Symbol:
KRT8
Name:
keratin 8
RGD ID:
735536
HGNC Page
HGNC:6446
Description:
Enables scaffold protein binding activity. Predicted to be involved in response to hydrostatic pressure and sarcomere organization. Predicted to act upstream of or within several processes, including cell differentiation involved in embryonic placenta development; cell surface receptor signaling pathway; and hepatocyte apoptotic process. Located in cytoplasm and keratin filament. Implicated in liver cirrhosis. Biomarker of liver cirrhosis.
Type:
protein-coding
RefSeq Status:
REVIEWED
Previously known as:
CARD2; CK-8; CK8; CYK8; cytokeratin 8; cytokeratin-8; K2C8; K8; keratin 8, type II; keratin, type II cytoskeletal 8; keratin-8; KO; type-II keratin Kb8
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Mus musculus (house mouse):
Krt8 (keratin 8) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Krt8 (keratin 8) RGD
RGD
Chinchilla lanigera (long-tailed chinchilla):
Krt8 (keratin 8) NCBI
Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):
KRT8 (keratin 8) NCBI
Ortholog
Canis lupus familiaris (dog):
KRT8 (keratin 8) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Krt8 (keratin 8) NCBI
Ortholog
Sus scrofa (pig):
KRT8 (keratin 8) HGNC
EggNOG, Ensembl, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Chlorocebus sabaeus (green monkey):
KRT8 (keratin 8) NCBI
Ortholog
Heterocephalus glaber (naked mole-rat):
Krt8 (keratin 8) NCBI
Ortholog
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Krt8 (keratin 8)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Krt8 (keratin 8)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
krt5 (keratin 5)
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Danio rerio (zebrafish):
krt4 (keratin 4)
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Danio rerio (zebrafish):
krt8 (keratin 8)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid|ZFIN)
Danio rerio (zebrafish):
zgc:158846
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER|PhylomeDB)
Caenorhabditis elegans (roundworm):
ifd-2
Alliance
DIOPT (Ensembl Compara|OMA)
Xenopus laevis (African clawed frog):
krt8.1.S
Alliance
DIOPT (Xenbase)
Xenopus laevis (African clawed frog):
krt8.1.L
Alliance
DIOPT (Xenbase)
Xenopus laevis (African clawed frog):
krt8.2.S
Alliance
DIOPT (Xenbase)
Xenopus laevis (African clawed frog):
krt8.2.L
Alliance
DIOPT (Xenbase)
Related Pseudogenes:
KRT8P1
KRT8P10
KRT8P11
KRT8P12
KRT8P13
KRT8P14
KRT8P15
KRT8P16
KRT8P17
KRT8P18
KRT8P19
KRT8P2
KRT8P20
KRT8P21
KRT8P22
KRT8P23
KRT8P24
KRT8P25
KRT8P26
KRT8P27
KRT8P28
KRT8P29
KRT8P3
KRT8P30
KRT8P31
KRT8P32
KRT8P33
KRT8P34
KRT8P35
KRT8P36
KRT8P37
KRT8P38
KRT8P39
KRT8P4
KRT8P40
KRT8P41
KRT8P42
KRT8P43
KRT8P44
KRT8P45
KRT8P46
KRT8P47
KRT8P48
KRT8P49
KRT8P5
KRT8P50
KRT8P51
KRT8P52
KRT8P6
KRT8P7
KRT8P8
KRT8P9
KRT90P
Allele / Splice:
See ClinVar data
Latest Assembly:
GRCh38 - Human Genome Assembly GRCh38
Position:
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 12 52,897,191 - 52,949,860 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 12 52,897,187 - 52,949,954 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 12 53,290,975 - 53,343,644 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 12 51,577,238 - 51,585,127 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 12 51,577,241 - 51,585,089 NCBI Celera 12 52,937,521 - 52,945,403 (-) NCBI Celera Cytogenetic Map 12 q13.13 NCBI HuRef 12 50,334,669 - 50,387,466 (-) NCBI HuRef CHM1_1 12 53,257,746 - 53,310,407 (-) NCBI CHM1_1 T2T-CHM13v2.0 12 52,861,778 - 52,914,419 (-) NCBI T2T-CHM13v2.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
KRT8 Human (+)-schisandrin B multiple interactions ISO Krt8 (Rattus norvegicus) 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of KRT8 mRNA] CTD PMID:31150632 KRT8 Human (-)-ephedrine multiple interactions EXP 6480464 Ephedrine inhibits the reaction [Bleomycin results in decreased expression of KRT8 mRNA] and Ephedrine inhibits the reaction [Bleomycin results in decreased expression of KRT8 protein] CTD PMID:37778983 KRT8 Human (1->4)-beta-D-glucan multiple interactions ISO Krt8 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of KRT8 mRNA CTD PMID:36331819 KRT8 Human 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane increases expression ISO Krt8 (Mus musculus) 6480464 o and p'-DDT results in increased expression of KRT8 mRNA CTD PMID:24096037 KRT8 Human 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane increases expression ISO Krt8 (Rattus norvegicus) 6480464 o and p'-DDT results in increased expression of KRT8 mRNA CTD PMID:24096037 KRT8 Human 1,2-dichloroethane increases expression ISO Krt8 (Mus musculus) 6480464 ethylene dichloride results in increased expression of KRT8 mRNA CTD PMID:28960355 KRT8 Human 1,2-dimethylhydrazine multiple interactions ISO Krt8 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of KRT8 mRNA CTD PMID:22206623 KRT8 Human 1-aminobenzotriazole multiple interactions ISO Krt8 (Mus musculus) 6480464 1-aminobenzotriazole affects the reaction [propylene dichloride results in decreased expression of KRT8 protein] CTD PMID:32435916 KRT8 Human 1-naphthyl isothiocyanate increases expression ISO Krt8 (Rattus norvegicus) 6480464 1-Naphthylisothiocyanate results in increased expression of KRT8 mRNA CTD PMID:17522070 more ... KRT8 Human 1-naphthyl isothiocyanate multiple interactions ISO Krt8 (Mus musculus) 6480464 O(2)-vinyl-1-(pyrrolidin-1-yl)diazen-1-ium-1 and 2-diolate inhibits the reaction [1-Naphthylisothiocyanate results in increased expression of KRT8 mRNA] CTD PMID:15913567 KRT8 Human 1-naphthyl isothiocyanate increases expression ISO Krt8 (Mus musculus) 6480464 1-Naphthylisothiocyanate results in increased expression of KRT8 mRNA CTD PMID:15913567 KRT8 Human 17alpha-ethynylestradiol multiple interactions ISO Krt8 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of KRT8 mRNA CTD PMID:17942748 KRT8 Human 17alpha-ethynylestradiol decreases expression ISO Krt8 (Rattus norvegicus) 6480464 Ethinyl Estradiol results in decreased expression of KRT8 mRNA CTD PMID:29097150 and PMID:30387366 KRT8 Human 17alpha-ethynylestradiol increases expression ISO Krt8 (Rattus norvegicus) 6480464 Ethinyl Estradiol results in increased expression of KRT8 mRNA CTD PMID:15576828 more ... KRT8 Human 17alpha-ethynylestradiol increases expression ISO Krt8 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of KRT8 mRNA CTD PMID:17942748 more ... KRT8 Human 17beta-estradiol decreases expression ISO Krt8 (Rattus norvegicus) 6480464 Estradiol results in decreased expression of KRT8 mRNA CTD PMID:17522070 and PMID:32145629 KRT8 Human 17beta-estradiol multiple interactions ISO Krt8 (Rattus norvegicus) 6480464 [bisphenol A co-treated with Estradiol] results in increased expression of KRT8 mRNA CTD PMID:26496021 KRT8 Human 17beta-estradiol increases expression ISO Krt8 (Mus musculus) 6480464 Estradiol results in increased expression of KRT8 mRNA CTD PMID:15289156 more ... KRT8 Human 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of KRT8 mRNA CTD PMID:14605097 KRT8 Human 17beta-estradiol multiple interactions EXP 6480464 [Estradiol co-treated with Bucladesine co-treated with Medroxyprogesterone Acetate] results in decreased expression of KRT8 mRNA more ... CTD PMID:20061804 and PMID:20823114 KRT8 Human 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of KRT8 mRNA CTD PMID:16705744 KRT8 Human 17beta-estradiol 3-benzoate increases methylation ISO Krt8 (Rattus norvegicus) 6480464 estradiol 3-benzoate results in increased methylation of KRT8 promoter CTD PMID:27415467 KRT8 Human 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one increases expression EXP 6480464 Metribolone results in increased expression of KRT8 mRNA and Metribolone results in increased expression of KRT8 protein CTD PMID:17010196 and PMID:17152098 KRT8 Human 17beta-hydroxy-5alpha-androstan-3-one increases expression EXP 6480464 Dihydrotestosterone results in increased expression of KRT8 mRNA CTD PMID:29581250 KRT8 Human 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Krt8 (Rattus norvegicus) 6480464 [Tetrachlorodibenzodioxin binds to and results in increased activity of AHR protein] which results in increased expression of KRT8 mRNA CTD PMID:21602191 KRT8 Human 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Krt8 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of KRT8 mRNA CTD PMID:12215675 and PMID:21570461 KRT8 Human 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Krt8 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of KRT8 mRNA CTD PMID:17035482 KRT8 Human 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Krt8 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of KRT8 mRNA CTD PMID:17942748 KRT8 Human 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Krt8 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in increased expression of KRT8 mRNA CTD PMID:20959002 and PMID:34747641 KRT8 Human 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Krt8 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of KRT8 mRNA CTD PMID:21724226 KRT8 Human 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Krt8 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 KRT8 Human 2,4-dinitrotoluene affects expression ISO Krt8 (Rattus norvegicus) 6480464 2 and 4-dinitrotoluene affects the expression of KRT8 mRNA CTD PMID:21346803 KRT8 Human 2,6-dimethoxyphenol multiple interactions EXP 6480464 [Sodium Chloride co-treated with pyrogallol 1 more ... CTD PMID:38598786 KRT8 Human 2-acetamidofluorene multiple interactions ISO Krt8 (Rattus norvegicus) 6480464 [2-Acetylaminofluorene co-treated with Diethylnitrosamine] results in increased expression of KRT8 mRNA and [Diethylnitrosamine co-treated with 2-Acetylaminofluorene] results in increased expression of KRT8 mRNA CTD PMID:14656948 and PMID:16158176 KRT8 Human 3,5-diethoxycarbonyl-1,4-dihydrocollidine decreases response to substance