID:26091465	PMID:26125799	PMID:26142705	PMID:26143632	PMID:26173399	PMID:26186194	PMID:26186946	PMID:26218201	PMID:26227317	PMID:26238954	PMID:26244607
PMID:26269184	PMID:26270345	PMID:26277392	PMID:26283888	PMID:26291278	PMID:26303499	PMID:26313808	PMID:26315932	PMID:26337933	PMID:26350099	PMID:26385185	PMID:26385579
PMID:26398855	PMID:26404762	PMID:26405158	PMID:26416069	PMID:26418896	PMID:26445536	PMID:26456668	PMID:26483091	PMID:26507778	PMID:26512585	PMID:26534961	PMID:26555743
PMID:26566708	PMID:26576971	PMID:26595750	PMID:26600472	PMID:26652036	PMID:26672618	PMID:26680374	PMID:26690352	PMID:26697129	PMID:26698667	PMID:26700310	PMID:26725491
PMID:26726846	PMID:26733347	PMID:26758041	PMID:26777482	PMID:26780849	PMID:26782424	PMID:26801320	PMID:26822586	PMID:26824276	PMID:26859574	PMID:26866925	PMID:26868429
PMID:26877238	PMID:26895301	PMID:26898422	PMID:26916598	PMID:26938875	PMID:26966892	PMID:26968795	PMID:27023064	PMID:27058954	PMID:27117941	PMID:27122182	PMID:27183573
PMID:27184847	PMID:27185859	PMID:27211510	PMID:27257045	PMID:27274779	PMID:27280718	PMID:27313828	PMID:27322610	PMID:27323160	PMID:27354342	PMID:27400252	PMID:27412411
PMID:27473828	PMID:27488535	PMID:27490825	PMID:27553177	PMID:27571925	PMID:27572090	PMID:27606430	PMID:27620489	PMID:27626166	PMID:27639646	PMID:27678042	PMID:27694475
PMID:27752990	PMID:27764834	PMID:27821168	PMID:27821584	PMID:27821769	PMID:27825138	PMID:27829220	PMID:27840932	PMID:27867098	PMID:27922667	PMID:27943244	PMID:27993883
PMID:27997582	PMID:27998018	PMID:27999449	PMID:28032857	PMID:28060008	PMID:28098837	PMID:28186648	PMID:28206992	PMID:28243792	PMID:28245071	PMID:28257713	PMID:28276576
PMID:28298427	PMID:28300285	PMID:28323022	PMID:28347842	PMID:28423042	PMID:28444966	PMID:28445830	PMID:28503569	PMID:28512172	PMID:28514442	PMID:28555162	PMID:28580587
PMID:28588027	PMID:28600848	PMID:28604588	PMID:28612103	PMID:28627599	PMID:28655775	PMID:28679437	PMID:28684418	PMID:28713890	PMID:28749936	PMID:28770550	PMID:28790431
PMID:28806787	PMID:28808929	PMID:28842295	PMID:28846111	PMID:28951772	PMID:29048628	PMID:29125538	PMID:29155886	PMID:29161307	PMID:29180619	PMID:29203625	PMID:29274359
PMID:29302043	PMID:29311669	PMID:29343136	PMID:29425821	PMID:29437594	PMID:29454088	PMID:29470442	PMID:29484761	PMID:29510721	PMID:29537718	PMID:29617687	PMID:29620188
PMID:29660345	PMID:29693114	PMID:29772541	PMID:29791903	PMID:29877949	PMID:29886060	PMID:29974998	PMID:30024897	PMID:30071692	PMID:30105448	PMID:30139825	PMID:30159103
PMID:30171344	PMID:30194290	PMID:30216645	PMID:30238818	PMID:30258436	PMID:30282830	PMID:30296742	PMID:30341816	PMID:30354985	PMID:30363976	PMID:30400002	PMID:30428359
PMID:30476559	PMID:30484334	PMID:30508596	PMID:30515391	PMID:30527623	PMID:30546363	PMID:30553057	PMID:30567635	PMID:30577437	PMID:30591458	PMID:30606233	PMID:30621167
PMID:30634993	PMID:30662338	PMID:30706605	PMID:30736789	PMID:30764900	PMID:30776144	PMID:30813528	PMID:30835584	PMID:30851935	PMID:30881359	PMID:30944174	PMID:30978117
PMID:31013932	PMID:31030250	PMID:31037501	PMID:31057560	PMID:31115551	PMID:31120979	PMID:31176653	PMID:31180611	PMID:31199053	PMID:31210657	PMID:31251786	PMID:31264739
PMID:31279900	PMID:31288720	PMID:31299184	PMID:31376303	PMID:31411335	PMID:31521246	PMID:31541463	PMID:31564855	PMID:31607476	PMID:31634788	PMID:31679277	PMID:31711520
PMID:31718385	PMID:31727545	PMID:31770847	PMID:31847534	PMID:31870428	PMID:31916865	PMID:31921135	PMID:31957703	PMID:31963199	PMID:31964423	PMID:32015215	PMID:32028540
PMID:32042051	PMID:32084514	PMID:32108290	PMID:32121588	PMID:32141648	PMID:32197509	PMID:32240302	PMID:32277015	PMID:32278282	PMID:32296183	PMID:32353859	PMID:32423001
PMID:32500379	PMID:32558263	PMID:32559798	PMID:32581238	PMID:32615411	PMID:32640729	PMID:32663573	PMID:32687490	PMID:32770964	PMID:32819605	PMID:32838362	PMID:32880973
PMID:32897647	PMID:32910432	PMID:32930133	PMID:32971746	PMID:33001278	PMID:33016915	PMID:33023074	PMID:33060197	PMID:33075721	PMID:33076330	PMID:33080218	PMID:33110194
PMID:33116199	PMID:33144569	PMID:33176981	PMID:33232319	PMID:33306668	PMID:33378016	PMID:33383653	PMID:33388910	PMID:33394027	PMID:33396647	PMID:33410147	PMID:33430731
PMID:33467682	PMID:33498175	PMID:33537027	PMID:33537805	PMID:33546372	PMID:33588423	PMID:33589574	PMID:33646477	PMID:33670516	PMID:33738869	PMID:33800989	PMID:33903766
PMID:33961781	PMID:33961973	PMID:33962830	PMID:34117611	PMID:34202670	PMID:34202711	PMID:34205698	PMID:34237527	PMID:34240732	PMID:34264023	PMID:34312365	PMID:34321570
PMID:34365685	PMID:34443628	PMID:34493626	PMID:34544203	PMID:34547407	PMID:34634993	PMID:34638586	PMID:34672954	PMID:34688156	PMID:34732716	PMID:34750390	PMID:34841438
PMID:34918393	PMID:34918880	PMID:34920080	PMID:34999313	PMID:35006443	PMID:35239449	PMID:35271311	PMID:35281042	PMID:35293311	PMID:35304903	PMID:35428017	PMID:35470713
PMID:35551540	PMID:35696571	PMID:35762119	PMID:35821281	PMID:36001619	PMID:36054818	PMID:36217030	PMID:36265795	PMID:36291740	PMID:36300537	PMID:36436727	PMID:36464717
PMID:36539019	PMID:36610398	PMID:36705254	PMID:36775962	PMID:36892766	PMID:36949045	PMID:37043130	PMID:37046065	PMID:37210762	PMID:37219322	PMID:37245063	PMID:37286868
PMID:37415103	PMID:37445792	PMID:37486100	PMID:37532969	PMID:37592866	PMID:37685970	PMID:37800319	PMID:37890696	PMID:37897855	PMID:37984695	PMID:38006802	PMID:38051262
PMID:38069389	PMID:38129860	PMID:38147696	PMID:38154209	PMID:38172743	PMID:38244583	PMID:38279097	PMID:38410927	PMID:38468410	PMID:38584112

Genomics

Comparative Map Data

HMOX1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	22	35,381,096 - 35,394,207 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	22	35,380,361 - 35,394,214 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	22	35,777,089 - 35,790,200 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	22	34,107,087 - 34,120,194 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	22	34,101,640 - 34,114,748	NCBI
Celera	22	19,579,740 - 19,592,881 (+)	NCBI		Celera
Cytogenetic Map	22	q12.3	NCBI
HuRef	22	18,737,577 - 18,750,716 (+)	NCBI		HuRef
CHM1_1	22	35,735,791 - 35,748,937 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	22	35,839,114 - 35,852,226 (+)	NCBI		T2T-CHM13v2.0

Hmox1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	75,820,246 - 75,827,221 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	75,820,249 - 75,827,217 (+)	Ensembl		GRCm39 Ensembl
GRCm38	8	75,093,618 - 75,100,593 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	75,093,621 - 75,100,589 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	8	77,617,517 - 77,624,492 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	8	77,989,694 - 77,996,657 (+)	NCBI		MGSCv36	mm8
Celera	8	79,400,848 - 79,407,824 (+)	NCBI		Celera
Cytogenetic Map	8	C1	NCBI
cM Map	8	35.59	NCBI

Hmox1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	13,452,365 - 13,479,823 (+)	NCBI		GRCr8
mRatBN7.2	19	13,466,287 - 13,474,082 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	13,467,244 - 13,474,079 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	19	13,440,832 - 13,447,675 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	14,206,098 - 14,212,941 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	13,487,026 - 13,493,858 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	14,508,634 - 14,515,455 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	14,508,616 - 14,515,456 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	19	25,622,556 - 25,629,377 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	19	13,963,139 - 13,969,960 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	19	13,967,964 - 13,974,784 (+)	NCBI
Celera	19	13,334,259 - 13,341,080 (+)	NCBI		Celera
Cytogenetic Map	19	p11	NCBI

Hmox1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955405	43,124,510 - 43,130,979 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955405	43,124,447 - 43,128,873 (+)	NCBI	ChiLan1.0	ChiLan1.0

HMOX1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	23	45,322,157 - 45,335,267 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	22	48,018,985 - 48,034,597 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	22	16,388,368 - 16,401,289 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	22	34,230,825 - 34,244,063 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	22	34,230,825 - 34,244,063 (+)	Ensembl	panpan1.1		panPan2

HMOX1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	10	28,744,404 - 28,751,544 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	10	28,743,795 - 28,751,773 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	10	28,683,213 - 28,689,972 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	10	29,531,402 - 29,538,230 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	10	29,530,793 - 29,539,227 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	10	29,255,139 - 29,261,959 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	10	29,565,774 - 29,572,612 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	10	29,745,379 - 29,752,300 (-)	NCBI		UU_Cfam_GSD_1.0

Hmox1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	12,031,937 - 12,038,780 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936492	5,042,330 - 5,049,311 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936492	5,042,353 - 5,049,216 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

HMOX1
(Sus scrofa - pig)

No map positions available.

