Hpd (4-hydroxyphenylpyruvate dioxygenase)

Gene: Hpd (4-hydroxyphenylpyruvate dioxygenase) Rattus norvegicus

Analyze

Symbol:

Hpd

Name:

4-hydroxyphenylpyruvate dioxygenase

RGD ID:

61974

Description:

Enables 4-hydroxyphenylpyruvate dioxygenase activity; iron ion binding activity; and protein homodimerization activity. Involved in tyrosine catabolic process. Located in Golgi membrane and endoplasmic reticulum membrane. Human ortholog(s) of this gene implicated in hawkinsinuria and tyrosinemia type III. Orthologous to human HPD (4-hydroxyphenylpyruvate dioxygenase); PARTICIPATES IN alkaptonuria pathway; disulfiram pharmacodynamics pathway; dopamine beta-hydroxylase deficiency pathway; INTERACTS WITH 17alpha-ethynylestradiol; 17beta-estradiol; 2,2',4,4',5,5'-hexachlorobiphenyl.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

4-hydroxyphenylpyruvic acid dioxygenase; 4-hydroxyphenylpyruvic acid oxidase; 4HPPD; f Alloantigen; f protein; HPPDase

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	HPD (4-hydroxyphenylpyruvate dioxygenase)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Hpd (4-hydroxyphenylpyruvic acid dioxygenase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Hpd (4-hydroxyphenylpyruvate dioxygenase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	HPD (4-hydroxyphenylpyruvate dioxygenase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	HPD (4-hydroxyphenylpyruvate dioxygenase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	HPD (4-hydroxyphenylpyruvate dioxygenase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	HPD (4-hydroxyphenylpyruvate dioxygenase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Hpd (4-hydroxyphenylpyruvate dioxygenase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Hpd (4-hydroxyphenylpyruvic acid dioxygenase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	HPD (4-hydroxyphenylpyruvate dioxygenase)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	hpdb (4-hydroxyphenylpyruvate dioxygenase b)	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	hpda (4-hydroxyphenylpyruvate dioxygenase a)	Alliance	DIOPT (InParanoid\|OrthoInspector\|SonicParanoid)
Caenorhabditis elegans (roundworm):	hpd-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Hpd	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	hpd	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	39,042,246 - 39,053,596 (+)	NCBI		GRCr8
mRatBN7.2	12	33,381,397 - 33,392,750 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	33,381,231 - 33,392,766 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	12	34,560,040 - 34,571,400 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	35,171,415 - 35,182,771 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	34,223,280 - 34,234,640 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	38,828,606 - 38,839,956 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	38,828,444 - 38,839,969 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	12	40,729,052 - 40,740,668 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	12	34,548,320 - 34,558,371 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	12	34,411,707 - 34,421,759 (+)	NCBI
Celera	12	35,063,212 - 35,073,637 (+)	NCBI		Celera
Cytogenetic Map	12	q16	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Chemical and Drug Induced Liver Injury (ISO)

Developmental Disabilities (ISO)

genetic disease (ISO)

hawkinsinuria (ISO)

tyrosinemia (ISO)

tyrosinemia type III (ISO,ISS)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

17alpha-ethynylestradiol (EXP)

17beta-estradiol (EXP,ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (EXP)

2,2',5,5'-tetrachlorobiphenyl (EXP)

2,3,7,8-tetrabromodibenzodioxine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

3,3',4,4',5-pentachlorobiphenyl (EXP)

3H-1,2-dithiole-3-thione (EXP)

4,4'-diaminodiphenylmethane (ISO)

acetamide (EXP)

acrylamide (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

benzo[a]pyrene (ISO)

benzo[e]pyrene (ISO)

bisphenol A (EXP,ISO)

butanal (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

caffeine (ISO)

CGP 52608 (ISO)

chlorpyrifos (ISO)

choline (EXP)

ciguatoxin CTX1B (ISO)

cisplatin (ISO)

cobalt dichloride (EXP)

cocaine (EXP)

Cuprizon (EXP)

cyclosporin A (ISO)

decabromodiphenyl ether (EXP)

diquat (ISO)

doramapimod (EXP)

folic acid (EXP,ISO)

furan (EXP)

gamma-hexachlorocyclohexane (EXP)

gentamycin (EXP)

glycidol (EXP)

L-methionine (EXP)

lipopolysaccharide (ISO)

methapyrilene (ISO)

methidathion (ISO)

N-nitrosodiethylamine (EXP,ISO)