ISO Krt8 (Mus musculus) 6480464 KRT8 protein results in decreased susceptibility to 3 more ... CTD PMID:10751352 KRT8 Human 3,5-diethoxycarbonyl-1,4-dihydrocollidine increases expression ISO Krt8 (Mus musculus) 6480464 3 more ... CTD PMID:10751352 KRT8 Human 3-chloropropane-1,2-diol decreases expression ISO Krt8 (Rattus norvegicus) 6480464 alpha-Chlorohydrin analog results in decreased expression of KRT8 protein CTD PMID:26597043 KRT8 Human 4,4'-diaminodiphenylmethane increases expression ISO Krt8 (Rattus norvegicus) 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of KRT8 mRNA CTD PMID:25380136 KRT8 Human 4,4'-diaminodiphenylmethane decreases expression ISO Krt8 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of KRT8 mRNA CTD PMID:18648102 KRT8 Human 4,4'-sulfonyldiphenol increases expression ISO Krt8 (Mus musculus) 6480464 bisphenol S results in increased expression of KRT8 mRNA CTD PMID:30951980 and PMID:39298647 KRT8 Human 4,4'-sulfonyldiphenol affects methylation ISO Krt8 (Mus musculus) 6480464 bisphenol S affects the methylation of KRT8 gene CTD PMID:31683443 KRT8 Human 4-amino-2,6-dinitrotoluene affects expression ISO Krt8 (Rattus norvegicus) 6480464 4-amino-2 and 6-dinitrotoluene affects the expression of KRT8 mRNA CTD PMID:21346803 KRT8 Human 4-hydroxyphenyl retinamide increases expression ISO Krt8 (Mus musculus) 6480464 Fenretinide results in increased expression of KRT8 mRNA CTD PMID:28973697 KRT8 Human 4-hydroxyphenyl retinamide increases expression EXP 6480464 Fenretinide results in increased expression of KRT8 protein CTD PMID:17387344 KRT8 Human 5-aza-2'-deoxycytidine multiple interactions EXP 6480464 [trichostatin A co-treated with Decitabine] results in decreased expression of KRT8 protein CTD PMID:19294695 KRT8 Human 5-aza-2'-deoxycytidine affects expression EXP 6480464 Decitabine affects the expression of KRT8 protein CTD PMID:19294695 KRT8 Human 5-azacytidine increases expression EXP 6480464 Azacitidine results in increased expression of KRT8 mRNA CTD PMID:20823114 KRT8 Human 5-azacytidine multiple interactions EXP 6480464 Azacitidine inhibits the reaction [[Estradiol co-treated with Bucladesine co-treated with Medroxyprogesterone Acetate] results in decreased expression of KRT8 mRNA] CTD PMID:20823114 KRT8 Human 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole affects expression ISO Krt8 (Rattus norvegicus) 6480464 Omeprazole affects the expression of KRT8 mRNA CTD PMID:19483382 KRT8 Human 6-propyl-2-thiouracil affects expression ISO Krt8 (Rattus norvegicus) 6480464 Propylthiouracil affects the expression of KRT8 mRNA CTD PMID:19483382 KRT8 Human 6-propyl-2-thiouracil increases expression ISO Krt8 (Rattus norvegicus) 6480464 Propylthiouracil results in increased expression of KRT8 mRNA CTD PMID:30047161 KRT8 Human 6-propyl-2-thiouracil decreases expression ISO Krt8 (Rattus norvegicus) 6480464 Propylthiouracil results in decreased expression of KRT8 mRNA CTD PMID:25825206 KRT8 Human 7,12-dimethyltetraphene multiple interactions ISO Krt8 (Rattus norvegicus) 6480464 [9 more ... CTD PMID:22248470 KRT8 Human 7,12-dimethyltetraphene increases expression ISO Krt8 (Rattus norvegicus) 6480464 9 more ... CTD PMID:22248470 KRT8 Human 9-cis-retinoic acid increases expression EXP 6480464 Alitretinoin results in increased expression of KRT8 mRNA CTD PMID:17034753 KRT8 Human acetamide increases expression ISO Krt8 (Rattus norvegicus) 6480464 acetamide results in increased expression of KRT8 mRNA CTD PMID:31881176 KRT8 Human acrolein increases metabolic processing EXP 6480464 Acrolein results in increased metabolism of KRT8 protein CTD PMID:20015449 KRT8 Human acrolein increases phosphorylation EXP 6480464 Acrolein results in increased phosphorylation of KRT8 protein CTD PMID:24594012 KRT8 Human acrylamide increases expression ISO Krt8 (Rattus norvegicus) 6480464 Acrylamide results in increased expression of KRT8 mRNA CTD PMID:28959563 KRT8 Human acrylamide decreases expression ISO Krt8 (Mus musculus) 6480464 Acrylamide results in decreased expression of KRT8 mRNA CTD PMID:35032568 KRT8 Human actinomycin D multiple interactions EXP 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of KRT8 protein CTD PMID:38460933 KRT8 Human aflatoxin B1 decreases methylation EXP 6480464 Aflatoxin B1 results in decreased methylation of KRT8 gene CTD PMID:27153756 KRT8 Human all-trans-4-oxoretinoic acid increases expression EXP 6480464 4-oxoretinoic acid results in increased expression of KRT8 mRNA CTD PMID:17034753 KRT8 Human all-trans-4-oxoretinol increases expression EXP 6480464 4-oxoretinol results in increased expression of KRT8 mRNA CTD PMID:17034753 KRT8 Human all-trans-retinoic acid increases expression EXP 6480464 Tretinoin results in increased expression of KRT8 mRNA and Tretinoin results in increased expression of KRT8 protein CTD PMID:17034753 more ... KRT8 Human all-trans-retinoic acid multiple interactions ISO Krt8 (Mus musculus) 6480464 [bisphenol F co-treated with Tretinoin] results in decreased expression of KRT8 mRNA CTD PMID:30951980 KRT8 Human all-trans-retinoic acid increases expression ISO Krt8 (Mus musculus) 6480464 Tretinoin results in increased expression of KRT8 mRNA and Tretinoin results in increased expression of KRT8 protein CTD PMID:16236135 and PMID:7201471 KRT8 Human all-trans-retinoic acid decreases expression ISO Krt8 (Rattus norvegicus) 6480464 Tretinoin results in decreased expression of KRT8 mRNA CTD PMID:24977338 KRT8 Human all-trans-retinol increases expression EXP 6480464 Vitamin A results in increased expression of KRT8 mRNA CTD PMID:17034753 KRT8 Human amiodarone affects expression ISO Krt8 (Rattus norvegicus) 6480464 Amiodarone affects the expression of KRT8 mRNA CTD PMID:19483382 KRT8 Human amitrole increases expression ISO Krt8 (Rattus norvegicus) 6480464 Amitrole results in increased expression of KRT8 mRNA CTD PMID:30047161 KRT8 Human arachidonic acid multiple interactions EXP 6480464 [[Arachidonic Acid co-treated with ferric nitrilotriacetate co-treated with Ethanol] results in increased expression of CYP2E1 protein] which results in increased expression of KRT8 protein CTD PMID:17034788 KRT8 Human aristolochic acid A increases expression EXP 6480464 aristolochic acid I results in increased expression of KRT8 mRNA CTD PMID:33212167 KRT8 Human arsane decreases expression EXP 6480464 Arsenic results in decreased expression of KRT8 mRNA and Arsenic results in decreased expression of KRT8 protein CTD PMID:11134558 more ... KRT8 Human arsane multiple interactions EXP 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of KRT8 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of KRT8 mRNA CTD PMID:39836092 KRT8 Human arsenic atom decreases expression EXP 6480464 Arsenic results in decreased expression of KRT8 mRNA and Arsenic results in decreased expression of KRT8 protein CTD PMID:11134558 more ... KRT8 Human arsenic atom multiple interactions EXP 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of KRT8 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of KRT8 mRNA CTD PMID:39836092 KRT8 Human arsenite(3-) decreases expression ISO Krt8 (Rattus norvegicus) 6480464 arsenite results in decreased expression of KRT8 protein CTD PMID:21344382 KRT8 Human arsenous acid decreases response to substance EXP 6480464 KRT8 protein results in decreased susceptibility to Arsenic Trioxide CTD PMID:20707922 KRT8 Human arsenous acid increases expression EXP 6480464 Arsenic Trioxide results in increased expression of KRT8 protein CTD PMID:33634982 KRT8 Human arsenous acid decreases expression EXP 6480464 Arsenic Trioxide results in decreased expression of KRT8 protein CTD PMID:25419056 KRT8 Human benzbromarone affects expression ISO Krt8 (Rattus norvegicus) 6480464 Benzbromarone affects the expression of KRT8 mRNA CTD PMID:19483382 KRT8 Human benzo[a]pyrene multiple interactions ISO Krt8 (Rattus norvegicus) 6480464 Benzo(a)pyrene promotes the reaction [sodium arsenite results in decreased expression of KRT8 protein] and sodium arsenite promotes the reaction [Benzo(a)pyrene results in decreased expression of KRT8 protein] CTD PMID:16456883 KRT8 Human benzo[a]pyrene decreases methylation EXP 6480464 Benzo(a)pyrene results in decreased methylation of KRT8 promoter CTD PMID:27901495 KRT8 Human benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of KRT8 mRNA and Benzo(a)pyrene results in increased expression of KRT8 protein CTD PMID:17292933 and PMID:32234424 KRT8 Human benzo[a]pyrene increases expression ISO Krt8 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of KRT8 mRNA CTD PMID:27195522 KRT8 Human benzo[a]pyrene decreases expression ISO Krt8 (Rattus norvegicus) 6480464 Benzo(a)pyrene results in decreased expression of KRT8 protein CTD PMID:16456883 KRT8 Human beta-carotene decreases expression EXP 6480464 beta Carotene results in decreased expression of KRT8 mRNA CTD PMID:17034753 KRT8 Human bis(2-ethylhexyl) phthalate increases expression EXP 6480464 Diethylhexyl Phthalate results in increased expression of KRT8 mRNA CTD PMID:31163220 KRT8 Human bisphenol A multiple interactions ISO Krt8 (Rattus norvegicus) 6480464 [bisphenol A co-treated with Estradiol] results in increased expression of KRT8 mRNA CTD PMID:26496021 KRT8 Human bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of KRT8 mRNA CTD PMID:36232920 KRT8 Human bisphenol A increases expression ISO Krt8 (Mus musculus) 6480464 bisphenol A results in increased expression of KRT8 mRNA CTD PMID:30951980 and PMID:32156529 KRT8 Human bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of KRT8 mRNA CTD PMID:30903817 KRT8 Human bisphenol A decreases expression ISO Krt8 (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of KRT8 mRNA and bisphenol A results in decreased expression of KRT8 protein CTD PMID:29097150 more ... KRT8 Human bisphenol A increases expression ISO Krt8 (Rattus norvegicus) 6480464 bisphenol A results in