HMOX1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	19	18,144,466 - 18,157,944 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	19	18,144,545 - 18,157,971 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666045	107,791,541 - 107,805,610 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Hmox1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624750	342,146 - 345,887 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624750	341,699 - 346,005 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in HMOX1
254 total Variants

Clinical Variants

Name	Type	Condition(s)	Position(s)	Clinical significance
NM_002133.3(HMOX1):c.24_144del	deletion	Heme oxygenase 1 deficiency [RCV000017241]	Chr22:22q12	pathogenic
NM_002133.3(HMOX1):c.324_325del (p.Pro109fs)	microsatellite	Heme oxygenase 1 deficiency [RCV000017242]	Chr22:35386860..35386861 [GRCh38] Chr22:35782853..35782854 [GRCh37] Chr22:22q12.3	pathogenic
NG_023030.1:g.4769GT[30_?]	microsatellite	Pulmonary disease, chronic obstructive, susceptibility to [RCV000017243]	Chr22:22q12	risk factor
GRCh38/hg38 22q12.3-13.1(chr22:35333993-38900177)x1	copy number loss	See cases [RCV000051364]	Chr22:35333993..38900177 [GRCh38] Chr22:35729986..39296182 [GRCh37] Chr22:34059986..37626128 [NCBI36] Chr22:22q12.3-13.1	pathogenic
GRCh38/hg38 22q12.3-13.33(chr22:33768441-50739977)x3	copy number gain	See cases [RCV000051682]	Chr22:33768441..50739977 [GRCh38] Chr22:34164428..51178405 [GRCh37] Chr22:32494428..49525271 [NCBI36] Chr22:22q12.3-13.33	pathogenic
NM_002133.2(HMOX1):c.534C>T (p.Phe178=)	single nucleotide variant	Malignant melanoma [RCV000072954]	Chr22:35387074 [GRCh38] Chr22:35783067 [GRCh37] Chr22:34113067 [NCBI36] Chr22:22q12.3	not provided
GRCh38/hg38 22q11.1-13.33(chr22:16916608-50739836)x3	copy number gain	See cases [RCV000133646]	Chr22:16916608..50739836 [GRCh38] Chr22:17397498..51178264 [GRCh37] Chr22:15777498..49525130 [NCBI36] Chr22:22q11.1-13.33	pathogenic
NM_002133.3(HMOX1):c.784C>T (p.Arg262Cys)	single nucleotide variant	not provided [RCV001348789]	Chr22:35393515 [GRCh38] Chr22:35789508 [GRCh37] Chr22:22q12.3	likely benign\|uncertain significance
GRCh38/hg38 22q11.1-13.33(chr22:16916743-50739785)x3	copy number gain	See cases [RCV000134730]	Chr22:16916743..50739785 [GRCh38] Chr22:17397633..51178213 [GRCh37] Chr22:15777633..49525079 [NCBI36] Chr22:22q11.1-13.33	pathogenic
GRCh38/hg38 22q11.23-12.3(chr22:23279231-36247369)x3	copy number gain	See cases [RCV000138172]	Chr22:23279231..36247369 [GRCh38] Chr22:23621418..36643415 [GRCh37] Chr22:21951418..34973361 [NCBI36] Chr22:22q11.23-12.3	pathogenic
GRCh38/hg38 22q11.21-12.3(chr22:20907226-37187347)x3	copy number gain	See cases [RCV000137926]	Chr22:20907226..37187347 [GRCh38] Chr22:21261514..37583387 [GRCh37] Chr22:19591514..35913333 [NCBI36] Chr22:22q11.21-12.3	pathogenic
GRCh37/hg19 22q12.3-13.1(chr22:35680095-38098981)x1	copy number loss	See cases [RCV000207444]	Chr22:35680095..38098981 [GRCh37] Chr22:22q12.3-13.1	pathogenic
NM_002133.3(HMOX1):c.131G>A (p.Arg44Gln)	single nucleotide variant	not provided [RCV001368116]	Chr22:35383213 [GRCh38] Chr22:35779206 [GRCh37] Chr22:22q12.3	uncertain significance
GRCh37/hg19 22q11.1-13.33(chr22:16054691-51237518)x3	copy number gain	See cases [RCV000240091]	Chr22:16054691..51237518 [GRCh37] Chr22:22q11.1-13.33	pathogenic
GRCh37/hg19 22q12.3-13.33(chr22:35728929-51220961)x3	copy number gain	See cases [RCV000240469]	Chr22:35728929..51220961 [GRCh37] Chr22:22q12.3-13.33	pathogenic
NM_002133.3(HMOX1):c.330C>T (p.Ala110=)	single nucleotide variant	not provided [RCV000957470]\|not specified [RCV000591468]	Chr22:35386870 [GRCh38] Chr22:35782863 [GRCh37] Chr22:22q12.3	benign
GRCh37/hg19 22q11.1-13.33(chr22:16054691-51220902)x3	copy number gain	See cases [RCV000446956]	Chr22:16054691..51220902 [GRCh37] Chr22:22q11.1-13.33	pathogenic
GRCh37/hg19 22q11.1-13.33(chr22:16054691-51237463)x3	copy number gain	See cases [RCV000448847]	Chr22:16054691..51237463 [GRCh37] Chr22:22q11.1-13.33	pathogenic
GRCh37/hg19 22q11.1-13.33(chr22:16888900-51197838)	copy number gain	See cases [RCV000510873]	Chr22:16888900..51197838 [GRCh37] Chr22:22q11.1-13.33	pathogenic
GRCh37/hg19 22q11.23-12.3(chr22:23637907-36614412)x3	copy number gain	See cases [RCV000511098]	Chr22:23637907..36614412 [GRCh37] Chr22:22q11.23-12.3	pathogenic
NM_002133.3(HMOX1):c.724A>C (p.Asn242His)	single nucleotide variant	Inborn genetic diseases [RCV003240582]	Chr22:35389951 [GRCh38] Chr22:35785944 [GRCh37] Chr22:22q12.3	uncertain significance
GRCh37/hg19 22q11.1-13.33(chr22:16888900-51197838)x3	copy number gain	See cases [RCV000512333]	Chr22:16888900..51197838 [GRCh37] Chr22:22q11.1-13.33	pathogenic
GRCh37/hg19 22q12.3-13.1(chr22:35674826-39466442)x3	copy number gain	See cases [RCV000512385]	Chr22:35674826..39466442 [GRCh37] Chr22:22q12.3-13.1	likely pathogenic
GRCh37/hg19 22q11.1-13.33(chr22:16054667-51243435)x3	copy number gain	not provided [RCV000741689]	Chr22:16054667..51243435 [GRCh37] Chr22:22q11.1-13.33	pathogenic
GRCh37/hg19 22q11.1-13.33(chr22:16114244-51195728)x3	copy number gain	not provided [RCV000741691]	Chr22:16114244..51195728 [GRCh37] Chr22:22q11.1-13.33	pathogenic
GRCh37/hg19 22q11.1-13.33(chr22:16114244-51211392)x3	copy number gain	not provided [RCV000741692]	Chr22:16114244..51211392 [GRCh37] Chr22:22q11.1-13.33	pathogenic
NM_002133.3(HMOX1):c.222C>T (p.Phe74=)	single nucleotide variant	not provided [RCV000882487]	Chr22:35386762 [GRCh38] Chr22:35782755 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.291C>T (p.Tyr97=)	single nucleotide variant	not provided [RCV000884372]	Chr22:35386831 [GRCh38] Chr22:35782824 [GRCh37] Chr22:22q12.3	benign
GRCh37/hg19 22q12.2-13.33(chr22:30654764-51197838)x3	copy number gain	not provided [RCV001007181]	Chr22:30654764..51197838 [GRCh37] Chr22:22q12.2-13.33	pathogenic
NM_002133.3(HMOX1):c.351G>A (p.Arg117=)	single nucleotide variant	not provided [RCV000980665]	Chr22:35386891 [GRCh38] Chr22:35782884 [GRCh37] Chr22:22q12.3	likely benign
GRCh37/hg19 22q11.1-13.33(chr22:16888899-51197838)x3	copy number gain	not provided [RCV000846344]	Chr22:16888899..51197838 [GRCh37] Chr22:22q11.1-13.33	pathogenic
NM_002133.3(HMOX1):c.55dup (p.Glu19fs)	duplication	not provided [RCV000997913]	Chr22:35383135..35383136 [GRCh38] Chr22:35779128..35779129 [GRCh37] Chr22:22q12.3	likely pathogenic
NC_000022.10:g.(?_35779079)_(35779239_?)dup	duplication	not provided [RCV003107591]	Chr22:35779079..35779239 [GRCh37] Chr22:22q12.3	likely pathogenic
NM_002133.3(HMOX1):c.603A>G (p.Glu201=)	single nucleotide variant	HMOX1-related condition [RCV003915877]\|not provided [RCV000955603]	Chr22:35387143 [GRCh38] Chr22:35783136 [GRCh37] Chr22:22q12.3	benign\|likely benign
NM_002133.3(HMOX1):c.366G>A (p.Gly122=)	single nucleotide variant	not provided [RCV000933902]	Chr22:35386906 [GRCh38] Chr22:35782899 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.840A>G (p.Thr280=)	single nucleotide variant	not provided [RCV000889784]	Chr22:35393571 [GRCh38] Chr22:35789564 [GRCh37] Chr22:22q12.3	benign
NM_002133.3(HMOX1):c.360G>T (p.Glu120Asp)	single nucleotide variant	not provided [RCV002464873]	Chr22:35386900 [GRCh38] Chr22:35782893 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.636+2T>A	single nucleotide variant	Heme oxygenase 1 deficiency [RCV001543383]\|not provided [RCV003558841]	Chr22:35387178 [GRCh38] Chr22:35783171 [GRCh37] Chr22:22q12.3	pathogenic\|likely pathogenic
GRCh37/hg19 22q11.1-13.33(chr22:16197005-51224252)x3	copy number gain	See cases [RCV001263056]	Chr22:16197005..51224252 [GRCh37] Chr22:22q11.1-13.33	pathogenic
NM_002133.3(HMOX1):c.694C>T (p.Arg232Trp)	single nucleotide variant	not provided [RCV001306486]	Chr22:35389921 [GRCh38] Chr22:35785914 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.716G>A (p.Arg239Gln)	single nucleotide variant	not provided [RCV001320950]	Chr22:35389943 [GRCh38] Chr22:35785936 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.262_268delinsCC (p.Ala88fs)	indel	Heme oxygenase 1 deficiency [RCV001787242]\|not provided [RCV002275222]	Chr22:35386802..35386808 [GRCh38] Chr22:35782795..35782801 [GRCh37] Chr22:22q12.3	pathogenic\|likely pathogenic
NM_002133.3(HMOX1):c.334_345del (p.Gln112_Val115del)	deletion	not provided [RCV001357789]	Chr22:35386872..35386883 [GRCh38] Chr22:35782865..35782876 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.254G>T (p.Arg85Leu)	single nucleotide variant	not provided [RCV001321298]	Chr22:35386794 [GRCh38] Chr22:35782787 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.452C>T (p.Ala151Val)	single nucleotide variant	not provided [RCV001325924]	Chr22:35386992 [GRCh38] Chr22:35782985 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.709C>G (p.Arg237Gly)	single nucleotide variant	HMOX1-related condition [RCV003918871]\|not provided [RCV001350633]	Chr22:35389936 [GRCh38] Chr22:35785929 [GRCh37] Chr22:22q12.3	likely benign\|conflicting interpretations of pathogenicity\|uncertain significance
NM_002133.3(HMOX1):c.23+14G>A	single nucleotide variant	not provided [RCV001519736]	Chr22:35381210 [GRCh38] Chr22:35777203 [GRCh37] Chr22:22q12.3	benign
NM_002133.3(HMOX1):c.23+13CGCGGGA[3]	microsatellite	not provided [RCV001519175]	Chr22:35381208..35381209 [GRCh38] Chr22:35777201..35777202 [GRCh37] Chr22:22q12.3	benign
NM_002133.3(HMOX1):c.552C>T (p.Ser184=)	single nucleotide variant	not provided [RCV001492783]	Chr22:35387092 [GRCh38] Chr22:35783085 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.637-9G>A	single nucleotide variant	not provided [RCV001477105]	Chr22:35389855 [GRCh38] Chr22:35785848 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.144+4T>C	single nucleotide variant	not provided [RCV001517796]	Chr22:35383230 [GRCh38] Chr22:35779223 [GRCh37] Chr22:22q12.3	benign
NM_002133.3(HMOX1):c.579C>T (p.Pro193=)	single nucleotide variant	HMOX1-related condition [RCV003940903]\|not provided [RCV001512647]	Chr22:35387119 [GRCh38] Chr22:35783112 [GRCh37] Chr22:22q12.3	benign
NM_002133.3(HMOX1):c.621C>T (p.Phe207=)	single nucleotide variant	not provided [RCV001427398]	Chr22:35387161 [GRCh38] Chr22:35783154 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.19G>C (p.Asp7His)	single nucleotide variant	not provided [RCV001518876]	Chr22:35381192 [GRCh38] Chr22:35777185 [GRCh37] Chr22:22q12.3	benign