N-nitrosodimethylamine (ISO)

N-nitrosomorpholine (EXP)

nitisinone (ISO)

nitrofen (EXP)

O-methyleugenol (ISO)

paracetamol (EXP,ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

phenobarbital (EXP)

pirinixic acid (EXP,ISO)

potassium dichromate (ISO)

propanal (ISO)

resveratrol (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

succimer (ISO)

tamibarotene (ISO)

tetrachloroethene (ISO)

tetrachloromethane (ISO)

thioacetamide (EXP)

tremolite asbestos (ISO)

Triptolide (ISO)

triptonide (ISO)

tris(2-butoxyethyl) phosphate (ISO)

valproic acid (ISO)

vancomycin (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

aromatic amino acid metabolic process (IEA)

L-phenylalanine catabolic process (IEA)

tyrosine catabolic process (IBA,IDA,ISO,TAS)

Cellular Component

endoplasmic reticulum (IDA)

endoplasmic reticulum membrane (IBA,IDA,IEA)

Golgi apparatus (IDA)

Golgi membrane (IBA,IDA,IEA)

Molecular Function

4-hydroxyphenylpyruvate dioxygenase activity (IBA,IDA,IEA,ISO,TAS)

iron ion binding (IDA)

metal ion binding (IEA)

protein binding (ISO)

protein homodimerization activity (IDA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

alkaptonuria pathway (ISO)

disulfiram pharmacodynamics pathway (ISO)

dopamine beta-hydroxylase deficiency pathway (ISO)

hawkinsinuria pathway (ISO)

phenylalanine metabolic pathway (IEA)

phenylketonuria pathway (ISO)

tyrosine metabolic pathway (IEA,ISO)

tyrosinemia type I pathway (ISO)

tyrosinemia type II pathway (ISO)

tyrosinemia type III pathway (ISO)

ubiquinone biosynthetic pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Molecular cloning of the liver-specific rat F antigen.	Gershwin ME, etal., J Immunol 1987 Dec 1;139(11):3828-33.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	KEGG: Kyoto Encyclopedia of Genes and Genomes	KEGG
5.	The C-terminal of rat 4-hydroxyphenylpyruvate dioxygenase is indispensable for enzyme activity.	Lee MH, etal., FEBS Lett. 1996 Sep 16;393(2-3):269-72.
6.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.	Tissue distribution, intracellular localization and proteolytic processing of rat 4-hydroxyphenylpyruvate dioxygenase.	Neve S, etal., Cell Biol Int 2003;27(8):611-24.
8.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
9.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
10.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
11.	GOA pipeline	RGD automated data pipeline
12.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
13.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
14.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
15.	Structural basis for herbicidal inhibitor selectivity revealed by comparison of crystal structures of plant and mammalian 4-hydroxyphenylpyruvate dioxygenases.	Yang C, etal., Biochemistry. 2004 Aug 17;43(32):10414-23. doi: 10.1021/bi049323o.

Additional References at PubMed

PMID:10942115	PMID:15489334	PMID:19056867	PMID:20677779	PMID:22872058	PMID:23376485

Genomics

Comparative Map Data

Hpd
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	39,042,246 - 39,053,596 (+)	NCBI		GRCr8
mRatBN7.2	12	33,381,397 - 33,392,750 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	33,381,231 - 33,392,766 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	12	34,560,040 - 34,571,400 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	35,171,415 - 35,182,771 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	34,223,280 - 34,234,640 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	38,828,606 - 38,839,956 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	38,828,444 - 38,839,969 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	12	40,729,052 - 40,740,668 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	12	34,548,320 - 34,558,371 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	12	34,411,707 - 34,421,759 (+)	NCBI
Celera	12	35,063,212 - 35,073,637 (+)	NCBI		Celera
Cytogenetic Map	12	q16	NCBI

HPD
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	12	121,839,527 - 121,888,611 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	12	121,839,527 - 121,863,596 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	12	122,277,433 - 122,326,517 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	120,761,816 - 120,781,152 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	12	120,740,154 - 120,759,489	NCBI
Celera	12	121,913,690 - 121,962,455 (-)	NCBI		Celera
Cytogenetic Map	12	q24.31	NCBI
HuRef	12	119,289,545 - 119,337,791 (-)	NCBI		HuRef
CHM1_1	12	122,245,145 - 122,294,160 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	12	121,836,201 - 121,884,910 (-)	NCBI		T2T-CHM13v2.0