increased expression of KRT8 mRNA CTD PMID:25181051 KRT8 Human bisphenol AF increases expression EXP 6480464 bisphenol AF results in increased expression of KRT8 protein CTD PMID:34186270 KRT8 Human Bisphenol B increases expression EXP 6480464 bisphenol B results in increased expression of KRT8 protein CTD PMID:34186270 KRT8 Human bisphenol F multiple interactions ISO Krt8 (Mus musculus) 6480464 [bisphenol F co-treated with Tretinoin] results in decreased expression of KRT8 mRNA CTD PMID:30951980 KRT8 Human bisphenol F increases expression EXP 6480464 bisphenol F results in increased expression of KRT8 protein CTD PMID:34186270 KRT8 Human bisphenol F increases expression ISO Krt8 (Mus musculus) 6480464 bisphenol F results in increased expression of KRT8 mRNA CTD PMID:30951980 KRT8 Human bleomycin A2 decreases expression EXP 6480464 Bleomycin results in decreased expression of KRT8 mRNA and Bleomycin results in decreased expression of KRT8 protein CTD PMID:37778983 KRT8 Human bleomycin A2 multiple interactions EXP 6480464 Ephedrine inhibits the reaction [Bleomycin results in decreased expression of KRT8 mRNA] and Ephedrine inhibits the reaction [Bleomycin results in decreased expression of KRT8 protein] CTD PMID:37778983 KRT8 Human bucladesine multiple interactions EXP 6480464 [Estradiol co-treated with Bucladesine co-treated with Medroxyprogesterone Acetate] results in decreased expression of KRT8 mRNA and Azacitidine inhibits the reaction [[Estradiol co-treated with Bucladesine co-treated with Medroxyprogesterone Acetate] results in decreased expression of KRT8 mRNA] CTD PMID:20823114 KRT8 Human Butylparaben increases expression EXP 6480464 butylparaben results in increased expression of KRT8 mRNA CTD PMID:17121429 KRT8 Human C60 fullerene increases expression ISO Krt8 (Rattus norvegicus) 6480464 fullerene C60 results in increased expression of KRT8 mRNA CTD PMID:19167457 KRT8 Human cadmium atom decreases response to substance ISO Krt8 (Rattus norvegicus) 6480464 KRT8 protein results in decreased susceptibility to Cadmium CTD PMID:17332340 KRT8 Human cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of KRT8 protein CTD PMID:26220685 KRT8 Human calciol decreases expression ISO Krt8 (Mus musculus) 6480464 Cholecalciferol results in decreased expression of KRT8 mRNA CTD PMID:16508948 KRT8 Human cannabidiol increases expression ISO Krt8 (Mus musculus) 6480464 Cannabidiol results in increased expression of KRT8 mRNA CTD PMID:31052254 KRT8 Human captan increases expression ISO Krt8 (Mus musculus) 6480464 Captan results in increased expression of KRT8 mRNA CTD PMID:31558096 KRT8 Human carbon nanotube affects expression EXP 6480464 Nanotubes and Carbon affects the expression of KRT8 protein CTD PMID:22001959 KRT8 Human carbon nanotube increases expression ISO Krt8 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 KRT8 Human carbon nanotube decreases expression ISO Krt8 (Mus musculus) 6480464 Nanotubes and Carbon analog results in decreased expression of KRT8 mRNA CTD PMID:25620056 KRT8 Human carmustine affects response to substance EXP 6480464 KRT8 mRNA affects the susceptibility to Carmustine CTD PMID:16365179 KRT8 Human chlordecone multiple interactions ISO Krt8 (Mus musculus) 6480464 Chlordecone promotes the reaction [Biomarkers metabolite binds to KRT8 gene] CTD PMID:31084621 KRT8 Human chloroform increases expression ISO Krt8 (Rattus norvegicus) 6480464 Chloroform results in increased expression of KRT8 mRNA CTD PMID:17522070 KRT8 Human choline multiple interactions ISO Krt8 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of KRT8 mRNA CTD PMID:20938992 KRT8 Human chromium(6+) affects expression ISO Krt8 (Mus musculus) 6480464 chromium hexavalent ion affects the expression of KRT8 mRNA CTD PMID:24374135 KRT8 Human ciprofibrate increases expression ISO Krt8 (Mus musculus) 6480464 ciprofibrate results in increased expression of KRT8 mRNA CTD PMID:12771043 KRT8 Human clofibrate affects expression ISO Krt8 (Rattus norvegicus) 6480464 Clofibrate affects the expression of KRT8 mRNA CTD PMID:19483382 KRT8 Human clofibrate multiple interactions ISO Krt8 (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of KRT8 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of KRT8 mRNA] CTD PMID:17585979 KRT8 Human clofibrate decreases expression ISO Krt8 (Rattus norvegicus) 6480464 Clofibrate results in decreased expression of KRT8 mRNA CTD PMID:17522070 KRT8 Human cobalt dichloride decreases expression EXP 6480464 cobaltous chloride results in decreased expression of KRT8 mRNA CTD PMID:19376846 KRT8 Human copper atom affects binding EXP 6480464 KRT8 protein binds to Copper CTD PMID:14534351 KRT8 Human copper atom decreases expression ISO Krt8 (Rattus norvegicus) 6480464 Copper results in decreased expression of KRT8 mRNA CTD PMID:30556269 KRT8 Human copper(0) affects binding EXP 6480464 KRT8 protein binds to Copper CTD PMID:14534351 KRT8 Human copper(0) decreases expression ISO Krt8 (Rattus norvegicus) 6480464 Copper results in decreased expression of KRT8 mRNA CTD PMID:30556269 KRT8 Human copper(II) chloride decreases expression EXP 6480464 cupric chloride results in decreased expression of KRT8 mRNA CTD PMID:38568856 KRT8 Human copper(II) sulfate increases expression EXP 6480464 Copper Sulfate results in increased expression of KRT8 mRNA CTD PMID:19549813 KRT8 Human cumene multiple interactions ISO Krt8 (Mus musculus) 6480464 [cumene co-treated with KRAS gene mutant form] results in decreased expression of KRT8 mRNA CTD PMID:18648096 KRT8 Human Cuprizon increases expression ISO Krt8 (Rattus norvegicus) 6480464 Cuprizone results in increased expression of KRT8 mRNA CTD PMID:26577399 KRT8 Human cyclophosphamide decreases expression ISO Krt8 (Mus musculus) 6480464 Cyclophosphamide results in decreased expression of KRT8 mRNA CTD PMID:21621594 KRT8 Human cyclosporin A increases expression EXP 6480464 Cyclosporine results in increased expression of KRT8 mRNA CTD PMID:21163907 KRT8 Human cytarabine decreases expression EXP 6480464 Cytarabine results in decreased expression of KRT8 mRNA CTD PMID:21198554 KRT8 Human daunorubicin increases expression ISO Krt8 (Rattus norvegicus) 6480464 Daunorubicin results in increased expression of KRT8 protein CTD PMID:2444108 KRT8 Human DDT decreases expression EXP 6480464 DDT results in decreased expression of KRT8 protein CTD PMID:26186133 KRT8 Human dexamethasone decreases expression ISO Krt8 (Rattus norvegicus) 6480464 Dexamethasone results in decreased expression of KRT8 mRNA CTD PMID:17522070 KRT8 Human dexamethasone increases expression ISO Krt8 (Mus musculus) 6480464 Dexamethasone results in increased expression of KRT8 mRNA CTD PMID:21621594 KRT8 Human diallyl trisulfide decreases expression EXP 6480464 diallyl trisulfide results in decreased expression of KRT8 protein CTD PMID:16344271 KRT8 Human diarsenic trioxide decreases expression EXP 6480464 Arsenic Trioxide results in decreased expression of KRT8 protein CTD PMID:25419056 KRT8 Human diarsenic trioxide increases expression EXP 6480464 Arsenic Trioxide results in increased expression of KRT8 protein CTD PMID:33634982 KRT8 Human diarsenic trioxide decreases response to substance EXP 6480464 KRT8 protein results in decreased susceptibility to Arsenic Trioxide CTD PMID:20707922 KRT8 Human dibenz[a,h]anthracene decreases expression ISO Krt8 (Mus musculus) 6480464 1 more ... CTD PMID:26377693 KRT8 Human dibutyl phthalate increases expression ISO Krt8 (Rattus norvegicus) 6480464 Dibutyl Phthalate results in increased expression of KRT8 mRNA CTD PMID:21266533 KRT8 Human dibutyl phthalate increases expression ISO Krt8 (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of KRT8 protein CTD PMID:34864091 KRT8 Human dichloroacetic acid increases expression ISO Krt8 (Mus musculus) 6480464 Dichloroacetic Acid results in increased expression of KRT8 mRNA CTD PMID:28962523 KRT8 Human diethylstilbestrol increases expression ISO Krt8 (Mus musculus) 6480464 Diethylstilbestrol results in increased expression of KRT8 mRNA CTD PMID:15289156 KRT8 Human diethylstilbestrol decreases expression ISO Krt8 (Mus musculus) 6480464 Diethylstilbestrol results in decreased expression of KRT8 mRNA CTD PMID:15171707 and PMID:22467019 KRT8 Human dimethylarsinic acid increases expression ISO Krt8 (Mus musculus) 6480464 Cacodylic Acid results in increased expression of KRT8 mRNA and Cacodylic Acid results in increased expression of KRT8 protein CTD PMID:32052077 KRT8 Human dioxygen multiple interactions ISO Krt8 (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of KRT8 mRNA CTD PMID:30529165 KRT8 Human diquat increases expression ISO Krt8 (Mus musculus) 6480464 Diquat results in increased expression of KRT8 mRNA CTD PMID:36851058 KRT8 Human diuron decreases expression ISO Krt8 (Rattus norvegicus) 6480464 Diuron results in decreased expression of KRT8 mRNA CTD PMID:21551480 KRT8 Human dorsomorphin multiple interactions EXP 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 KRT8 Human doxorubicin affects expression EXP 6480464 Doxorubicin affects the expression of KRT8 protein CTD PMID:29385562 KRT8 Human doxorubicin increases expression EXP 6480464 Doxorubicin results in increased expression of KRT8 mRNA CTD PMID:29803840 KRT8 Human elemental selenium increases expression EXP 6480464 Selenium results in increased expression of KRT8 mRNA CTD PMID:19244175 KRT8 Human entinostat increases expression EXP 6480464 entinostat results in increased expression of KRT8 mRNA CTD PMID:26272509 KRT8 Human entinostat multiple interactions EXP 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of KRT8 mRNA CTD PMID:27188386 KRT8 Human epoxiconazole increases expression ISO Krt8 (Mus musculus) 6480464 epoxiconazole results in increased expression of KRT8 mRNA CTD PMID:35436446 KRT8 Human ethanol multiple interactions EXP 6480464 [[Arachidonic Acid co-treated with ferric nitrilotriacetate