NM_002133.3(HMOX1):c.715C>T (p.Arg239Trp)	single nucleotide variant	Inborn genetic diseases [RCV002564274]\|not provided [RCV001509095]	Chr22:35389942 [GRCh38] Chr22:35785935 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.145-19C>T	single nucleotide variant	not provided [RCV001515612]	Chr22:35386666 [GRCh38] Chr22:35782659 [GRCh37] Chr22:22q12.3	benign
NM_002133.3(HMOX1):c.861C>T (p.Ala287=)	single nucleotide variant	not provided [RCV001477310]	Chr22:35393592 [GRCh38] Chr22:35789585 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.-7C>T	single nucleotide variant	not provided [RCV001509094]	Chr22:35381167 [GRCh38] Chr22:35777160 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.797C>T (p.Pro266Leu)	single nucleotide variant	not provided [RCV001520646]	Chr22:35393528 [GRCh38] Chr22:35789521 [GRCh37] Chr22:22q12.3	benign
NM_002133.3(HMOX1):c.676A>G (p.Lys226Glu)	single nucleotide variant	HMOX1-related condition [RCV003931052]\|not provided [RCV001511131]	Chr22:35389903 [GRCh38] Chr22:35785896 [GRCh37] Chr22:22q12.3	benign\|likely benign
NM_002133.3(HMOX1):c.25A>T (p.Met9Leu)	single nucleotide variant	not provided [RCV003105112]	Chr22:35383107 [GRCh38] Chr22:35779100 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.287G>A (p.Trp96Ter)	single nucleotide variant	Heme oxygenase 1 deficiency [RCV001780441]\|not provided [RCV001753341]	Chr22:35386827 [GRCh38] Chr22:35782820 [GRCh37] Chr22:22q12.3	likely pathogenic\|conflicting interpretations of pathogenicity\|uncertain significance
NM_002133.3(HMOX1):c.130C>T (p.Arg44Ter)	single nucleotide variant	Heme oxygenase 1 deficiency [RCV001787239]\|not provided [RCV003546715]	Chr22:35383212 [GRCh38] Chr22:35779205 [GRCh37] Chr22:22q12.3	pathogenic
NM_002133.3(HMOX1):c.416G>T (p.Gly139Val)	single nucleotide variant	Heme oxygenase 1 deficiency [RCV001787240]	Chr22:35386956 [GRCh38] Chr22:35782949 [GRCh37] Chr22:22q12.3	pathogenic
NM_002133.3(HMOX1):c.610A>T (p.Lys204Ter)	single nucleotide variant	Heme oxygenase 1 deficiency [RCV001787241]\|not provided [RCV003772175]	Chr22:35387150 [GRCh38] Chr22:35783143 [GRCh37] Chr22:22q12.3	pathogenic
NM_002133.3(HMOX1):c.299G>A (p.Arg100His)	single nucleotide variant	Inborn genetic diseases [RCV002554306]\|not provided [RCV001915385]	Chr22:35386839 [GRCh38] Chr22:35782832 [GRCh37] Chr22:22q12.3	likely benign\|uncertain significance
NM_002133.3(HMOX1):c.709C>T (p.Arg237Cys)	single nucleotide variant	not provided [RCV001874737]	Chr22:35389936 [GRCh38] Chr22:35785929 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.554G>A (p.Arg185His)	single nucleotide variant	Inborn genetic diseases [RCV003264197]\|not provided [RCV001896063]	Chr22:35387094 [GRCh38] Chr22:35783087 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.338G>A (p.Arg113His)	single nucleotide variant	not provided [RCV001964664]	Chr22:35386878 [GRCh38] Chr22:35782871 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.253C>T (p.Arg85Cys)	single nucleotide variant	HMOX1-related condition [RCV003426218]\|not provided [RCV002040037]	Chr22:35386793 [GRCh38] Chr22:35782786 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.484G>A (p.Glu162Lys)	single nucleotide variant	not provided [RCV001967298]	Chr22:35387024 [GRCh38] Chr22:35783017 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.87G>T (p.Glu29Asp)	single nucleotide variant	not provided [RCV001928720]	Chr22:35383169 [GRCh38] Chr22:35779162 [GRCh37] Chr22:22q12.3	likely benign\|uncertain significance
NM_002133.3(HMOX1):c.65A>C (p.Lys22Thr)	single nucleotide variant	not provided [RCV001894488]	Chr22:35383147 [GRCh38] Chr22:35779140 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.667C>T (p.His223Tyr)	single nucleotide variant	not provided [RCV002002261]	Chr22:35389894 [GRCh38] Chr22:35785887 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.847G>A (p.Val283Ile)	single nucleotide variant	not provided [RCV001938856]	Chr22:35393578 [GRCh38] Chr22:35789571 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.254G>A (p.Arg85His)	single nucleotide variant	not provided [RCV001923704]	Chr22:35386794 [GRCh38] Chr22:35782787 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.360G>C (p.Glu120Asp)	single nucleotide variant	not provided [RCV001883732]	Chr22:35386900 [GRCh38] Chr22:35782893 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.842T>G (p.Val281Gly)	single nucleotide variant	not provided [RCV001995343]	Chr22:35393573 [GRCh38] Chr22:35789566 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.356A>G (p.His119Arg)	single nucleotide variant	not provided [RCV001944789]	Chr22:35386896 [GRCh38] Chr22:35782889 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.553C>T (p.Arg185Cys)	single nucleotide variant	not provided [RCV001922468]	Chr22:35387093 [GRCh38] Chr22:35783086 [GRCh37] Chr22:22q12.3	uncertain significance
NC_000022.10:g.(?_35777167)_(35820248_?)dup	duplication	not provided [RCV001884054]	Chr22:35777167..35820248 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.23+6C>T	single nucleotide variant	not provided [RCV001994108]	Chr22:35381202 [GRCh38] Chr22:35777195 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.136G>A (p.Gly46Ser)	single nucleotide variant	not provided [RCV001998000]	Chr22:35383218 [GRCh38] Chr22:35779211 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.836C>T (p.Ala279Val)	single nucleotide variant	not provided [RCV001939320]	Chr22:35393567 [GRCh38] Chr22:35789560 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.263C>A (p.Ala88Asp)	single nucleotide variant	not provided [RCV001942901]	Chr22:35386803 [GRCh38] Chr22:35782796 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.575C>A (p.Thr192Asn)	single nucleotide variant	not provided [RCV002036003]	Chr22:35387115 [GRCh38] Chr22:35783108 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.637-1G>A	single nucleotide variant	not provided [RCV002038724]	Chr22:35389863 [GRCh38] Chr22:35785856 [GRCh37] Chr22:22q12.3	likely pathogenic
NM_002133.3(HMOX1):c.599T>C (p.Ile200Thr)	single nucleotide variant	not provided [RCV001958548]	Chr22:35387139 [GRCh38] Chr22:35783132 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.864G>A (p.Met288Ile)	single nucleotide variant	not provided [RCV002037554]	Chr22:35393595 [GRCh38] Chr22:35789588 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.442A>G (p.Lys148Glu)	single nucleotide variant	not provided [RCV001931022]	Chr22:35386982 [GRCh38] Chr22:35782975 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.853C>T (p.Leu285Phe)	single nucleotide variant	Inborn genetic diseases [RCV002551004]\|not provided [RCV001932452]	Chr22:35393584 [GRCh38] Chr22:35789577 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.204C>G (p.Asn68Lys)	single nucleotide variant	not provided [RCV002047253]	Chr22:35386744 [GRCh38] Chr22:35782737 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.322A>G (p.Thr108Ala)	single nucleotide variant	not provided [RCV002010832]	Chr22:35386862 [GRCh38] Chr22:35782855 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.145-12C>G	single nucleotide variant	not provided [RCV001973425]	Chr22:35386673 [GRCh38] Chr22:35782666 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.407G>A (p.Arg136His)	single nucleotide variant	not provided [RCV001883722]	Chr22:35386947 [GRCh38] Chr22:35782940 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.210G>T (p.Glu70Asp)	single nucleotide variant	not provided [RCV001917812]	Chr22:35386750 [GRCh38] Chr22:35782743 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.680A>C (p.Asp227Ala)	single nucleotide variant	not provided [RCV001997025]	Chr22:35389907 [GRCh38] Chr22:35785900 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.37T>A (p.Leu13Met)	single nucleotide variant	not provided [RCV001980704]	Chr22:35383119 [GRCh38] Chr22:35779112 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.577C>T (p.Pro193Ser)	single nucleotide variant	not provided [RCV001919856]	Chr22:35387117 [GRCh38] Chr22:35783110 [GRCh37] Chr22:22q12.3	likely benign\|uncertain significance
NM_002133.3(HMOX1):c.496T>C (p.Phe166Leu)	single nucleotide variant	not provided [RCV002019131]	Chr22:35387036 [GRCh38] Chr22:35783029 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.839C>A (p.Thr280Lys)	single nucleotide variant	Inborn genetic diseases [RCV002563513]\|not provided [RCV001997004]	Chr22:35393570 [GRCh38] Chr22:35789563 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.337C>T (p.Arg113Cys)	single nucleotide variant	Inborn genetic diseases [RCV002561439]\|not provided [RCV001982190]	Chr22:35386877 [GRCh38] Chr22:35782870 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.350G>A (p.Arg117Gln)	single nucleotide variant	not provided [RCV001917976]	Chr22:35386890 [GRCh38] Chr22:35782883 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.151A>T (p.Met51Leu)	single nucleotide variant	not provided [RCV002027625]	Chr22:35386691 [GRCh38] Chr22:35782684 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.736+8C>T	single nucleotide variant	not provided [RCV002148780]	Chr22:35389971 [GRCh38] Chr22:35785964 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.108C>T (p.Asn36=)	single nucleotide variant	not provided [RCV002187268]	Chr22:35383190 [GRCh38] Chr22:35779183 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.837G>A (p.Ala279=)	single nucleotide variant	not provided [RCV002148179]	Chr22:35393568 [GRCh38] Chr22:35789561 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.54G>A (p.Lys18=)	single nucleotide variant	not provided [RCV002128632]	Chr22:35383136 [GRCh38] Chr22:35779129 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.246G>A (p.Glu82=)	single nucleotide variant	not provided [RCV002167428]	Chr22:35386786 [GRCh38] Chr22:35782779 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.261T>C (p.Ala87=)	single nucleotide variant	not provided [RCV002107887]	Chr22:35386801 [GRCh38] Chr22:35782794 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.23+13CGCGGGA[4]	microsatellite	not provided [RCV002109944]	Chr22:35381208..35381209 [GRCh38] Chr22:35777201..35777202 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.145-17G>A	single nucleotide variant	not provided [RCV002174496]	Chr22:35386668 [GRCh38] Chr22:35782661 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.741T>C (p.Ser247=)	single nucleotide variant	HMOX1-related condition [RCV003950983]\|not provided [RCV002080574]	Chr22:35393472 [GRCh38] Chr22:35789465 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.747C>T (p.Pro249=)	single nucleotide variant	not provided [RCV002194776]	Chr22:35393478 [GRCh38] Chr22:35789471 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.462C>T (p.Ala154=)	single nucleotide variant	not provided [RCV002196379]	Chr22:35387002 [GRCh38] Chr22:35782995 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.852G>A (p.Gly284=)	single nucleotide variant	not provided [RCV002174488]	Chr22:35393583 [GRCh38] Chr22:35789576 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.135C>T (p.Asp45=)	single nucleotide variant	HMOX1-related condition [RCV003951075]\|not provided [RCV002115623]	Chr22:35383217 [GRCh38] Chr22:35779210 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.357C>T (p.His119=)	single nucleotide variant	not provided [RCV002097426]	Chr22:35386897 [GRCh38] Chr22:35782890 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.378C>T (p.Pro126=)	single nucleotide variant	Heme oxygenase 1 deficiency [RCV002494344]\|not provided [RCV002079375]	Chr22:35386918 [GRCh38] Chr22:35782911 [GRCh37] Chr22:22q12.3	benign\|likely benign