Hpd
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	123,309,870 - 123,320,786 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	123,309,870 - 123,320,790 (-)	Ensembl		GRCm39 Ensembl
GRCm38	5	123,171,807 - 123,182,723 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	123,171,807 - 123,182,727 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	5	123,621,816 - 123,632,695 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	5	123,432,425 - 123,443,305 (-)	NCBI		MGSCv36	mm8
Celera	5	120,267,078 - 120,277,955 (-)	NCBI		Celera
Cytogenetic Map	5	F	NCBI
cM Map	5	62.82	NCBI

Hpd
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955482	6,586,975 - 6,595,034 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955482	6,586,975 - 6,595,034 (+)	NCBI	ChiLan1.0	ChiLan1.0

HPD
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	10	129,927,636 - 129,977,265 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	12	129,924,008 - 129,973,639 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	12	119,442,893 - 119,462,171 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	12	122,813,141 - 122,859,815 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	12	122,813,141 - 122,831,701 (-)	Ensembl	panpan1.1		panPan2

HPD
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	26	7,430,891 - 7,440,643 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	26	7,430,933 - 7,440,611 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	26	7,590,591 - 7,600,332 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	26	7,682,482 - 7,692,423 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	26	7,682,506 - 7,692,441 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	26	7,614,559 - 7,624,300 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	26	7,704,925 - 7,714,660 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	26	7,660,824 - 7,670,565 (+)	NCBI		UU_Cfam_GSD_1.0

HPD
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	30,845,613 - 30,857,667 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	14	30,845,608 - 30,857,658 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	32,650,996 - 32,662,746 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

HPD
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	11	117,203,844 - 117,246,249 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	11	117,203,307 - 117,224,038 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666136	30,819 - 51,286 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Hpd
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624747	22,209,009 - 22,217,841 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624747	22,209,191 - 22,217,665 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Hpd
63 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	111
Count of miRNA genes:	83
Interacting mature miRNAs:	85
Transcripts:	ENSRNOT00000001809
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1598855	Bp294	Blood pressure QTL 294	3.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	1	34851688	Rat
7411660	Foco28	Food consumption QTL 28	10.9	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
9590086	Insglur6	Insulin/glucose ratio QTL 6	18.97	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	12	1	42110980	Rat
8694179	Bw150	Body weight QTL 150	2.9	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	12	1	42110980	Rat
7411586	Foco5	Food consumption QTL 5	5.4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
7411595	Foco9	Food consumption QTL 9	4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
7411545	Bw128	Body weight QTL 128	5.2	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	12	1	42110980	Rat
9590147	Scort7	Serum corticosterone level QTL 7	13.61	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	12	1	42110980	Rat
2303575	Insul14	Insulin level QTL 14	4		blood insulin amount (VT:0001560)	blood insulin level (CMO:0000349)	12	1	42450532	Rat
737979	Pia22	Pristane induced arthritis QTL 22	53.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	1	44465750	Rat
634351	Apr5	Acute phase response QTL 5	6.7		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	12	1	44503507	Rat
2302042	Pia38	Pristane induced arthritis QTL 38	3.5	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	12	1	44503507	Rat
634350	Apr4	Acute phase response QTL 4	6		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	1172005	46172005	Rat
8552918	Pigfal7	Plasma insulin-like growth factor 1 level QTL 7			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564495	46669029	Rat
7411547	Bw129	Body weight QTL 129		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	5564495	46669029	Rat
7411597	Foco10	Food consumption QTL 10		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
7411641	Foco19	Food consumption QTL 19	27.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
8552964	Pigfal17	Plasma insulin-like growth factor 1 level QTL 17	3.5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564495	46669029	Rat
7411588	Foco6	Food consumption QTL 6		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
8552912	Pigfal6	Plasma insulin-like growth factor 1 level QTL 6	5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564498	46669029	Rat
10059594	Kidm46	Kidney mass QTL 46	3.79	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	12	6107579	46669029	Rat
1302792	Scl21	Serum cholesterol level QTL 21	3.8	0.0011	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	12	7196730	46669029	Rat
1549829	Scl48	Serum cholesterol level QTL 48	5		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	12	9603277	46669029	Rat
2293699	Bss49	Bone structure and strength QTL 49	5.61	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	12	10474137	46669029	Rat
2300186	Bmd59	Bone mineral density QTL 59	7.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	12	10474137	46669029	Rat
1331761	Bp218	Blood pressure QTL 218	2.973		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	11073825	45055165	Rat
61404	Bw120	Body weight QTL 120	5.1		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	12	12351619	46669029	Rat
1641928	Alcrsp5	Alcohol response QTL 5			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	12	12812385	46669029	Rat
2303569	Gluco44	Glucose level QTL 44	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	12812385	46669029	Rat
1549902	Bp269	Blood pressure QTL 269			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	13182736	46669029	Rat
1549912	Bp268	Blood pressure QTL 268			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	13182736	46669029	Rat
2302060	Pia37	Pristane induced arthritis QTL 37	6.1	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	12	13198157	46669029	Rat
61421	Cia12	Collagen induced arthritis QTL 12	4.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	13635523	35682913	Rat
631543	Bp83	Blood pressure QTL 83	5.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	15550826	38478808	Rat
631560	Apr1	Acute phase response QTL 1	6.1		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	19144362	46669029	Rat
737822	Alc10	Alcohol consumption QTL 10	2.2		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	12	19610870	40218516	Rat
5684888	Pia42	Pristane induced arthritis QTL 42			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	19610870	42828880	Rat
61324	Eae5	Experimental allergic encephalomyelitis QTL 5	14		nervous system integrity trait (VT:0010566)	percentage of study population developing relapsing-remitting experimental autoimmune encephalomyelitis during a period of time (CMO:0001402)	12	19610870	46669029	Rat
1298081	Cia25	Collagen induced arthritis QTL 25	4.7		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	19610889	35682913	Rat
70213	Niddm27	Non-insulin dependent diabetes mellitus QTL 27	3.72		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	19835789	38193007	Rat
7411643	Foco20	Food consumption QTL 20		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	20328819	46669029	Rat
70169	Eae13	Experimental allergic encephalomyelitis QTL 13		0.032	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	12	24139202	36638073	Rat
1556747	Calcic1	Intracellular calcium level QTL 1		3.6	platelet calcium amount (VT:0010500)	platelet intracellular calcium level (CMO:0000922)	12	28064433	40130419	Rat
1300175	Cm5	Cardiac mass QTL 5	3.78		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	12	28064433	45899022	Rat
1600386	Calcic2	Intracellular calcium level QTL 2		0.001	platelet physiology trait (VT:0005464)	platelet intracellular calcium level (CMO:0000922)	12	28064433	46669029	Rat
1331787	Rf41	Renal function QTL 41	2.998		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	12	28064557	40218380	Rat
631829	Alc6	Alcohol consumption QTL 6	4.7		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	12	28607526	37691617	Rat
1300162	Bp188	Blood pressure QTL 188	3.19		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	32103174	45899022	Rat