co-treated with Ethanol] results in increased expression of CYP2E1 protein] which results in increased expression of KRT8 protein CTD PMID:17034788 KRT8 Human fenofibrate multiple interactions ISO Krt8 (Mus musculus) 6480464 [Fenofibrate co-treated with Diethylnitrosamine] results in increased expression of KRT8 protein CTD PMID:18978307 KRT8 Human fenvalerate increases expression ISO Krt8 (Rattus norvegicus) 6480464 fenvalerate results in increased expression of KRT8 mRNA CTD PMID:31524104 KRT8 Human fipronil decreases expression ISO Krt8 (Rattus norvegicus) 6480464 fipronil results in decreased expression of KRT8 mRNA CTD PMID:23962444 KRT8 Human flavone increases expression EXP 6480464 flavone results in increased expression of KRT8 protein CTD PMID:14750173 KRT8 Human flutamide increases expression ISO Krt8 (Rattus norvegicus) 6480464 Flutamide results in increased expression of KRT8 mRNA CTD PMID:24136188 KRT8 Human folic acid multiple interactions ISO Krt8 (Mus musculus) 6480464 [1 more ... CTD PMID:20938992 and PMID:22206623 KRT8 Human folpet increases expression ISO Krt8 (Mus musculus) 6480464 folpet results in increased expression of KRT8 mRNA CTD PMID:31558096 KRT8 Human fulvestrant multiple interactions EXP 6480464 KRT8 protein promotes the reaction [fulvestrant inhibits the reaction [Estradiol results in increased activity of ESR1 protein]] and KRT8 protein promotes the reaction [fulvestrant results in increased degradation of ESR1 protein] CTD PMID:20061804 KRT8 Human fumonisin B1 increases expression ISO Krt8 (Mus musculus) 6480464 fumonisin B1 results in increased expression of KRT8 mRNA CTD PMID:16221962 KRT8 Human furan affects binding ISO Krt8 (Rattus norvegicus) 6480464 furan binds to KRT8 protein CTD PMID:22240984 KRT8 Human furan increases expression ISO Krt8 (Rattus norvegicus) 6480464 furan results in increased expression of KRT8 mRNA CTD PMID:25539665 and PMID:26194646 KRT8 Human furfural multiple interactions EXP 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of KRT8 protein and [Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of KRT8 protein CTD PMID:38598786 KRT8 Human gemcitabine decreases expression EXP 6480464 Gemcitabine results in decreased expression of KRT8 mRNA CTD PMID:17039268 KRT8 Human genistein decreases expression EXP 6480464 Genistein results in decreased expression of KRT8 mRNA CTD PMID:16705744 KRT8 Human genistein increases expression ISO Krt8 (Mus musculus) 6480464 Genistein results in increased expression of KRT8 mRNA CTD PMID:15289156 and PMID:24365114 KRT8 Human genistein increases expression EXP 6480464 Genistein results in increased expression of KRT8 protein CTD PMID:20884965 KRT8 Human genistein multiple interactions EXP 6480464 ESR1 promotes the reaction [Genistein results in increased expression of KRT8 protein] and ESR2 promotes the reaction [Genistein results in increased expression of KRT8 protein] CTD PMID:20884965 KRT8 Human glycidyl methacrylate decreases expression EXP 6480464 glycidyl methacrylate results in decreased expression of KRT8 protein CTD PMID:36641056 KRT8 Human glyphosate increases expression ISO Krt8 (Mus musculus) 6480464 Glyphosate results in increased expression of KRT8 protein CTD PMID:37208198 KRT8 Human glyphosate decreases expression ISO Krt8 (Rattus norvegicus) 6480464 Glyphosate results in decreased expression of KRT8 mRNA CTD PMID:38314887 KRT8 Human griseofulvin increases expression ISO Krt8 (Mus musculus) 6480464 Griseofulvin results in increased expression of KRT8 mRNA and Griseofulvin results in increased expression of KRT8 protein CTD PMID:10952237 more ... KRT8 Human griseofulvin increases phosphorylation ISO Krt8 (Mus musculus) 6480464 Griseofulvin results in increased phosphorylation of KRT8 protein CTD PMID:20643122 KRT8 Human hexadecanoic acid decreases phosphorylation EXP 6480464 Palmitic Acid results in decreased phosphorylation of KRT8 protein CTD PMID:28073184 KRT8 Human hydrazine increases expression ISO Krt8 (Rattus norvegicus) 6480464 hydrazine results in increased expression of KRT8 protein CTD PMID:15370871 KRT8 Human inulin multiple interactions ISO Krt8 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of KRT8 mRNA CTD PMID:36331819 KRT8 Human iron(III) nitrilotriacetate multiple interactions EXP 6480464 [[Arachidonic Acid co-treated with ferric nitrilotriacetate co-treated with Ethanol] results in increased expression of CYP2E1 protein] which results in increased expression of KRT8 protein CTD PMID:17034788 KRT8 Human isoflavones multiple interactions ISO Krt8 (Rattus norvegicus) 6480464 [9 more ... CTD PMID:22248470 KRT8 Human ivermectin decreases expression EXP 6480464 Ivermectin results in decreased expression of KRT8 protein CTD PMID:32959892 KRT8 Human L-ethionine affects expression ISO Krt8 (Rattus norvegicus) 6480464 Ethionine affects the expression of KRT8 mRNA CTD PMID:19483382 KRT8 Human L-methionine multiple interactions ISO Krt8 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of KRT8 mRNA CTD PMID:20938992 KRT8 Human lidocaine increases expression ISO Krt8 (Rattus norvegicus) 6480464 Lidocaine results in increased expression of KRT8 mRNA CTD PMID:35283115 KRT8 Human manganese atom multiple interactions EXP 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of KRT8 mRNA CTD PMID:39836092 KRT8 Human manganese(0) multiple interactions EXP 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of KRT8 mRNA CTD PMID:39836092 KRT8 Human manganese(II) chloride multiple interactions EXP 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of KRT8 mRNA CTD PMID:39836092 KRT8 Human medroxyprogesterone acetate multiple interactions EXP 6480464 [Estradiol co-treated with Bucladesine co-treated with Medroxyprogesterone Acetate] results in decreased expression of KRT8 mRNA and Azacitidine inhibits the reaction [[Estradiol co-treated with Bucladesine co-treated with Medroxyprogesterone Acetate] results in decreased expression of KRT8 mRNA] CTD PMID:20823114 KRT8 Human megestrol acetate increases expression EXP 6480464 Megestrol Acetate results in increased expression of KRT8 protein CTD PMID:16939895 KRT8 Human menadione multiple interactions EXP 6480464 Acetylcysteine inhibits the reaction [Vitamin K 3 results in increased phosphorylation of KRT8 protein] and U 0126 inhibits the reaction [Vitamin K 3 results in increased phosphorylation of KRT8 protein] CTD PMID:15939799 KRT8 Human menadione increases phosphorylation EXP 6480464 Vitamin K 3 results in increased phosphorylation of KRT8 protein CTD PMID:15939799 KRT8 Human mercury dibromide increases expression EXP 6480464 mercuric bromide results in increased expression of KRT8 mRNA CTD PMID:26272509 KRT8 Human mercury dibromide multiple interactions EXP 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of KRT8 mRNA CTD PMID:27188386 KRT8 Human methapyrilene increases expression ISO Krt8 (Rattus norvegicus) 6480464 Methapyrilene results in increased expression of KRT8 mRNA CTD PMID:28935588 and PMID:30467583 KRT8 Human methapyrilene affects expression ISO Krt8 (Rattus norvegicus) 6480464 Methapyrilene affects the expression of KRT8 protein CTD PMID:30467583 KRT8 Human methidathion increases expression ISO Krt8 (Mus musculus) 6480464 methidathion results in increased expression of KRT8 mRNA CTD PMID:34813904 KRT8 Human methimazole increases expression ISO Krt8 (Rattus norvegicus) 6480464 Methimazole results in increased expression of KRT8 mRNA CTD PMID:30047161 KRT8 Human methotrexate decreases expression ISO Krt8 (Mus musculus) 6480464 Methotrexate results in decreased expression of KRT8 mRNA CTD PMID:21621594 KRT8 Human methotrexate decreases expression EXP 6480464 Methotrexate results in decreased expression of KRT8 protein CTD PMID:24736981 KRT8 Human methylmercury chloride decreases expression EXP 6480464 methylmercuric chloride results in decreased expression of KRT8 mRNA CTD PMID:23179753 KRT8 Human methylmercury chloride increases expression EXP 6480464 methylmercuric chloride results in increased expression of KRT8 mRNA CTD PMID:28001369 KRT8 Human methylparaben increases expression EXP 6480464 methylparaben results in increased expression of KRT8 mRNA CTD PMID:17121429 KRT8 Human microcystin-LR increases expression ISO Krt8 (Mus musculus) 6480464 cyanoginosin LR results in increased expression of KRT8 mRNA CTD PMID:17654400 KRT8 Human microcystin-LR multiple interactions EXP 6480464 cyanoginosin LR results in increased phosphorylation of and affects the expression of KRT8 protein more ... CTD PMID:22960429 KRT8 Human Monobutylphthalate affects expression ISO Krt8 (Mus musculus) 6480464 monobutyl phthalate affects the expression of KRT8 mRNA CTD PMID:19162170 KRT8 Human morphine multiple interactions ISO Krt8 (Rattus norvegicus) 6480464 Morphine deficiency affects the reaction [Morphine deficiency affects the reaction [Morphine results in decreased expression of KRT8 protein]] and Morphine deficiency affects the reaction [Morphine results in decreased expression of KRT8 protein] CTD PMID:23056601 KRT8 Human morphine decreases expression ISO Krt8 (Rattus norvegicus) 6480464 Morphine results in decreased expression of KRT8 protein CTD PMID:23056601 KRT8 Human N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine increases expression EXP 6480464 N more ... CTD PMID:18778698 KRT8 Human N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine multiple interactions EXP 6480464 TP53 mutant form inhibits the reaction [N more ... CTD PMID:18778698 KRT8 Human N-acetyl-L-cysteine multiple interactions EXP 6480464 Acetylcysteine inhibits the reaction [Vitamin K 3 results in increased phosphorylation of KRT8 protein] CTD PMID:15939799 KRT8 Human N-butyl-N-(4-hydroxybutyl)nitrosamine decreases expression ISO Krt8 (Mus musculus) 6480464 Butylhydroxybutylnitrosamine results in decreased expression of KRT8 protein CTD PMID:24998975 KRT8 Human N-nitrosodiethylamine