NM_002133.3(HMOX1):c.669T>C (p.His223=)	single nucleotide variant	not provided [RCV002205053]	Chr22:35389896 [GRCh38] Chr22:35785889 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.23+15C>T	single nucleotide variant	not provided [RCV002206647]	Chr22:35381211 [GRCh38] Chr22:35777204 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.429G>A (p.Gly143=)	single nucleotide variant	not provided [RCV002157686]	Chr22:35386969 [GRCh38] Chr22:35782962 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.23+22_23+28del	microsatellite	not provided [RCV002081984]	Chr22:35381209..35381215 [GRCh38] Chr22:35777202..35777208 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.282C>G (p.Ala94=)	single nucleotide variant	not provided [RCV002159177]	Chr22:35386822 [GRCh38] Chr22:35782815 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.522T>C (p.Ser174=)	single nucleotide variant	not provided [RCV002121884]	Chr22:35387062 [GRCh38] Chr22:35783055 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.618G>A (p.Ala206=)	single nucleotide variant	not provided [RCV002202762]	Chr22:35387158 [GRCh38] Chr22:35783151 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.23+5GCGCGGG[3]	microsatellite	not provided [RCV003110891]	Chr22:35381200..35381201 [GRCh38] Chr22:35777193..35777194 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.173A>G (p.Tyr58Cys)	single nucleotide variant	Inborn genetic diseases [RCV003162139]\|not provided [RCV003115217]	Chr22:35386713 [GRCh38] Chr22:35782706 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.547C>T (p.Arg183Cys)	single nucleotide variant	not provided [RCV003112613]	Chr22:35387087 [GRCh38] Chr22:35783080 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.349C>T (p.Arg117Trp)	single nucleotide variant	not provided [RCV003115589]	Chr22:35386889 [GRCh38] Chr22:35782882 [GRCh37] Chr22:22q12.3	uncertain significance
NC_000022.10:g.(?_35776672)_(42486826_?)dup	duplication	Adenylosuccinate lyase deficiency [RCV003119093]	Chr22:35776672..42486826 [GRCh37] Chr22:22q12.3-13.2	uncertain significance
NM_002133.3(HMOX1):c.-13C>T	single nucleotide variant	not provided [RCV002261644]	Chr22:35381161 [GRCh38] Chr22:35777154 [GRCh37] Chr22:22q12.3	uncertain significance
GRCh37/hg19 22q12.3(chr22:35763314-35858124)x1	copy number loss	not provided [RCV002473434]	Chr22:35763314..35858124 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.560A>T (p.Asn187Ile)	single nucleotide variant	not provided [RCV002303581]	Chr22:35387100 [GRCh38] Chr22:35783093 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.785G>A (p.Arg262His)	single nucleotide variant	not provided [RCV002751315]	Chr22:35393516 [GRCh38] Chr22:35789509 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.215C>T (p.Pro72Leu)	single nucleotide variant	not provided [RCV002991694]	Chr22:35386755 [GRCh38] Chr22:35782748 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.863T>C (p.Met288Thr)	single nucleotide variant	Inborn genetic diseases [RCV002683655]	Chr22:35393594 [GRCh38] Chr22:35789587 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.364G>C (p.Gly122Arg)	single nucleotide variant	not provided [RCV002904075]	Chr22:35386904 [GRCh38] Chr22:35782897 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.354C>G (p.Leu118=)	single nucleotide variant	not provided [RCV002953421]	Chr22:35386894 [GRCh38] Chr22:35782887 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.548G>A (p.Arg183His)	single nucleotide variant	not provided [RCV002593236]	Chr22:35387088 [GRCh38] Chr22:35783081 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.21C>G (p.Asp7Glu)	single nucleotide variant	not provided [RCV003038196]	Chr22:35381194 [GRCh38] Chr22:35777187 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.530A>C (p.Lys177Thr)	single nucleotide variant	not provided [RCV003018691]	Chr22:35387070 [GRCh38] Chr22:35783063 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.393C>A (p.Ala131=)	single nucleotide variant	not provided [RCV002621216]	Chr22:35386933 [GRCh38] Chr22:35782926 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.499T>C (p.Phe167Leu)	single nucleotide variant	not provided [RCV002705524]	Chr22:35387039 [GRCh38] Chr22:35783032 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.736+18G>C	single nucleotide variant	not provided [RCV002871106]	Chr22:35389981 [GRCh38] Chr22:35785974 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.25A>C (p.Met9Leu)	single nucleotide variant	Inborn genetic diseases [RCV002799829]	Chr22:35383107 [GRCh38] Chr22:35779100 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.737-12T>C	single nucleotide variant	not provided [RCV003037601]	Chr22:35393456 [GRCh38] Chr22:35789449 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.837G>T (p.Ala279=)	single nucleotide variant	not provided [RCV002871801]	Chr22:35393568 [GRCh38] Chr22:35789561 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.220T>C (p.Phe74Leu)	single nucleotide variant	not provided [RCV002918230]	Chr22:35386760 [GRCh38] Chr22:35782753 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.582A>T (p.Ala194=)	single nucleotide variant	not provided [RCV002597350]	Chr22:35387122 [GRCh38] Chr22:35783115 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.177G>A (p.Val59=)	single nucleotide variant	not provided [RCV002876141]	Chr22:35386717 [GRCh38] Chr22:35782710 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.500T>C (p.Phe167Ser)	single nucleotide variant	not provided [RCV003057987]	Chr22:35387040 [GRCh38] Chr22:35783033 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.24-12T>C	single nucleotide variant	not provided [RCV002852301]	Chr22:35383094 [GRCh38] Chr22:35779087 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.367C>T (p.Arg123Cys)	single nucleotide variant	not provided [RCV003056733]	Chr22:35386907 [GRCh38] Chr22:35782900 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.329C>T (p.Ala110Val)	single nucleotide variant	Inborn genetic diseases [RCV002699310]\|not provided [RCV003108228]	Chr22:35386869 [GRCh38] Chr22:35782862 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.708T>A (p.Leu236=)	single nucleotide variant	not provided [RCV002830232]	Chr22:35389935 [GRCh38] Chr22:35785928 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.736+15G>A	single nucleotide variant	not provided [RCV002890020]	Chr22:35389978 [GRCh38] Chr22:35785971 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.617C>T (p.Ala206Val)	single nucleotide variant	not provided [RCV002928369]	Chr22:35387157 [GRCh38] Chr22:35783150 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.396C>T (p.His132=)	single nucleotide variant	not provided [RCV002667556]	Chr22:35386936 [GRCh38] Chr22:35782929 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.348G>A (p.Lys116=)	single nucleotide variant	not provided [RCV002741491]	Chr22:35386888 [GRCh38] Chr22:35782881 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.737-11_737-10del	deletion	not provided [RCV002937572]	Chr22:35393455..35393456 [GRCh38] Chr22:35789448..35789449 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.743C>T (p.Ala248Val)	single nucleotide variant	not provided [RCV003092062]	Chr22:35393474 [GRCh38] Chr22:35789467 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.53A>T (p.Lys18Met)	single nucleotide variant	not provided [RCV002632902]	Chr22:35383135 [GRCh38] Chr22:35779128 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.397G>A (p.Ala133Thr)	single nucleotide variant	Inborn genetic diseases [RCV002812460]	Chr22:35386937 [GRCh38] Chr22:35782930 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.369C>T (p.Arg123=)	single nucleotide variant	not provided [RCV002937299]	Chr22:35386909 [GRCh38] Chr22:35782902 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.23+19A>G	single nucleotide variant	not provided [RCV002670775]	Chr22:35381215 [GRCh38] Chr22:35777208 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.562T>C (p.Ser188Pro)	single nucleotide variant	not provided [RCV002646430]	Chr22:35387102 [GRCh38] Chr22:35783095 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.736+3G>A	single nucleotide variant	not provided [RCV002715429]	Chr22:35389966 [GRCh38] Chr22:35785959 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.736+5G>A	single nucleotide variant	not provided [RCV002715430]	Chr22:35389968 [GRCh38] Chr22:35785961 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.598A>G (p.Ile200Val)	single nucleotide variant	not provided [RCV002599956]	Chr22:35387138 [GRCh38] Chr22:35783131 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.806G>A (p.Arg269Gln)	single nucleotide variant	not provided [RCV002577462]	Chr22:35393537 [GRCh38] Chr22:35789530 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.514A>G (p.Ile172Val)	single nucleotide variant	not provided [RCV002807300]	Chr22:35387054 [GRCh38] Chr22:35783047 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.819A>G (p.Thr273=)	single nucleotide variant	not provided [RCV002922120]	Chr22:35393550 [GRCh38] Chr22:35789543 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.580G>A (p.Ala194Thr)	single nucleotide variant	not provided [RCV002607543]	Chr22:35387120 [GRCh38] Chr22:35783113 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.564C>T (p.Ser188=)	single nucleotide variant	not provided [RCV002658025]	Chr22:35387104 [GRCh38] Chr22:35783097 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.298C>T (p.Arg100Cys)	single nucleotide variant	Inborn genetic diseases [RCV002652585]	Chr22:35386838 [GRCh38] Chr22:35782831 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.404C>G (p.Thr135Ser)	single nucleotide variant	Inborn genetic diseases [RCV003348417]	Chr22:35386944 [GRCh38] Chr22:35782937 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.145-10C>T	single nucleotide variant	not provided [RCV003571239]	Chr22:35386675 [GRCh38] Chr22:35782668 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.726C>T (p.Asn242=)	single nucleotide variant	not provided [RCV003570252]	Chr22:35389953 [GRCh38] Chr22:35785946 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.636+12_636+13del	deletion	not provided [RCV003570490]	Chr22:35387188..35387189 [GRCh38] Chr22:35783181..35783182 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.304C>T (p.Gln102Ter)	single nucleotide variant	not provided [RCV003571898]	Chr22:35386844 [GRCh38] Chr22:35782837 [GRCh37] Chr22:22q12.3	pathogenic