Markers in Region

RH141029

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	33,392,472 - 33,392,665 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	38,839,679 - 38,839,871	NCBI	Rnor6.0
Rnor_5.0	12	40,740,391 - 40,740,583	UniSTS	Rnor5.0
RGSC_v3.4	12	34,558,094 - 34,558,286	UniSTS	RGSC3.4
Celera	12	35,073,360 - 35,073,552	UniSTS
Cytogenetic Map	12	q16	UniSTS

GDB:455130

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	33,386,550 - 33,386,634 (+)	MAPPER	mRatBN7.2
mRatBN7.2	4	175,792,841 - 175,793,184 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	177,068,161 - 177,068,503	NCBI	Rnor6.0
Rnor_6.0	12	38,833,759 - 38,833,842	NCBI	Rnor6.0
Rnor_5.0	12	40,734,471 - 40,734,554	UniSTS	Rnor5.0
Rnor_5.0	4	241,276,967 - 241,277,309	UniSTS	Rnor5.0
RGSC_v3.4	4	180,725,277 - 180,725,619	UniSTS	RGSC3.4
RGSC_v3.4	12	34,552,174 - 34,552,257	UniSTS	RGSC3.4
Celera	12	35,067,439 - 35,067,522	UniSTS
Celera	4	164,323,553 - 164,323,938	UniSTS
Cytogenetic Map	12	q16	UniSTS
Cytogenetic Map	4	q44	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High			22	22		22				4
Medium		2	21	19		19				25	7	1
Low		23	14		17		8	9	23	6	26	7	8
Below cutoff	3	14			2			2	37		6	3

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_017233	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC123330	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF082834	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC081819	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473973	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ209393	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ209489	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ210905	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ210917	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ218378	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ218727	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ218745	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219147	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219696	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000012	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M18405	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000001809 ⟹ ENSRNOP00000001809