multiple interactions ISO Krt8 (Rattus norvegicus) 6480464 [2-Acetylaminofluorene co-treated with Diethylnitrosamine] results in increased expression of KRT8 mRNA more ... CTD PMID:14656948 more ... KRT8 Human N-nitrosodiethylamine increases expression ISO Krt8 (Mus musculus) 6480464 Diethylnitrosamine results in increased expression of KRT8 mRNA CTD PMID:12771043 KRT8 Human N-nitrosodiethylamine multiple interactions ISO Krt8 (Mus musculus) 6480464 [Diethylnitrosamine co-treated with Piperonyl Butoxide] results in increased expression of KRT8 protein more ... CTD PMID:18978307 more ... KRT8 Human N-nitrosodiethylamine increases expression ISO Krt8 (Rattus norvegicus) 6480464 Diethylnitrosamine results in increased expression of KRT8 mRNA CTD PMID:19638242 KRT8 Human N-nitrosodimethylamine increases expression ISO Krt8 (Rattus norvegicus) 6480464 Dimethylnitrosamine results in increased expression of KRT8 mRNA CTD PMID:17072980 and PMID:25380136 KRT8 Human N-nitrosomorpholine affects expression ISO Krt8 (Rattus norvegicus) 6480464 N-nitrosomorpholine affects the expression of KRT8 protein CTD PMID:19716841 KRT8 Human nefazodone increases expression ISO Krt8 (Rattus norvegicus) 6480464 nefazodone results in increased expression of KRT8 mRNA CTD PMID:24136188 KRT8 Human nimesulide increases expression ISO Krt8 (Rattus norvegicus) 6480464 nimesulide results in increased expression of KRT8 mRNA CTD PMID:24136188 KRT8 Human nitrofen increases expression ISO Krt8 (Rattus norvegicus) 6480464 nitrofen results in increased expression of KRT8 mRNA CTD PMID:33484710 KRT8 Human Nutlin-3 multiple interactions EXP 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of KRT8 protein CTD PMID:38460933 KRT8 Human nystatin increases expression ISO Krt8 (Mus musculus) 6480464 Nystatin results in increased expression of KRT8 mRNA CTD PMID:22863853 KRT8 Human omeprazole affects expression ISO Krt8 (Rattus norvegicus) 6480464 Omeprazole affects the expression of KRT8 mRNA CTD PMID:19483382 KRT8 Human orphenadrine affects expression ISO Krt8 (Rattus norvegicus) 6480464 Orphenadrine affects the expression of KRT8 mRNA CTD PMID:23665939 KRT8 Human ozone multiple interactions ISO Krt8 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of KRT8 mRNA and [Air Pollutants results in increased abundance of Ozone] which results in increased expression of KRT8 mRNA CTD PMID:34911549 KRT8 Human p-chloromercuribenzoic acid increases expression EXP 6480464 p-Chloromercuribenzoic Acid results in increased expression of KRT8 mRNA CTD PMID:26272509 KRT8 Human p-chloromercuribenzoic acid multiple interactions EXP 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of KRT8 mRNA CTD PMID:27188386 KRT8 Human panobinostat multiple interactions EXP 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of KRT8 mRNA CTD PMID:27188386 KRT8 Human panobinostat increases expression EXP 6480464 panobinostat results in increased expression of KRT8 mRNA CTD PMID:26272509 KRT8 Human paracetamol multiple interactions ISO Krt8 (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of KRT8 mRNA more ... CTD PMID:17585979 and PMID:25499718 KRT8 Human paracetamol decreases expression ISO Krt8 (Rattus norvegicus) 6480464 Acetaminophen results in decreased expression of KRT8 mRNA CTD PMID:33387578 KRT8 Human paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of KRT8 protein CTD PMID:22230336 KRT8 Human paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of KRT8 mRNA and Acetaminophen results in decreased expression of KRT8 protein CTD PMID:21420995 and PMID:22230336 KRT8 Human paracetamol affects expression ISO Krt8 (Mus musculus) 6480464 Acetaminophen affects the expression of KRT8 mRNA CTD PMID:17562736 KRT8 Human paraquat increases expression ISO Krt8 (Rattus norvegicus) 6480464 Paraquat results in increased expression of KRT8 mRNA CTD PMID:32680482 KRT8 Human pentachlorophenol increases expression ISO Krt8 (Mus musculus) 6480464 Pentachlorophenol results in increased expression of KRT8 mRNA CTD PMID:23892564 KRT8 Human perfluorobutyric acid increases expression ISO Krt8 (Mus musculus) 6480464 perfluorobutyric acid results in increased expression of KRT8 mRNA CTD PMID:34474067 KRT8 Human perfluorododecanoic acid increases expression ISO Krt8 (Rattus norvegicus) 6480464 perfluorododecanoic acid results in increased expression of KRT8 protein CTD PMID:26168851 KRT8 Human perfluorooctane-1-sulfonic acid increases expression ISO Krt8 (Mus musculus) 6480464 perfluorooctane sulfonic acid results in increased expression of KRT8 protein CTD PMID:26178269 KRT8 Human perfluorooctane-1-sulfonic acid multiple interactions ISO Krt8 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of KRT8 mRNA more ... CTD PMID:36331819 KRT8 Human perfluorooctanoic acid increases expression ISO Krt8 (Rattus norvegicus) 6480464 perfluorooctanoic acid results in increased expression of KRT8 mRNA CTD PMID:19162173 KRT8 Human phenobarbital multiple interactions ISO Krt8 (Rattus norvegicus) 6480464 [Diethylnitrosamine co-treated with Phenobarbital] results in increased expression of and results in increased phosphorylation of KRT8 protein more ... CTD PMID:19409407 and PMID:20935162 KRT8 Human phenobarbital affects expression EXP 6480464 Phenobarbital affects the expression of KRT8 mRNA CTD PMID:19159669 KRT8 Human phenobarbital increases expression ISO Krt8 (Mus musculus) 6480464 Phenobarbital results in increased expression of KRT8 mRNA CTD PMID:19482888 KRT8 Human phenobarbital multiple interactions ISO Krt8 (Mus musculus) 6480464 [Phenobarbital co-treated with Diethylnitrosamine co-treated with Pregnenolone Carbonitrile] results in increased expression of KRT8 mRNA and NR1I3 protein affects the reaction [Phenobarbital results in increased expression of KRT8 mRNA] CTD PMID:19482888 and PMID:33398415 KRT8 Human phenylmercury acetate increases expression EXP 6480464 Phenylmercuric Acetate results in increased expression of KRT8 mRNA CTD PMID:26272509 KRT8 Human phenylmercury acetate multiple interactions EXP 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of KRT8 mRNA CTD PMID:27188386 KRT8 Human phorbol 13-acetate 12-myristate multiple interactions ISO Krt8 (Mus musculus) 6480464 [sodium arsenite co-treated with Tetradecanoylphorbol Acetate] results in increased expression of KRT8 mRNA and [sodium arsenite co-treated with Tetradecanoylphorbol Acetate] results in increased expression of KRT8 protein CTD PMID:16368122 KRT8 Human phosgene affects expression ISO Krt8 (Mus musculus) 6480464 Phosgene affects the expression of KRT8 mRNA CTD PMID:16300373 KRT8 Human piperonyl butoxide multiple interactions ISO Krt8 (Mus musculus) 6480464 [Diethylnitrosamine co-treated with Piperonyl Butoxide] results in increased expression of KRT8 protein CTD PMID:20101389 KRT8 Human pirinixic acid affects expression ISO Krt8 (Rattus norvegicus) 6480464 pirinixic acid affects the expression of KRT8 mRNA CTD PMID:19483382 KRT8 Human pirinixic acid increases expression ISO Krt8 (Mus musculus) 6480464 pirinixic acid results in increased expression of KRT8 mRNA CTD PMID:16221962 more ... KRT8 Human pirinixic acid multiple interactions ISO Krt8 (Mus musculus) 6480464 PPARA protein promotes the reaction [pirinixic acid results in increased expression of KRT8 mRNA] CTD PMID:20059764 KRT8 Human prednisolone increases expression ISO Krt8 (Mus musculus) 6480464 Prednisolone results in increased expression of KRT8 mRNA CTD PMID:21621594 KRT8 Human pregnenolone 16alpha-carbonitrile increases expression ISO Krt8 (Rattus norvegicus) 6480464 Pregnenolone Carbonitrile results in increased expression of KRT8 mRNA CTD PMID:19162173 KRT8 Human pregnenolone 16alpha-carbonitrile multiple interactions ISO Krt8 (Mus musculus) 6480464 [Phenobarbital co-treated with Diethylnitrosamine co-treated with Pregnenolone Carbonitrile] results in increased expression of KRT8 mRNA CTD PMID:33398415 KRT8 Human progesterone decreases expression EXP 6480464 Progesterone results in decreased expression of KRT8 mRNA CTD PMID:21540246 KRT8 Human propiconazole increases expression ISO Krt8 (Mus musculus) 6480464 propiconazole results in increased expression of KRT8 mRNA CTD PMID:21278054 KRT8 Human quercetin decreases expression ISO Krt8 (Rattus norvegicus) 6480464 Quercetin results in decreased expression of KRT8 mRNA CTD PMID:17103110 KRT8 Human quercetin increases expression EXP 6480464 Quercetin results in increased expression of KRT8 protein CTD PMID:14750173 KRT8 Human quercetin decreases expression EXP 6480464 Quercetin results in decreased expression of KRT8 protein CTD PMID:15748282 KRT8 Human rac-1,2-dichloropropane multiple interactions ISO Krt8 (Mus musculus) 6480464 1-aminobenzotriazole affects the reaction [propylene dichloride results in decreased expression of KRT8 protein] CTD PMID:32435916 KRT8 Human rac-1,2-dichloropropane decreases expression ISO Krt8 (Mus musculus) 6480464 propylene dichloride results in decreased expression of KRT8 protein CTD PMID:32435916 KRT8 Human rotenone affects expression ISO Krt8 (Rattus norvegicus) 6480464 Rotenone affects the expression of KRT8 mRNA CTD PMID:28374803 KRT8 Human SB 203580 multiple interactions EXP 6480464 SB 203580 inhibits the reaction [cyanoginosin LR results in increased phosphorylation of KRT8 protein] CTD PMID:22960429 KRT8 Human SB 431542 multiple interactions EXP 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 KRT8 Human SB 431542 increases expression EXP 6480464 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide results in increased expression of KRT8 protein CTD PMID:25670856 KRT8 Human selenium atom increases expression EXP 6480464 Selenium results in increased expression of KRT8 mRNA CTD PMID:19244175 KRT8 Human silicon dioxide affects secretion EXP 6480464 Silicon Dioxide analog affects the secretion of KRT8 protein CTD PMID:25895662 KRT8 Human sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of