NM_002133.3(HMOX1):c.342T>C (p.Tyr114=)	single nucleotide variant	not provided [RCV003691503]	Chr22:35386882 [GRCh38] Chr22:35782875 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.412C>T (p.Leu138=)	single nucleotide variant	not provided [RCV003571350]	Chr22:35386952 [GRCh38] Chr22:35782945 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.822C>T (p.Leu274=)	single nucleotide variant	not provided [RCV003457100]	Chr22:35393553 [GRCh38] Chr22:35789546 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.17C>A (p.Pro6His)	single nucleotide variant	HMOX1-related condition [RCV003408373]	Chr22:35381190 [GRCh38] Chr22:35777183 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.382C>T (p.Leu128=)	single nucleotide variant	not provided [RCV003694184]	Chr22:35386922 [GRCh38] Chr22:35782915 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.309G>A (p.Glu103=)	single nucleotide variant	not provided [RCV003578123]	Chr22:35386849 [GRCh38] Chr22:35782842 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.777C>T (p.Leu259=)	single nucleotide variant	not provided [RCV003715041]	Chr22:35393508 [GRCh38] Chr22:35789501 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.420C>T (p.Asp140=)	single nucleotide variant	not provided [RCV003576990]	Chr22:35386960 [GRCh38] Chr22:35782953 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.99C>T (p.Phe33=)	single nucleotide variant	not provided [RCV003827385]	Chr22:35383181 [GRCh38] Chr22:35779174 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.705G>C (p.Gly235=)	single nucleotide variant	not provided [RCV003694369]	Chr22:35389932 [GRCh38] Chr22:35785925 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.247C>T (p.Leu83=)	single nucleotide variant	not provided [RCV003574403]	Chr22:35386787 [GRCh38] Chr22:35782780 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.459del (p.Ala154fs)	deletion	not provided [RCV003692366]	Chr22:35386997 [GRCh38] Chr22:35782990 [GRCh37] Chr22:22q12.3	pathogenic
NM_002133.3(HMOX1):c.372A>G (p.Thr124=)	single nucleotide variant	not provided [RCV003662328]	Chr22:35386912 [GRCh38] Chr22:35782905 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.652C>T (p.Gln218Ter)	single nucleotide variant	not provided [RCV003660190]	Chr22:35389879 [GRCh38] Chr22:35785872 [GRCh37] Chr22:22q12.3	pathogenic
NM_002133.3(HMOX1):c.324A>T (p.Thr108=)	single nucleotide variant	not provided [RCV003686813]	Chr22:35386864 [GRCh38] Chr22:35782857 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.747C>G (p.Pro249=)	single nucleotide variant	not provided [RCV003694083]	Chr22:35393478 [GRCh38] Chr22:35789471 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.285C>T (p.Phe95=)	single nucleotide variant	not provided [RCV003690037]	Chr22:35386825 [GRCh38] Chr22:35782818 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.277C>T (p.Leu93=)	single nucleotide variant	not provided [RCV003547651]	Chr22:35386817 [GRCh38] Chr22:35782810 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.405C>T (p.Thr135=)	single nucleotide variant	not provided [RCV003686417]	Chr22:35386945 [GRCh38] Chr22:35782938 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.288G>A (p.Trp96Ter)	single nucleotide variant	not provided [RCV003687490]	Chr22:35386828 [GRCh38] Chr22:35782821 [GRCh37] Chr22:22q12.3	pathogenic
NM_002133.3(HMOX1):c.291C>A (p.Tyr97Ter)	single nucleotide variant	not provided [RCV003716455]	Chr22:35386831 [GRCh38] Chr22:35782824 [GRCh37] Chr22:22q12.3	pathogenic
NM_002133.3(HMOX1):c.144+1G>A	single nucleotide variant	not provided [RCV003572457]	Chr22:35383227 [GRCh38] Chr22:35779220 [GRCh37] Chr22:22q12.3	likely pathogenic
NM_002133.3(HMOX1):c.732G>A (p.Val244=)	single nucleotide variant	not provided [RCV003687354]	Chr22:35389959 [GRCh38] Chr22:35785952 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.636+7G>A	single nucleotide variant	not provided [RCV003547411]	Chr22:35387183 [GRCh38] Chr22:35783176 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.156C>G (p.Ala52=)	single nucleotide variant	not provided [RCV003691761]	Chr22:35386696 [GRCh38] Chr22:35782689 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.696G>C (p.Arg232=)	single nucleotide variant	not provided [RCV003547812]	Chr22:35389923 [GRCh38] Chr22:35785916 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.219C>T (p.Val73=)	single nucleotide variant	not provided [RCV003689221]	Chr22:35386759 [GRCh38] Chr22:35782752 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.417T>C (p.Gly139=)	single nucleotide variant	not provided [RCV003691268]	Chr22:35386957 [GRCh38] Chr22:35782950 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.81G>A (p.Gln27=)	single nucleotide variant	not provided [RCV003547551]	Chr22:35383163 [GRCh38] Chr22:35779156 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.444A>G (p.Lys148=)	single nucleotide variant	not provided [RCV003571964]	Chr22:35386984 [GRCh38] Chr22:35782977 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.23+1G>T	single nucleotide variant	not provided [RCV003716329]	Chr22:35381197 [GRCh38] Chr22:35777190 [GRCh37] Chr22:22q12.3	likely pathogenic
NM_002133.3(HMOX1):c.711C>G (p.Arg237=)	single nucleotide variant	not provided [RCV003662686]	Chr22:35389938 [GRCh38] Chr22:35785931 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.207G>A (p.Lys69=)	single nucleotide variant	not provided [RCV003811610]	Chr22:35386747 [GRCh38] Chr22:35782740 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.737-12T>A	single nucleotide variant	not provided [RCV003849703]	Chr22:35393456 [GRCh38] Chr22:35789449 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.120C>G (p.Gly40=)	single nucleotide variant	not provided [RCV003580226]	Chr22:35383202 [GRCh38] Chr22:35779195 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.737-15C>T	single nucleotide variant	not provided [RCV003667747]	Chr22:35393453 [GRCh38] Chr22:35789446 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.737-16C>G	single nucleotide variant	not provided [RCV003811188]	Chr22:35393452 [GRCh38] Chr22:35789445 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.690C>A (p.Pro230=)	single nucleotide variant	not provided [RCV003840359]	Chr22:35389917 [GRCh38] Chr22:35785910 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.715C>A (p.Arg239=)	single nucleotide variant	not provided [RCV003697803]	Chr22:35389942 [GRCh38] Chr22:35785935 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.678G>A (p.Lys226=)	single nucleotide variant	not provided [RCV003856818]	Chr22:35389905 [GRCh38] Chr22:35785898 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.469C>T (p.Leu157=)	single nucleotide variant	not provided [RCV003674412]	Chr22:35387009 [GRCh38] Chr22:35783002 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.23+12G>A	single nucleotide variant	not provided [RCV003856680]	Chr22:35381208 [GRCh38] Chr22:35777201 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.117G>A (p.Lys39=)	single nucleotide variant	not provided [RCV003674094]	Chr22:35383199 [GRCh38] Chr22:35779192 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.378C>G (p.Pro126=)	single nucleotide variant	not provided [RCV003560472]	Chr22:35386918 [GRCh38] Chr22:35782911 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.23+8_23+23del	deletion	not provided [RCV003666353]	Chr22:35381201..35381216 [GRCh38] Chr22:35777194..35777209 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.636+13C>T	single nucleotide variant	not provided [RCV003702514]	Chr22:35387189 [GRCh38] Chr22:35783182 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.579C>G (p.Pro193=)	single nucleotide variant	not provided [RCV003724920]	Chr22:35387119 [GRCh38] Chr22:35783112 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.567G>A (p.Leu189=)	single nucleotide variant	not provided [RCV003549532]	Chr22:35387107 [GRCh38] Chr22:35783100 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.737-9C>G	single nucleotide variant	not provided [RCV003673330]	Chr22:35393459 [GRCh38] Chr22:35789452 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.615T>C (p.Thr205=)	single nucleotide variant	not provided [RCV003672032]	Chr22:35387155 [GRCh38] Chr22:35783148 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.736+12C>G	single nucleotide variant	not provided [RCV003854801]	Chr22:35389975 [GRCh38] Chr22:35785968 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.105G>A (p.Arg35=)	single nucleotide variant	not provided [RCV003839465]	Chr22:35383187 [GRCh38] Chr22:35779180 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.636+7G>T	single nucleotide variant	not provided [RCV003700691]	Chr22:35387183 [GRCh38] Chr22:35783176 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.636+17C>T	single nucleotide variant	not provided [RCV003816256]	Chr22:35387193 [GRCh38] Chr22:35783186 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.384G>A (p.Leu128=)	single nucleotide variant	not provided [RCV003666710]	Chr22:35386924 [GRCh38] Chr22:35782917 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.23+17G>C	single nucleotide variant	not provided [RCV003839163]	Chr22:35381213 [GRCh38] Chr22:35777206 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.210G>A (p.Glu70=)	single nucleotide variant	not provided [RCV003699750]	Chr22:35386750 [GRCh38] Chr22:35782743 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.145-18T>G	single nucleotide variant	not provided [RCV003831856]	Chr22:35386667 [GRCh38] Chr22:35782660 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.737-4T>C	single nucleotide variant	not provided [RCV003697355]	Chr22:35393464 [GRCh38] Chr22:35789457 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.294G>A (p.Gly98=)	single nucleotide variant	not provided [RCV003668589]	Chr22:35386834 [GRCh38] Chr22:35782827 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.23+11G>A	single nucleotide variant	not provided [RCV003666359]	Chr22:35381207 [GRCh38] Chr22:35777200 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.144+5G>C	single nucleotide variant	not provided [RCV003560325]	Chr22:35383231 [GRCh38] Chr22:35779224 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.144+20T>C	single nucleotide variant	not provided [RCV003834176]	Chr22:35383246 [GRCh38] Chr22:35779239 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.744C>A (p.Ala248=)	single nucleotide variant	not provided [RCV003567447]	Chr22:35393475 [GRCh38] Chr22:35789468 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.567G>C (p.Leu189=)	single nucleotide variant	not provided [RCV003681752]	Chr22:35387107 [GRCh38] Chr22:35783100 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.145-4del	deletion	not provided [RCV003863849]	Chr22:35386679 [GRCh38] Chr22:35782672 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.109T>C (p.Phe37Leu)	single nucleotide variant	not provided [RCV003683155]	Chr22:35383191 [GRCh38] Chr22:35779184 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.150G>C (p.Val50=)	single nucleotide variant	not provided [RCV003859928]	Chr22:35386690 [GRCh38] Chr22:35782683 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.237C>T (p.Phe79=)	single nucleotide variant	not provided [RCV003841540]	Chr22:35386777 [GRCh38] Chr22:35782770 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.612G>C (p.Lys204Asn)	single nucleotide variant	not provided [RCV003860016]	Chr22:35387152 [GRCh38] Chr22:35783145 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.798G>A (p.Pro266=)	single nucleotide variant	not provided [RCV003563258]	Chr22:35393529 [GRCh38] Chr22:35789522 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.627C>G (p.Leu209=)	single nucleotide variant	not provided [RCV003552811]	Chr22:35387167 [GRCh38] Chr22:35783160 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.57G>A (p.Glu19=)	single nucleotide variant	not provided [RCV003711255]	Chr22:35383139 [GRCh38] Chr22:35779132 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.363G>T (p.Val121=)	single nucleotide variant	not provided [RCV003676294]	Chr22:35386903 [GRCh38] Chr22:35782896 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.213C>T (p.Ser71=)	single nucleotide variant	not provided [RCV003865912]	Chr22:35386753 [GRCh38] Chr22:35782746 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.23+10G>A	single nucleotide variant	not provided [RCV003542668]	Chr22:35381206 [GRCh38] Chr22:35777199 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.604G>T (p.Glu202Ter)	single nucleotide variant	not provided [RCV003705458]	Chr22:35387144 [GRCh38] Chr22:35783137 [GRCh37] Chr22:22q12.3	pathogenic
NM_002133.3(HMOX1):c.42A>T (p.Ser14=)	single nucleotide variant	not provided [RCV003566657]	Chr22:35383124 [GRCh38] Chr22:35779117 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.57_60dup (p.Thr21fs)	duplication	not provided [RCV003678147]	Chr22:35383138..35383139 [GRCh38] Chr22:35779131..35779132 [GRCh37] Chr22:22q12.3	pathogenic
NM_002133.3(HMOX1):c.69G>A (p.Glu23=)	single nucleotide variant	not provided [RCV003553772]	Chr22:35383151 [GRCh38] Chr22:35779144 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.666C>T (p.Thr222=)	single nucleotide variant	not provided [RCV003565186]	Chr22:35389893 [GRCh38] Chr22:35785886 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.135_139del (p.Gly46fs)	deletion	not provided [RCV003683236]	Chr22:35383217..35383221 [GRCh38] Chr22:35779210..35779214 [GRCh37] Chr22:22q12.3	pathogenic
NM_002133.3(HMOX1):c.483C>T (p.Gly161=)	single nucleotide variant	not provided [RCV003841715]	Chr22:35387023 [GRCh38] Chr22:35783016 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.483C>G (p.Gly161=)	single nucleotide variant	not provided [RCV003568218]	Chr22:35387023 [GRCh38] Chr22:35783016 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.720C>T (p.Ala240=)	single nucleotide variant	not provided [RCV003728917]	Chr22:35389947 [GRCh38] Chr22:35785940 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.129C>A (p.Thr43=)	single nucleotide variant	not provided [RCV003719049]	Chr22:35383211 [GRCh38] Chr22:35779204 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.737-13T>A	single nucleotide variant	not provided [RCV003703769]	Chr22:35393455 [GRCh38] Chr22:35789448 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.24-5C>T	single nucleotide variant	not provided [RCV003706461]	Chr22:35383101 [GRCh38] Chr22:35779094 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.594G>A (p.Arg198=)	single nucleotide variant	not provided [RCV003557087]	Chr22:35387134 [GRCh38] Chr22:35783127 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.393C>G (p.Ala131=)	single nucleotide variant	not provided [RCV003670732]	Chr22:35386933 [GRCh38] Chr22:35782926 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.63C>T (p.Thr21=)	single nucleotide variant	not provided [RCV003845262]	Chr22:35383145 [GRCh38] Chr22:35779138 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.303_328del (p.Trp101fs)	deletion	not provided [RCV003719022]	Chr22:35386842..35386867 [GRCh38] Chr22:35782835..35782860 [GRCh37] Chr22:22q12.3	pathogenic
NM_002133.3(HMOX1):c.227_228del (p.Pro76fs)	deletion	not provided [RCV003847596]	Chr22:35386767..35386768 [GRCh38] Chr22:35782760..35782761 [GRCh37] Chr22:22q12.3	pathogenic
NM_002133.3(HMOX1):c.636+9C>G	single nucleotide variant	not provided [RCV003550741]	Chr22:35387185 [GRCh38] Chr22:35783178 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.300C>A (p.Arg100=)	single nucleotide variant	not provided [RCV003871706]	Chr22:35386840 [GRCh38] Chr22:35782833 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.636+19_636+28del	deletion	not provided [RCV003844186]	Chr22:35387186..35387195 [GRCh38] Chr22:35783179..35783188 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.561C>T (p.Asn187=)	single nucleotide variant	not provided [RCV003685255]	Chr22:35387101 [GRCh38] Chr22:35783094 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.585C>T (p.Val195=)	single nucleotide variant	not provided [RCV003719931]	Chr22:35387125 [GRCh38] Chr22:35783118 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.279G>A (p.Leu93=)	single nucleotide variant	not provided [RCV003568557]	Chr22:35386819 [GRCh38] Chr22:35782812 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.637-19T>C	single nucleotide variant	not provided [RCV003541870]	Chr22:35389845 [GRCh38] Chr22:35785838 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.144+11T>C	single nucleotide variant	not provided [RCV003864703]	Chr22:35383237 [GRCh38] Chr22:35779230 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.144+8G>A	single nucleotide variant	not provided [RCV003551096]	Chr22:35383234 [GRCh38] Chr22:35779227 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.414G>A (p.Leu138=)	single nucleotide variant	not provided [RCV003567107]	Chr22:35386954 [GRCh38] Chr22:35782947 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.750G>A (p.Val250=)	single nucleotide variant	not provided [RCV003675375]	Chr22:35393481 [GRCh38] Chr22:35789474 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.737-13T>C	single nucleotide variant	not provided [RCV003711616]	Chr22:35393455 [GRCh38] Chr22:35789448 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.468C>T (p.Asp156=)	single nucleotide variant	not provided [RCV003564433]	Chr22:35387008 [GRCh38] Chr22:35783001 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.345G>A (p.Val115=)	single nucleotide variant	not provided [RCV003551485]	Chr22:35386885 [GRCh38] Chr22:35782878 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.247C>G (p.Leu83Val)	single nucleotide variant	not provided [RCV003732838]	Chr22:35386787 [GRCh38] Chr22:35782780 [GRCh37] Chr22:22q12.3	uncertain significance
NM_002133.3(HMOX1):c.18C>T (p.Pro6=)	single nucleotide variant	not provided [RCV003729794]	Chr22:35381191 [GRCh38] Chr22:35777184 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.813C>G (p.Val271=)	single nucleotide variant	not provided [RCV003863211]	Chr22:35393544 [GRCh38] Chr22:35789537 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.228del (p.Val77fs)	deletion	not provided [RCV003864562]	Chr22:35386768 [GRCh38] Chr22:35782761 [GRCh37] Chr22:22q12.3	pathogenic
NM_002133.3(HMOX1):c.447G>A (p.Lys149=)	single nucleotide variant	not provided [RCV003565128]	Chr22:35386987 [GRCh38] Chr22:35782980 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.23+17G>A	single nucleotide variant	not provided [RCV003563948]	Chr22:35381213 [GRCh38] Chr22:35777206 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.636+10G>A	single nucleotide variant	not provided [RCV003860139]	Chr22:35387186 [GRCh38] Chr22:35783179 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.639C>T (p.Leu213=)	single nucleotide variant	not provided [RCV003704203]	Chr22:35389866 [GRCh38] Chr22:35785859 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.737-19G>A	single nucleotide variant	not provided [RCV002875906]	Chr22:35393449 [GRCh38] Chr22:35789442 [GRCh37] Chr22:22q12.3	likely benign
NM_002133.3(HMOX1):c.636+16C>T	single nucleotide variant	not provided [RCV003723740]	Chr22:35387192 [GRCh38] Chr22:35783185 [GRCh37] Chr22:22q12.3	likely benign