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	33,381,231 - 33,392,766 (+)	Ensembl
Rnor_6.0 Ensembl	12	38,828,444 - 38,839,969 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000120179 ⟹ ENSRNOP00000085869

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	33,381,389 - 33,392,766 (+)	Ensembl

RefSeq Acc Id:

NM_017233 ⟹ NP_058929

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	39,042,246 - 39,053,596 (+)	NCBI
mRatBN7.2	12	33,381,397 - 33,392,750 (+)	NCBI
Rnor_6.0	12	38,828,606 - 38,839,956 (+)	NCBI
Rnor_5.0	12	40,729,052 - 40,740,668 (+)	NCBI
RGSC_v3.4	12	34,548,320 - 34,558,371 (+)	RGD
Celera	12	35,063,212 - 35,073,637 (+)	RGD

Sequence:

show sequence

TCCAGTACTCTGGTAGAGGTCTGACCACCATCAACCATGACAACCTACAGCAACAAAGGACCAA
AGCCTGAGAGAGGCCGGTTCCTCCATTTCCACTCTGTGACCTTCTGGGTTGGCAACGCCAAGCA
GGCTGCCTCCTTCTATTGCAACAAGATGGGCTTCGAACCGCTGGCCTACAAGGGCCTGGAGACG
GGCTCCCGGGAGGTGGTCAGTCATGTCATCAAGCAAGGGAAAATTGTGTTTGTTCTCTGCTCTG
CTCTCAATCCCTGGAACAAAGAGATGGGTGACCACCTGGTGAAGCATGGTGATGGCGTAAAGGA
CATCGCATTCGAGGTGGAAGACTGTGAACACATTGTGCAGAAAGCCCGAGAACGGGGCGCTAAA
ATTGTACGGGAGCCATGGGTGGAGGAAGACAAATTCGGGAAGGTGAAGTTCGCTGTGCTGCAGA
CGTATGGAGATACCACGCACACCCTGGTGGAGAAGATCAACTACACCGGTCGTTTCTTACCTGG
ATTCGAGGCCCCAACATACAAGGACACCCTACTTCCAAAACTACCCAGCTGTAACCTGGAGATC
ATCGACCATATTGTAGGCAACCAGCCCGACCAGGAAATGGAGTCTGCCTCAGAATGGTACCTGA
AAAACCTGCAGTTCCACCGGTTCTGGTCTGTAGACGACACACAGGTGCACACGGAGTATAGCTC
TCTGCGCTCCATCGTGGTGGCCAACTATGAGGAGTCCATCAAAATGCCCATTAATGAACCGGCC
CCGGGCAGGAAGAAGTCTCAGATCCAGGAATATGTGGACTATAATGGGGGTGCTGGGGTCCAGC
ACATCGCTCTCAGGACCGAAGACATCATCACAACGATCCGCCACTTGAGGGAACGAGGCATGGA
GTTCTTGGCTGTCCCGTCTTCTTACTACAGACTGCTTCGGGAGAATCTCAAGACCTCCAAGATC
CAAGTGAAGGAGAACATGGATGTCTTGGAGGAGCTAAAAATCCTGGTAGACTACGATGAGAAAG
GCTACCTCCTACAGATCTTCACCAAGCCCATGCAGGACCGGCCCACGCTCTTCTTGGAAGTCAT
CCAACGCCACAACCACCAGGGCTTTGGAGCAGGTAACTTCAACTCTCTGTTCAAAGCTTTCGAA
GAGGAGCAAGCCCTACGGGGTAACCTCACTGACCTGGAGACCAACGGTGTGAGGTCTGGAATGT
AAGCTCCACCCACACCCAGACCGCGCAAGGCGCTGGACAAGTCAATCAGCTCCAACTGGCTGAA
AGGCTGGACCTCAGGGCTCCACCCACACCATGGCCACGCCCCCTCTACGGCAAGGCTTCTCCTG
ATCCGTTTCGAGTAAAC

hide sequence

Protein Sequences


Protein RefSeqs	NP_058929	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA40740	(Get FASTA)	NCBI Sequence Viewer
	AAC32387	(Get FASTA)	NCBI Sequence Viewer
	AAH81819	(Get FASTA)	NCBI Sequence Viewer
	EDM13651	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000001809.5
	ENSRNOP00000085869
	ENSRNOP00000085869.1
	ENSRNOP00055021625
	ENSRNOP00060003848
	ENSRNOP00065007162
GenBank Protein	P32755	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_058929 ⟸ NM_017233