KRT8 mRNA and sodium arsenite results in increased expression of KRT8 protein CTD PMID:12016162 and PMID:19524636 KRT8 Human sodium arsenite multiple interactions EXP 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of KRT8 mRNA more ... CTD PMID:33939924 and PMID:39836092 KRT8 Human sodium arsenite increases expression ISO Krt8 (Rattus norvegicus) 6480464 sodium arsenite results in increased expression of KRT8 protein CTD PMID:29459688 KRT8 Human sodium arsenite decreases expression ISO Krt8 (Rattus norvegicus) 6480464 sodium arsenite results in decreased expression of KRT8 protein CTD PMID:16456883 KRT8 Human sodium arsenite multiple interactions ISO Krt8 (Rattus norvegicus) 6480464 Benzo(a)pyrene promotes the reaction [sodium arsenite results in decreased expression of KRT8 protein] and sodium arsenite promotes the reaction [Benzo(a)pyrene results in decreased expression of KRT8 protein] CTD PMID:16456883 KRT8 Human sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of KRT8 mRNA CTD PMID:12634122 and PMID:38568856 KRT8 Human sodium arsenite increases expression ISO Krt8 (Mus musculus) 6480464 sodium arsenite results in increased expression of KRT8 mRNA and sodium arsenite results in increased expression of KRT8 protein CTD PMID:14691202 more ... KRT8 Human sodium arsenite multiple interactions ISO Krt8 (Mus musculus) 6480464 [sodium arsenite co-treated with Tetradecanoylphorbol Acetate] results in increased expression of KRT8 mRNA and [sodium arsenite co-treated with Tetradecanoylphorbol Acetate] results in increased expression of KRT8 protein CTD PMID:16368122 KRT8 Human sodium arsenite affects expression ISO Krt8 (Mus musculus) 6480464 sodium arsenite affects the expression of KRT8 mRNA CTD PMID:16507464 KRT8 Human sodium chloride multiple interactions EXP 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of KRT8 protein more ... CTD PMID:38598786 KRT8 Human sodium dichromate increases expression ISO Krt8 (Rattus norvegicus) 6480464 sodium bichromate results in increased expression of KRT8 mRNA CTD PMID:25993096 KRT8 Human sodium dichromate increases expression ISO Krt8 (Mus musculus) 6480464 sodium bichromate results in increased expression of KRT8 mRNA CTD PMID:31558096 KRT8 Human sodium dodecyl sulfate decreases expression ISO Krt8 (Mus musculus) 6480464 Sodium Dodecyl Sulfate results in decreased expression of KRT8 mRNA CTD PMID:21621594 KRT8 Human sodium fluoride decreases expression ISO Krt8 (Mus musculus) 6480464 Sodium Fluoride results in decreased expression of KRT8 mRNA and Sodium Fluoride results in decreased expression of KRT8 protein CTD PMID:27548804 and PMID:27862939 KRT8 Human SU6656 increases expression EXP 6480464 SU 6656 results in increased expression of KRT8 protein CTD PMID:23527294 KRT8 Human sulfadimethoxine increases expression ISO Krt8 (Rattus norvegicus) 6480464 Sulfadimethoxine results in increased expression of KRT8 mRNA CTD PMID:30047161 KRT8 Human sulforaphane increases methylation EXP 6480464 sulforaphane results in increased methylation of KRT8 gene CTD PMID:31838189 KRT8 Human sulforaphane decreases expression EXP 6480464 sulforaphane results in decreased expression of KRT8 mRNA CTD PMID:31838189 KRT8 Human sunitinib decreases expression EXP 6480464 Sunitinib results in decreased expression of KRT8 mRNA CTD PMID:31533062 KRT8 Human T-2 toxin affects expression ISO Krt8 (Rattus norvegicus) 6480464 T-2 Toxin affects the expression of KRT8 protein CTD PMID:26141394 KRT8 Human T-2 toxin increases expression EXP 6480464 T-2 Toxin results in increased expression of KRT8 mRNA CTD PMID:34581912 KRT8 Human tamoxifen increases expression ISO Krt8 (Rattus norvegicus) 6480464 Tamoxifen results in increased expression of KRT8 mRNA CTD PMID:19400957 KRT8 Human tamoxifen increases expression ISO Krt8 (Mus musculus) 6480464 Tamoxifen results in increased expression of KRT8 mRNA CTD PMID:19400957 KRT8 Human temozolomide affects response to substance EXP 6480464 KRT8 mRNA affects the susceptibility to temozolomide CTD PMID:16365179 KRT8 Human temozolomide increases expression EXP 6480464 Temozolomide results in increased expression of KRT8 mRNA CTD PMID:31758290 KRT8 Human tetrachloromethane increases expression ISO Krt8 (Rattus norvegicus) 6480464 Carbon Tetrachloride results in increased expression of KRT8 mRNA CTD PMID:17522070 and PMID:31150632 KRT8 Human tetrachloromethane multiple interactions ISO Krt8 (Rattus norvegicus) 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of KRT8 mRNA] CTD PMID:31150632 KRT8 Human tetrachloromethane increases expression ISO Krt8 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of KRT8 mRNA CTD PMID:27339419 and PMID:31919559 KRT8 Human tetrachloromethane affects expression ISO Krt8 (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of KRT8 mRNA CTD PMID:17484886 KRT8 Human tetracycline increases expression ISO Krt8 (Rattus norvegicus) 6480464 Tetracycline results in increased expression of KRT8 mRNA CTD PMID:17522070 KRT8 Human thapsigargin decreases expression EXP 6480464 Thapsigargin results in decreased expression of KRT8 protein CTD PMID:21692457 KRT8 Human thapsigargin decreases expression ISO Krt8 (Rattus norvegicus) 6480464 Thapsigargin results in decreased expression of KRT8 protein CTD PMID:35544339 KRT8 Human theophylline increases expression ISO Krt8 (Rattus norvegicus) 6480464 Theophylline results in increased expression of KRT8 mRNA CTD PMID:17522070 KRT8 Human thioacetamide affects expression ISO Krt8 (Rattus norvegicus) 6480464 Thioacetamide affects the expression of KRT8 mRNA CTD PMID:19483382 KRT8 Human thioacetamide multiple interactions ISO Krt8 (Rattus norvegicus) 6480464 [Diethylnitrosamine co-treated with Thioacetamide] results in increased expression of KRT8 mRNA CTD PMID:28943392 KRT8 Human thioacetamide increases expression ISO Krt8 (Rattus norvegicus) 6480464 Thioacetamide results in increased expression of KRT8 mRNA CTD PMID:23411599 and PMID:34492290 KRT8 Human thioacetamide multiple interactions ISO Krt8 (Mus musculus) 6480464 Thioacetamide results in increased expression of and results in increased phosphorylation of KRT8 protein CTD PMID:18395095 KRT8 Human thioacetamide increases expression ISO Krt8 (Mus musculus) 6480464 Thioacetamide results in increased expression of KRT8 mRNA CTD PMID:18395095 KRT8 Human titanium dioxide increases expression ISO Krt8 (Mus musculus) 6480464 titanium dioxide results in increased expression of KRT8 mRNA CTD PMID:27760801 KRT8 Human titanium dioxide decreases expression ISO Krt8 (Mus musculus) 6480464 titanium dioxide results in decreased expression of KRT8 mRNA CTD PMID:23557971 KRT8 Human trichloroethene decreases expression ISO Krt8 (Rattus norvegicus) 6480464 Trichloroethylene results in decreased expression of KRT8 mRNA CTD PMID:33387578 KRT8 Human trichostatin A affects expression EXP 6480464 trichostatin A affects the expression of KRT8 protein CTD PMID:19294695 KRT8 Human trichostatin A increases expression EXP 6480464 trichostatin A results in increased expression of KRT8 mRNA CTD PMID:24935251 and PMID:26272509 KRT8 Human trichostatin A multiple interactions EXP 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:19294695 and PMID:27188386 KRT8 Human triptonide increases expression ISO Krt8 (Mus musculus) 6480464 triptonide results in increased expression of KRT8 mRNA CTD PMID:33045310 KRT8 Human troglitazone decreases expression EXP 6480464 troglitazone results in decreased expression of KRT8 mRNA CTD PMID:19140230 KRT8 Human tunicamycin increases expression EXP 6480464 Tunicamycin results in increased expression of KRT8 mRNA CTD PMID:29453283 KRT8 Human valdecoxib increases expression ISO Krt8 (Rattus norvegicus) 6480464 valdecoxib results in increased expression of KRT8 mRNA CTD PMID:24136188 KRT8 Human valproic acid increases expression ISO Krt8 (Mus musculus) 6480464 Valproic Acid results in increased expression of KRT8 mRNA CTD PMID:19136453 KRT8 Human valproic acid multiple interactions EXP 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of KRT8 mRNA CTD PMID:27188386 KRT8 Human valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of KRT8 mRNA CTD PMID:23179753 more ... KRT8 Human vancomycin decreases expression ISO Krt8 (Mus musculus) 6480464 Vancomycin results in decreased expression of KRT8 mRNA CTD PMID:18930951 KRT8 Human vinclozolin affects expression ISO Krt8 (Rattus norvegicus) 6480464 vinclozolin affects the expression of KRT8 mRNA CTD PMID:19015723 KRT8 Human zinc atom increases expression ISO Krt8 (Mus musculus) 6480464 Zinc deficiency results in increased expression of KRT8 mRNA CTD PMID:20857495 KRT8 Human zinc(0) increases expression ISO Krt8 (Mus musculus) 6480464 Zinc deficiency results in increased expression of KRT8 mRNA CTD PMID:20857495 KRT8 Human zoledronic acid decreases expression EXP 6480464 zoledronic acid results in decreased expression of KRT8 mRNA CTD PMID:24714768