miRNA Target Status

Confirmed Target Of

miRNA Gene	Mature miRNA	Method Name	Result Type	Data Type	Support Type	PMID
MIR122	hsa-miR-122-5p	Mirtarbase	external_info	Western blot;qRT-PCR	Functional MTI	20633528
MIR122	hsa-miR-122-5p	Tarbase	external_info	qPCR	POSITIVE

Predicted Target Of

	Summary Value
Count of predictions:	1638
Count of miRNA genes:	827
Interacting mature miRNAs:	980
Transcripts:	ENST00000216117, ENST00000412893, ENST00000481190, ENST00000494998
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

Markers in Region

RH27826

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	22	35,789,878 - 35,790,052	UniSTS	GRCh37
Build 36	22	34,119,878 - 34,120,052	RGD	NCBI36
Celera	22	19,592,552 - 19,592,726	RGD
Cytogenetic Map	22	q13.1	UniSTS
HuRef	22	18,750,387 - 18,750,561	UniSTS

HMOX1

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	22	35,782,716 - 35,783,083	UniSTS	GRCh37
Build 36	22	34,112,716 - 34,113,083	RGD	NCBI36
Celera	22	19,585,396 - 19,585,763	RGD
HuRef	22	18,743,233 - 18,743,600	UniSTS

HMOX1_3225

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	22	35,789,539 - 35,790,206	UniSTS	GRCh37
Build 36	22	34,119,539 - 34,120,206	RGD	NCBI36
Celera	22	19,592,213 - 19,592,880	RGD
HuRef	22	18,750,048 - 18,750,715	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

alimentary part of gastrointestinal system

circulatory system

endocrine system

exocrine system

hemolymphoid system

hepatobiliary system

integumental system

musculoskeletal system

nervous system

renal system

reproductive system

respiratory system

sensory system

visual system

adipose tissue

appendage

entire extraembryonic component

High

103

Medium

1633

1986

1288

515

1666

416

3807

1195

1573

379

1165

1340

109

1163

2282

Low

795

977

433

106

132

542

983

2127

277

261

501

Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NG_023030	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_002133	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF051791	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK313120	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY460337	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC001491	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BP288767	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BT019785	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CA306357	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH471095	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CP068256	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CR456505	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CR541945	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CR541968	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	GU187011	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	GU187012	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JF323038	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M23041	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M23042	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	S58267	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X06985	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X14782	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	Z82244	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENST00000216117 ⟹ ENSP00000216117

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	22	35,381,096 - 35,394,207 (+)	Ensembl

RefSeq Acc Id:

ENST00000412893 ⟹ ENSP00000413316

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	22	35,380,361 - 35,387,101 (+)	Ensembl

RefSeq Acc Id:

ENST00000481190

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	22	35,381,093 - 35,394,214 (+)	Ensembl

RefSeq Acc Id:

ENST00000494998

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	22	35,387,040 - 35,390,293 (+)	Ensembl

RefSeq Acc Id:

ENST00000677931 ⟹ ENSP00000502849

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	22	35,381,096 - 35,394,207 (+)	Ensembl

RefSeq Acc Id:

ENST00000678411 ⟹ ENSP00000503526

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	22	35,383,164 - 35,394,212 (+)	Ensembl

RefSeq Acc Id:

ENST00000679074 ⟹ ENSP00000503459

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	22	35,381,096 - 35,394,207 (+)	Ensembl

RefSeq Acc Id:

NM_002133 ⟹ NP_002124

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	22	35,381,096 - 35,394,207 (+)	NCBI
GRCh37	22	35,777,060 - 35,790,207 (+)	ENTREZGENE
Build 36	22	34,107,087 - 34,120,194 (+)	NCBI Archive
HuRef	22	18,737,577 - 18,750,716 (+)	ENTREZGENE
CHM1_1	22	35,735,791 - 35,748,937 (+)	NCBI
T2T-CHM13v2.0	22	35,839,114 - 35,852,226 (+)	NCBI