- UniProtKB:

O88655 (UniProtKB/Swiss-Prot), P32755 (UniProtKB/Swiss-Prot), A0A8L2Q085 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MTTYSNKGPKPERGRFLHFHSVTFWVGNAKQAASFYCNKMGFEPLAYKGLETGSREVVSHVIKQ
GKIVFVLCSALNPWNKEMGDHLVKHGDGVKDIAFEVEDCEHIVQKARERGAKIVREPWVEEDKF
GKVKFAVLQTYGDTTHTLVEKINYTGRFLPGFEAPTYKDTLLPKLPSCNLEIIDHIVGNQPDQE
MESASEWYLKNLQFHRFWSVDDTQVHTEYSSLRSIVVANYEESIKMPINEPAPGRKKSQIQEYV
DYNGGAGVQHIALRTEDIITTIRHLRERGMEFLAVPSSYYRLLRENLKTSKIQVKENMDVLEEL
KILVDYDEKGYLLQIFTKPMQDRPTLFLEVIQRHNHQGFGAGNFNSLFKAFEEEQALRGNLTDL
ETNGVRSGM

hide sequence

RefSeq Acc Id:

ENSRNOP00000001809 ⟸ ENSRNOT00000001809

RefSeq Acc Id:

ENSRNOP00000085869 ⟸ ENSRNOT00000120179

Protein Domains

VOC

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P32755-F1-model_v2	AlphaFold	P32755	1-393	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13698633

Promoter ID:

EPDNEW_R9157

Type:

multiple initiation site

Name:

Hpd_1

Description:

4-hydroxyphenylpyruvate dioxygenase

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	12	38,828,598 - 38,828,658	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:61974	AgrOrtholog
BioCyc Gene	G2FUF-19291	BioCyc
BioCyc Pathway	PWY-6318 [L-phenylalanine degradation IV (mammalian, via side chain)]	BioCyc
	TYRFUMCAT-PWY [L-tyrosine degradation I]	BioCyc
BioCyc Pathway Image	PWY-6318	BioCyc
	TYRFUMCAT-PWY	BioCyc
Ensembl Genes	ENSRNOG00000001338	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ENSRNOG00055015643	UniProtKB/Swiss-Prot
	ENSRNOG00060003174	UniProtKB/Swiss-Prot
	ENSRNOG00065006407	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000001809.7	UniProtKB/TrEMBL
	ENSRNOT00000120179	ENTREZGENE
	ENSRNOT00000120179.1	UniProtKB/Swiss-Prot
	ENSRNOT00055026676	UniProtKB/Swiss-Prot
	ENSRNOT00060005212	UniProtKB/Swiss-Prot
	ENSRNOT00065009858	UniProtKB/Swiss-Prot
Gene3D-CATH	3.10.180.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7107086	IMAGE-MGC_LOAD
InterPro	4OHPhenylPyrv_dOase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	4OHPhenylPyrv_dOase_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	4OHPhenylPyrv_dOase_N	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Glyas_Bleomycin-R_OHBP_Dase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Glyas_Fos-R_dOase_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	VOC	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:29531	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:93530	IMAGE-MGC_LOAD
NCBI Gene	29531	ENTREZGENE
PANTHER	4-HYDROXYPHENYLPYRUVATE DIOXYGENASE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR11959	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Glyoxalase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Hpd	PhenoGen
PIRSF	HPP_dOase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	VOC	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000001338	RatGTEx
	ENSRNOG00055015643	RatGTEx
	ENSRNOG00060003174	RatGTEx
	ENSRNOG00065006407	RatGTEx
Superfamily-SCOP	SSF54593	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8L2Q085	ENTREZGENE, UniProtKB/TrEMBL
	A6J162_RAT	UniProtKB/TrEMBL
	HPPD_RAT	UniProtKB/Swiss-Prot
	O88655	ENTREZGENE
	P32755	ENTREZGENE
UniProt Secondary	O88655	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-09-24	Hpd	4-hydroxyphenylpyruvate dioxygenase	Hpd	4-hydroxyphenylpyruvic acid dioxygenase	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-06-10	Hpd	4-hydroxyphenylpyruvic acid dioxygenase			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_cellular_localization	localized to membranes of the endoplasmic reticulum and Golgi apparatus	632936
gene_expression	expressed in liver
gene_expression	expressed in liver, kidney, and in neurons of various regions of the brain	632936
gene_product	43kDa

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

BioCyc Pathways

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

BioCyc Pathways