(+)-schisandrin B (ISO) (-)-ephedrine (EXP) (1->4)-beta-D-glucan (ISO) 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (ISO) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 1-aminobenzotriazole (ISO) 1-naphthyl isothiocyanate (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP,ISO) 17beta-estradiol 3-benzoate (ISO) 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one (EXP) 17beta-hydroxy-5alpha-androstan-3-one (EXP) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2,4-dinitrotoluene (ISO) 2,6-dimethoxyphenol (EXP) 2-acetamidofluorene (ISO) 3,5-diethoxycarbonyl-1,4-dihydrocollidine (ISO) 3-chloropropane-1,2-diol (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 4-amino-2,6-dinitrotoluene (ISO) 4-hydroxyphenyl retinamide (EXP,ISO) 5-aza-2'-deoxycytidine (EXP) 5-azacytidine (EXP) 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (ISO) 6-propyl-2-thiouracil (ISO) 7,12-dimethyltetraphene (ISO) 9-cis-retinoic acid (EXP) acetamide (ISO) acrolein (EXP) acrylamide (ISO) actinomycin D (EXP) aflatoxin B1 (EXP) all-trans-4-oxoretinoic acid (EXP) all-trans-4-oxoretinol (EXP) all-trans-retinoic acid (EXP,ISO) all-trans-retinol (EXP) amiodarone (ISO) amitrole (ISO) arachidonic acid (EXP) aristolochic acid A (EXP) arsane (EXP) arsenic atom (EXP) arsenite(3-) (ISO) arsenous acid (EXP) benzbromarone (ISO) benzo[a]pyrene (EXP,ISO) beta-carotene (EXP) bis(2-ethylhexyl) phthalate (EXP) bisphenol A (EXP,ISO) bisphenol AF (EXP) Bisphenol B (EXP) bisphenol F (EXP,ISO) bleomycin A2 (EXP) bucladesine (EXP) Butylparaben (EXP) C60 fullerene (ISO) cadmium atom (ISO) cadmium dichloride (EXP) calciol (ISO) cannabidiol (ISO) captan (ISO) carbon nanotube (EXP,ISO) carmustine (EXP) chlordecone (ISO) chloroform (ISO) choline (ISO) chromium(6+) (ISO) ciprofibrate (ISO) clofibrate (ISO) cobalt dichloride (EXP) copper atom (EXP,ISO) copper(0) (EXP,ISO) copper(II) chloride (EXP) copper(II) sulfate (EXP) cumene (ISO) Cuprizon (ISO) cyclophosphamide (ISO) cyclosporin A (EXP) cytarabine (EXP) daunorubicin (ISO) DDT (EXP) dexamethasone (ISO) diallyl trisulfide (EXP) diarsenic trioxide (EXP) dibenz[a,h]anthracene (ISO) dibutyl phthalate (ISO) dichloroacetic acid (ISO) diethylstilbestrol (ISO) dimethylarsinic acid (ISO) dioxygen (ISO) diquat (ISO) diuron (ISO) dorsomorphin (EXP) doxorubicin (EXP) elemental selenium (EXP) entinostat (EXP) epoxiconazole (ISO) ethanol (EXP) fenofibrate (ISO) fenvalerate (ISO) fipronil (ISO) flavone (EXP) flutamide (ISO) folic acid (ISO) folpet (ISO) fulvestrant (EXP) fumonisin B1 (ISO) furan (ISO) furfural (EXP) gemcitabine (EXP) genistein (EXP,ISO) glycidyl methacrylate (EXP) glyphosate (ISO) griseofulvin (ISO) hexadecanoic acid (EXP) hydrazine (ISO) inulin (ISO) iron(III) nitrilotriacetate (EXP) isoflavones (ISO) ivermectin (EXP) L-ethionine (ISO) L-methionine (ISO) lidocaine (ISO) manganese atom (EXP) manganese(0) (EXP) manganese(II) chloride (EXP) medroxyprogesterone acetate (EXP) megestrol acetate (EXP) menadione (EXP) mercury dibromide (EXP) methapyrilene (ISO) methidathion (ISO) methimazole (ISO) methotrexate (EXP,ISO) methylmercury chloride (EXP) methylparaben (EXP) microcystin-LR (EXP,ISO) Monobutylphthalate (ISO) morphine (ISO) N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine (EXP) N-acetyl-L-cysteine (EXP) N-butyl-N-(4-hydroxybutyl)nitrosamine (ISO) N-nitrosodiethylamine (ISO) N-nitrosodimethylamine (ISO) N-nitrosomorpholine (ISO) nefazodone (ISO) nimesulide (ISO) nitrofen (ISO) Nutlin-3 (EXP) nystatin (ISO) omeprazole (ISO) orphenadrine (ISO) ozone (ISO) p-chloromercuribenzoic acid (EXP) panobinostat (EXP) paracetamol (EXP,ISO) paraquat (ISO) pentachlorophenol (ISO) perfluorobutyric acid (ISO) perfluorododecanoic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) phenobarbital (EXP,ISO) phenylmercury acetate (EXP) phorbol 13-acetate 12-myristate (ISO) phosgene (ISO) piperonyl butoxide (ISO) pirinixic acid (ISO) prednisolone (ISO) pregnenolone 16alpha-carbonitrile (ISO) progesterone (EXP) propiconazole (ISO) quercetin (EXP,ISO) rac-1,2-dichloropropane (ISO) rotenone (ISO) SB 203580 (EXP) SB 431542 (EXP) selenium atom (EXP) silicon dioxide (EXP) sodium arsenite (EXP,ISO) sodium chloride (EXP) sodium dichromate (ISO) sodium dodecyl sulfate (ISO) sodium fluoride (ISO) SU6656 (EXP) sulfadimethoxine (ISO) sulforaphane (EXP) sunitinib (EXP) T-2 toxin (EXP,ISO) tamoxifen (ISO) temozolomide (EXP) tetrachloromethane (ISO) tetracycline (ISO) thapsigargin (EXP,ISO) theophylline (ISO) thioacetamide (ISO) titanium dioxide (ISO) trichloroethene (ISO) trichostatin A (EXP) triptonide (ISO) troglitazone (EXP) tunicamycin (EXP) valdecoxib (ISO) valproic acid (EXP,ISO) vancomycin (ISO) vinclozolin (ISO) zinc atom (ISO) zinc(0) (ISO) zoledronic acid (EXP)
KRT8 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 12 52,897,191 - 52,949,860 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 12 52,897,187 - 52,949,954 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 12 53,290,975 - 53,343,644 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 12 51,577,238 - 51,585,127 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 12 51,577,241 - 51,585,089 NCBI Celera 12 52,937,521 - 52,945,403 (-) NCBI Celera Cytogenetic Map 12 q13.13 NCBI HuRef 12 50,334,669 - 50,387,466 (-) NCBI HuRef CHM1_1 12 53,257,746 - 53,310,407 (-) NCBI CHM1_1 T2T-CHM13v2.0 12 52,861,778 - 52,914,419 (-) NCBI T2T-CHM13v2.0
Krt8 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 15 101,905,146 - 101,912,777 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 15 101,905,133 - 101,912,917 (-) Ensembl GRCm39 Ensembl GRCm38 15 101,996,711 - 102,004,342 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 15 101,996,698 - 102,004,482 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 15 101,827,142 - 101,834,773 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 15 101,824,745 - 101,832,317 (-) NCBI MGSCv36 mm8 Celera 15 104,151,508 - 104,159,109 (-) NCBI Celera Cytogenetic Map 15 F2 NCBI cM Map 15 57.2 NCBI
Krt8 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 135,002,886 - 135,010,339 (-) NCBI GRCr8 mRatBN7.2 7 133,124,203 - 133,131,656 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 133,124,203 - 133,131,728 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 134,885,801 - 134,893,230 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 137,115,319 - 137,122,748 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 137,093,977 - 137,101,412 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 143,596,511 - 143,603,745 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 143,596,511 - 143,603,803 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 141,393,004 - 141,400,457 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 140,713,902 - 140,721,199 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 140,790,339 - 140,797,636 (-) NCBI Celera 7 129,561,335 - 129,568,866 (-) NCBI Celera Cytogenetic Map 7 q36 NCBI
Krt8 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955458 178,954 - 190,310 (-) NCBI ChiLan1.0 ChiLan1.0
KRT8 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 10 41,287,911 - 41,295,899 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 12 41,284,674 - 41,292,662 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 12 35,855,367 - 35,863,248 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 12 36,634,582 - 36,642,564 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 12 36,634,582 - 36,642,564 (+) Ensembl panpan1.1 panPan2
KRT8 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 27 2,221,608 - 2,229,343 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 27 44,022,937 - 44,030,605 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 27 2,222,635 - 2,230,328 (+) NCBI ROS_Cfam_1.0 UMICH_Zoey_3.1 27 2,239,283 - 2,246,949 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 27 2,225,535 - 2,233,175 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 27 44,422,008 - 44,429,675 (-) NCBI UU_Cfam_GSD_1.0
Krt8 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404945 62,910,080 - 62,917,785 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936512 10,246,991 - 10,254,827 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936512 10,247,049 - 10,254,748 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
KRT8 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 5 18,167,553 - 18,180,404 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 5 18,172,423 - 18,180,277 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 5 18,663,339 - 18,671,193 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
KRT8
Krt8
.
NM_002273.4(KRT8):c.184G>T (p.Gly62Cys) single nucleotide variant
Cirrhosis, cryptogenic [RCV000015735 ]|not provided [RCV000056938 ]|not specified [RCV002247346 ]
Chr12:52904798 [GRCh38]
pathogenic|risk factor|benign|likely benign|uncertain significance|not provided
NM_002273.4(KRT8):c.160T>C (p.Tyr54His) single nucleotide variant
Cirrhosis, cryptogenic [RCV000015737 ]|Hepatitis C virus, susceptibility to [RCV000988859 ]|not provided [RCV000056936 ]|not specified [RCV001777139 ]
Chr12:52904822 [GRCh38]
pathogenic|risk factor|benign|uncertain significance|not provided
NM_002273.4(KRT8):c.1033G>T (p.Ala345Ser) single nucleotide variant
Hepatitis C virus, susceptibility to [RCV000049579 ]
Chr12:52898848 [GRCh38]
not provided
NM_002273.4(KRT8):c.1340C>T (p.Ala447Val) single nucleotide variant
Hepatitis C virus, susceptibility to [RCV000049580 ]|not provided [RCV001455226 ]
Chr12:52897540 [GRCh38]
likely benign|not provided
NM_002273.4(KRT8):c.1412G>A (p.Gly471Glu) single nucleotide variant
Hepatitis C virus, susceptibility to [RCV000049581 ]|not specified [RCV004018966 ]
Chr12:52897468 [GRCh38]
uncertain significance|not provided
NM_002273.4(KRT8):c.*31C>T single nucleotide variant
not provided [RCV000056922 ]
Chr12:52897397 [GRCh38]
not provided
NM_002273.4(KRT8):c.*38G>A single nucleotide variant
not provided [RCV000056923 ]
Chr12:52897390 [GRCh38]
not provided
NM_002273.4(KRT8):c.*8C>T single nucleotide variant
not provided [RCV000056924 ]
Chr12:52897420 [GRCh38]
not provided
NM_002273.4(KRT8):c.1021C>T (p.Arg341Cys) single nucleotide variant
not provided [RCV000056925 ]
Chr12:52898860 [GRCh38]
not provided
NM_002273.4(KRT8):c.1022G>A (p.Arg341His) single nucleotide variant
not provided [RCV000056926 ]
Chr12:52898859 [GRCh38]
benign|not provided
NM_002273.4(KRT8):c.1128G>A (p.Glu376=) single nucleotide variant
not provided [RCV000056927 ]
Chr12:52898753 [GRCh38]
not provided
NM_002273.4(KRT8):c.1138G>A (p.Val380Ile) single nucleotide variant
not provided [RCV000056928 ]
Chr12:52898743 [GRCh38]
likely benign|not provided
NM_002273.4(KRT8):c.1202+46A>T single nucleotide variant
not provided [RCV000056929 ]
Chr12:52898633 [GRCh38]
not provided
NM_002273.4(KRT8):c.1261+11del deletion
not provided [RCV000056930 ]