Sequence:

show sequence

AACGCCTGCCTCCTCTCGAGCGTCCTCAGCGCAGCCGCCGCCCGCGGAGCCAGCACGAACGAGC
CCAGCACCGGCCGGATGGAGCGTCCGCAACCCGACAGCATGCCCCAGGATTTGTCAGAGGCCCT
GAAGGAGGCCACCAAGGAGGTGCACACCCAGGCAGAGAATGCTGAGTTCATGAGGAACTTTCAG
AAGGGCCAGGTGACCCGAGACGGCTTCAAGCTGGTGATGGCCTCCCTGTACCACATCTATGTGG
CCCTGGAGGAGGAGATTGAGCGCAACAAGGAGAGCCCAGTCTTCGCCCCTGTCTACTTCCCAGA
AGAGCTGCACCGCAAGGCTGCCCTGGAGCAGGACCTGGCCTTCTGGTACGGGCCCCGCTGGCAG
GAGGTCATCCCCTACACACCAGCCATGCAGCGCTATGTGAAGCGGCTCCACGAGGTGGGGCGCA
CAGAGCCCGAGCTGCTGGTGGCCCACGCCTACACCCGCTACCTGGGTGACCTGTCTGGGGGCCA
GGTGCTCAAAAAGATTGCCCAGAAAGCCCTGGACCTGCCCAGCTCTGGCGAGGGCCTGGCCTTC
TTCACCTTCCCCAACATTGCCAGTGCCACCAAGTTCAAGCAGCTCTACCGCTCCCGCATGAACT
CCCTGGAGATGACTCCCGCAGTCAGGCAGAGGGTGATAGAAGAGGCCAAGACTGCGTTCCTGCT
CAACATCCAGCTCTTTGAGGAGTTGCAGGAGCTGCTGACCCATGACACCAAGGACCAGAGCCCC
TCACGGGCACCAGGGCTTCGCCAGCGGGCCAGCAACAAAGTGCAAGATTCTGCCCCCGTGGAGA
CTCCCAGAGGGAAGCCCCCACTCAACACCCGCTCCCAGGCTCCGCTTCTCCGATGGGTCCTTAC
ACTCAGCTTTCTGGTGGCGACAGTTGCTGTAGGGCTTTATGCCATGTGAATGCAGGCATGCTGG
CTCCCAGGGCCATGAACTTTGTCCGGTGGAAGGCCTTCTTTCTAGAGAGGGAATTCTCTTGGCT
GGCTTCCTTACCGTGGGCACTGAAGGCTTTCAGGGCCTCCAGCCCTCTCACTGTGTCCCTCTCT
CTGGAAAGGAGGAAGGAGCCTATGGCATCTTCCCCAACGAAAAGCACATCCAGGCAATGGCCTA
AACTTCAGAGGGGGCGAAGGGATCAGCCCTGCCCTTCAGCATCCTCAGTTCCTGCAGCAGAGCC
TGGAAGACACCCTAATGTGGCAGCTGTCTCAAACCTCCAAAAGCCCTGAGTTTCAAGTATCCTT
GTTGACACGGCCATGACCACTTTCCCCGTGGGCCATGGCAATTTTTACACAAACCTGAAAAGAT
GTTGTGTCTTGTGTTTTTGTCTTATTTTTGTTGGAGCCACTCTGTTCCTGGCTCAGCCTCAAAT
GCAGTATTTTTGTTGTGTTCTGTTGTTTTTATAGCAGGGTTGGGGTGGTTTTTGAGCCATGCGT
GGGTGGGGAGGGAGGTGTTTAACGGCACTGTGGCCTTGGTCTAACTTTTGTGTGAAATAATAAA
CAACATTGTCTGATAGTA

hide sequence

Protein Sequences


Protein RefSeqs	NP_002124	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA50403	(Get FASTA)	NCBI Sequence Viewer
	AAH01491	(Get FASTA)	NCBI Sequence Viewer
	AAR23262	(Get FASTA)	NCBI Sequence Viewer
	AAV38588	(Get FASTA)	NCBI Sequence Viewer
	ACZ72606	(Get FASTA)	NCBI Sequence Viewer
	ACZ72607	(Get FASTA)	NCBI Sequence Viewer
	ADZ76424	(Get FASTA)	NCBI Sequence Viewer
	BAG35941	(Get FASTA)	NCBI Sequence Viewer
	CAA30045	(Get FASTA)	NCBI Sequence Viewer
	CAA32886	(Get FASTA)	NCBI Sequence Viewer
	CAG30391	(Get FASTA)	NCBI Sequence Viewer
	CAG46743	(Get FASTA)	NCBI Sequence Viewer
	CAG46766	(Get FASTA)	NCBI Sequence Viewer
	EAW60059	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSP00000216117
	ENSP00000216117.8
	ENSP00000413316.1
	ENSP00000502849.1
	ENSP00000503459.1
	ENSP00000503526.1
	ENSP00000503987.1
GenBank Protein	P09601	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_002124 ⟸ NM_002133

- UniProtKB:

P09601 (UniProtKB/Swiss-Prot), Q6FH11 (UniProtKB/TrEMBL), B2R7U4 (UniProtKB/TrEMBL), F2YMD9 (UniProtKB/TrEMBL), Q96DI8 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEE
IERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHEVGRTEPEL
LVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQLYRSRMNSLEMT
PAVRQRVIEEAKTAFLLNIQLFEELQELLTHDTKDQSPSRAPGLRQRASNKVQDSAPVETPRGK
PPLNTRSQAPLLRWVLTLSFLVATVAVGLYAM

hide sequence

RefSeq Acc Id:

ENSP00000216117 ⟸ ENST00000216117

RefSeq Acc Id:

ENSP00000413316 ⟸ ENST00000412893

RefSeq Acc Id:

ENSP00000502849 ⟸ ENST00000677931

RefSeq Acc Id:

ENSP00000503526 ⟸ ENST00000678411

RefSeq Acc Id:

ENSP00000503459 ⟸ ENST00000679074

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P09601-F1-model_v2	AlphaFold	P09601	1-288	view protein structure

Promoters

RGD ID:

6800023

Promoter ID:

HG_KWN:42547

Type:

CpG-Island

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

HeLa_S3, K562, Lymphoblastoid, NB4

Transcripts:

OTTHUMT00000320657, OTTHUMT00000320658, OTTHUMT00000321533

Position:

Human Assembly	Chr	Position (strand)	Source
Build 36	22	34,106,864 - 34,107,364 (+)	MPROMDB

RGD ID:

6851704

Promoter ID:

EP73654

Type:

multiple initiation site

Name:

HS_HMOX1

Description:

Heme oxygenase (decycling) 1.

SO ACC ID:

SO:0000170

Source:

EPD (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

NEDO full length human cDNA sequencing project.; Oligo-capping

Position:

Human Assembly	Chr	Position (strand)	Source
Build 36	22	34,107,089 - 34,107,149	EPD

RGD ID:

6800024

Promoter ID:

HG_KWN:42548

Type:

Non-CpG

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

Lymphoblastoid

Transcripts:

OTTHUMT00000320660

Position:

Human Assembly	Chr	Position (strand)	Source
Build 36	22	34,112,501 - 34,113,001 (+)	MPROMDB

RGD ID:

13603854

Promoter ID:

EPDNEW_H28111

Type:

initiation region

Name:

HMOX1_1

Description:

heme oxygenase 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	22	35,381,096 - 35,381,156	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	HGNC:5013	AgrOrtholog
COSMIC	HMOX1	COSMIC
Ensembl Genes	ENSG00000100292	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Transcript	ENST00000216117	ENTREZGENE
	ENST00000216117.9	UniProtKB/Swiss-Prot
	ENST00000412893.5	UniProtKB/TrEMBL
	ENST00000481190.2	UniProtKB/TrEMBL
	ENST00000677931.1	UniProtKB/TrEMBL
	ENST00000678411.1	UniProtKB/TrEMBL
	ENST00000679074.1	UniProtKB/TrEMBL
Gene3D-CATH	1.20.910.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
GTEx	ENSG00000100292	GTEx
HGNC ID	HGNC:5013	ENTREZGENE
Human Proteome Map	HMOX1	Human Proteome Map
InterPro	Haem_Oase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Haem_Oase-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Haem_Oase-like_multi-hlx	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Haem_oxygenase_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	hsa:3162	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
NCBI Gene	3162	ENTREZGENE
OMIM	141250	OMIM
PANTHER	HEME OXYGENASE 1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR10720	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Heme_oxygenase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PharmGKB	PA29341	PharmGKB
PIRSF	Haem_Oase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PRINTS	HAEMOXYGNASE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	HEME_OXYGENASE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF48613	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A7I2V277_HUMAN	UniProtKB/TrEMBL
	A0A7I2V3I1_HUMAN	UniProtKB/TrEMBL
	A0A7I2V3M0_HUMAN	UniProtKB/TrEMBL
	A0A7I2YQL9_HUMAN	UniProtKB/TrEMBL
	B1AHA8_HUMAN	UniProtKB/TrEMBL
	B2R7U4	ENTREZGENE, UniProtKB/TrEMBL
	D2K7W4_HUMAN	UniProtKB/TrEMBL
	F2YMD9	ENTREZGENE, UniProtKB/TrEMBL
	HMOX1_HUMAN	UniProtKB/Swiss-Prot, ENTREZGENE
	Q6FH11	ENTREZGENE, UniProtKB/TrEMBL
	Q96DI8	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-04-08	HMOX1	heme oxygenase 1	HMOX1	heme oxygenase (decycling) 1	Symbol and/or name change	5135510	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

Manual Human Phenotype Annotations - RGD

Imported Human Phenotype Annotations - HPO

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

Manual Human Phenotype Annotations - RGD

Imported Human Phenotype Annotations - HPO