Chr12:52898450 [GRCh38]
not provided
NM_002273.4(KRT8):c.1261+20G>A single nucleotide variant
not provided [RCV000056931 ]
Chr12:52898441 [GRCh38]
not provided
NM_002273.4(KRT8):c.1300G>A (p.Gly434Ser) single nucleotide variant
KRT8-related disorder [RCV003935000 ]|not provided [RCV000056932 ]
Chr12:52897580 [GRCh38]
benign|not provided
NM_002273.4(KRT8):c.1360C>T (p.Arg454Cys) single nucleotide variant
not provided [RCV000056933 ]
Chr12:52897520 [GRCh38]
not provided
NM_002273.4(KRT8):c.1392G>T (p.Lys464Asn) single nucleotide variant
not provided [RCV000056934 ]|not specified [RCV003488369 ]
Chr12:52897488 [GRCh38]
uncertain significance|not provided
NM_002273.4(KRT8):c.158G>T (p.Gly53Val) single nucleotide variant
not provided [RCV000056935 ]
Chr12:52904824 [GRCh38]
not provided
NM_002273.4(KRT8):c.164G>C (p.Gly55Ala) single nucleotide variant
not provided [RCV000056937 ]
Chr12:52904818 [GRCh38]
not provided
NM_002273.4(KRT8):c.187A>G (p.Ile63Val) single nucleotide variant
Hepatitis C virus, susceptibility to [RCV000988858 ]|Inflammatory bowel disease [RCV001258260 ]|not provided [RCV000056939 ]|not specified [RCV000612895 ]
Chr12:52904795 [GRCh38]
benign|likely benign|not provided
NM_002273.4(KRT8):c.216G>A (p.Leu72=) single nucleotide variant
not provided [RCV000056940 ]
Chr12:52904766 [GRCh38]
not provided
NM_002273.4(KRT8):c.681A>G (p.Leu227=) single nucleotide variant
not provided [RCV000056941 ]
Chr12:52900597 [GRCh38]
not provided
NM_002273.4(KRT8):c.77C>G (p.Thr26Arg) single nucleotide variant
not provided [RCV000056942 ]
Chr12:52904905 [GRCh38]
not provided
NM_002273.4(KRT8):c.955G>T (p.Ala319Ser) single nucleotide variant
KRT8-related disorder [RCV003925017 ]|not provided [RCV000056943 ]
Chr12:52899801 [GRCh38]
likely benign|not provided
NM_002273.3(KRT8):c.574G>A (p.Glu192Lys) single nucleotide variant
Malignant melanoma [RCV000062538 ]
Chr12:52901179 [GRCh38]
not provided
NM_000224.3(KRT18):c.282C>T (p.Tyr94=) single nucleotide variant
Hepatitis C virus, susceptibility to [RCV000049577 ]
Chr12:52949455 [GRCh38]
not provided
NM_000224.3(KRT18):c.134G>C (p.Arg45Pro) single nucleotide variant
Hepatitis C virus, susceptibility to [RCV000049578 ]
Chr12:52949307 [GRCh38]
not provided
NM_000224.3(KRT18):c.-15C>T single nucleotide variant
not provided [RCV000056430 ]
Chr12:52949159 [GRCh38]
not provided
NM_000224.3(KRT18):c.193_216del (p.Thr65_Ala72del) deletion
not provided [RCV000056433 ]
Chr12:52949366..52949389 [GRCh38]
not provided
NM_000224.3(KRT18):c.307A>G (p.Thr103Ala) single nucleotide variant
not provided [RCV000056434 ]
Chr12:52949480 [GRCh38]
not provided
NM_000224.3(KRT18):c.383A>T (p.His128Leu) single nucleotide variant
Cirrhosis, cryptogenic [RCV000015686 ]|Cirrhosis, noncryptogenic, susceptibility to [RCV000015687 ]|not provided [RCV000056435 ]
Chr12:52949556 [GRCh38]
pathogenic|risk factor|not provided
GRCh38/hg38 12q13.13(chr12:52851850-53558824)x3 copy number gain
See cases [RCV000138030 ]
Chr12:52851850..53558824 [GRCh38]
likely pathogenic
GRCh38/hg38 12q13.13(chr12:52748391-52950618)x3 copy number gain
See cases [RCV000138642 ]
Chr12:52748391..52950618 [GRCh38]
likely benign
GRCh38/hg38 12p13.33-q24.33(chr12:121271-133196807)x3 copy number gain
See cases [RCV000139555 ]
Chr12:121271..133196807 [GRCh38]
pathogenic
GRCh38/hg38 12q13.12-13.13(chr12:50122359-53248460)x1 copy number loss
See cases [RCV000142033 ]
Chr12:50122359..53248460 [GRCh38]
pathogenic
GRCh37/hg19 12p13.33-q24.33(chr12:1-133851895)x3 copy number gain
See cases [RCV000258805 ]
Chr12:1..133851895 [GRCh37]
pathogenic|likely pathogenic
NM_002273.4(KRT8):c.1174A>G (p.Arg392Gly) single nucleotide variant
not specified [RCV004294011 ]
Chr12:52898707 [GRCh38]
uncertain significance
GRCh37/hg19 12p13.33-q24.33(chr12:173787-133777902)x3 copy number gain
See cases [RCV000510482 ]
Chr12:173787..133777902 [GRCh37]
pathogenic
GRCh37/hg19 12p13.33-q24.33(chr12:173787-133777902) copy number gain
See cases [RCV000511643 ]
Chr12:173787..133777902 [GRCh37]
pathogenic
NC_000012.11:g.26370251_54361538inv inversion
not specified [RCV000714265 ]
Chr12:26370251..54361538 [GRCh37]
uncertain significance
NM_000224.3(KRT18):c.300C>G (p.Ser100Arg) single nucleotide variant
not provided [RCV001572658 ]|not specified [RCV001729958 ]
Chr12:52949473 [GRCh38]
benign|likely benign
GRCh37/hg19 12p13.33-q24.33(chr12:191619-133777645)x3 copy number gain
not provided [RCV000750246 ]
Chr12:191619..133777645 [GRCh37]
pathogenic
GRCh37/hg19 12p13.33-q24.33(chr12:621220-133779118)x3 copy number gain
not provided [RCV000750253 ]
Chr12:621220..133779118 [GRCh37]
pathogenic
NM_000224.3(KRT18):c.274G>C (p.Ala92Pro) single nucleotide variant
not provided [RCV001572633 ]|not specified [RCV001729956 ]
Chr12:52949447 [GRCh38]
benign|likely benign
NM_002273.4(KRT8):c.1438G>A (p.Val480Ile) single nucleotide variant
KRT8-related disorder [RCV003910466 ]|not provided [RCV000885225 ]
Chr12:52897442 [GRCh38]
benign
NM_002273.4(KRT8):c.87C>T (p.Pro29=) single nucleotide variant
not provided [RCV000884588 ]
Chr12:52904895 [GRCh38]
likely benign
NM_002273.4(KRT8):c.1261+9C>T single nucleotide variant
not provided [RCV000969626 ]
Chr12:52898452 [GRCh38]
benign
NM_002273.4(KRT8):c.999C>T (p.Ala333=) single nucleotide variant
KRT8-related disorder [RCV003933251 ]|not provided [RCV000947459 ]
Chr12:52898882 [GRCh38]
benign
NM_002273.4(KRT8):c.25T>G (p.Ser9Ala) single nucleotide variant
not specified [RCV004309841 ]
Chr12:52904957 [GRCh38]
uncertain significance
NM_000224.3(KRT18):c.268C>T (p.Arg90Cys) single nucleotide variant
not provided [RCV001572635 ]|not specified [RCV001729957 ]
Chr12:52949441 [GRCh38]
benign|likely benign
NM_000224.3(KRT18):c.356A>G (p.Lys119Arg) single nucleotide variant
not specified [RCV004288757 ]
Chr12:52949529 [GRCh38]
uncertain significance
NM_002273.4(KRT8):c.1305C>T (p.Leu435=) single nucleotide variant
not provided [RCV000944050 ]
Chr12:52897575 [GRCh38]
likely benign
NM_002273.4(KRT8):c.1265G>T (p.Gly422Val) single nucleotide variant
not provided [RCV001553484 ]
Chr12:52897615 [GRCh38]
uncertain significance
NM_001256282.2(KRT8):c.39-2208G>A single nucleotide variant
not provided [RCV001666814 ]
Chr12:52907235 [GRCh38]
benign
NM_002273.4(KRT8):c.-4T>C single nucleotide variant
KRT8-related disorder [RCV003975973 ]|not provided [RCV001694500 ]
Chr12:52904985 [GRCh38]
benign
NM_000224.3(KRT18):c.206G>C (p.Gly69Ala) single nucleotide variant
Cirrhosis, familial [RCV001331079 ]|not provided [RCV004692541 ]
Chr12:52949379 [GRCh38]
uncertain significance
NM_002273.4(KRT8):c.1202+1G>A single nucleotide variant
not provided [RCV001357561 ]
Chr12:52898678 [GRCh38]
pathogenic|uncertain significance
NM_002273.4(KRT8):c.161A>G (p.Tyr54Cys) single nucleotide variant
not provided [RCV001765401 ]
Chr12:52904821 [GRCh38]
uncertain significance
NM_000224.3(KRT18):c.174_175insA (p.Gly59fs) insertion
not specified [RCV001733555 ]
Chr12:52949347..52949348 [GRCh38]
benign
NM_002273.4(KRT8):c.930G>T (p.Met310Ile) single nucleotide variant
not specified [RCV004321562 ]
Chr12:52899826 [GRCh38]
uncertain significance
NM_002273.4(KRT8):c.556C>G (p.Arg186Gly) single nucleotide variant
not specified [RCV004242744 ]
Chr12:52901197 [GRCh38]
uncertain significance
NM_002273.4(KRT8):c.1051G>A (p.Ala351Thr) single nucleotide variant
not specified [RCV004117347 ]
Chr12:52898830 [GRCh38]
uncertain significance
NM_002273.4(KRT8):c.1334C>G (p.Ser445Cys) single nucleotide variant
not specified [RCV004226583 ]
Chr12:52897546 [GRCh38]
uncertain significance
NM_000224.3(KRT18):c.107A>C (p.Tyr36Ser) single nucleotide variant
not specified [RCV004087252 ]
Chr12:52949280 [GRCh38]
uncertain significance
NM_002273.4(KRT8):c.625G>A (p.Glu209Lys) single nucleotide variant
not specified [RCV004229033 ]
Chr12:52900653 [GRCh38]
uncertain significance
NM_002273.4(KRT8):c.439C>G (p.Leu147Val) single nucleotide variant
not specified [RCV004098574 ]
Chr12:52901958 [GRCh38]
uncertain significance
NM_002273.4(KRT8):c.572A>G (p.Asn191Ser) single nucleotide variant
not specified [RCV004275316 ]
Chr12:52901181 [GRCh38]
uncertain significance
NM_002273.4(KRT8):c.49C>T (p.Pro17Ser) single nucleotide variant
not specified [RCV004357943 ]
Chr12:52904933 [GRCh38]
uncertain significance
NM_002273.4(KRT8):c.95G>C (p.Arg32Pro) single nucleotide variant
not specified [RCV004341660 ]
Chr12:52904887 [GRCh38]
uncertain significance
NM_002273.4(KRT8):c.1000G>A (p.Ala334Thr) single nucleotide variant
not specified [RCV004348067 ]
Chr12:52898881 [GRCh38]
uncertain significance
NM_002273.4(KRT8):c.475C>A (p.Leu159Met) single nucleotide variant
not specified [RCV004361918 ]
Chr12:52901922 [GRCh38]
uncertain significance
NM_000224.3(KRT18):c.57C>T (p.Val19=) single nucleotide variant
not provided [RCV003391852 ]
Chr12:52949230 [GRCh38]
likely benign
NM_002273.4(KRT8):c.739T>G (p.Ser247Ala) single nucleotide variant
not specified [RCV004414552 ]
Chr12:52900017 [GRCh38]
uncertain significance
NM_002273.4(KRT8):c.1330G>A (p.Gly444Ser) single nucleotide variant
not specified [RCV004414550 ]
Chr12:52897550 [GRCh38]
uncertain significance
NM_002273.4(KRT8):c.1014C>T (p.Ala338=) single nucleotide variant
KRT8-related disorder [RCV003903823 ]
Chr12:52898867 [GRCh38]
likely benign
NM_002273.4(KRT8):c.218T>G (p.Leu73Arg) single nucleotide variant
not specified [RCV004414551 ]
Chr12:52904764 [GRCh38]
uncertain significance
NM_002273.4(KRT8):c.-10T>A single nucleotide variant
KRT8-related disorder [RCV003964492 ]
Chr12:52904991 [GRCh38]
benign
NM_002273.4(KRT8):c.1356C>T (p.Phe452=) single nucleotide variant
not provided [RCV003885196 ]
Chr12:52897524 [GRCh38]
likely benign
NM_002273.4(KRT8):c.-29G>A single nucleotide variant
KRT8-related disorder [RCV003969086 ]
Chr12:52905010 [GRCh38]
likely benign
NM_002273.4(KRT8):c.573C>T (p.Asn191=) single nucleotide variant
KRT8-related disorder [RCV003911874 ]
Chr12:52901180 [GRCh38]
likely benign
NM_002273.4(KRT8):c.946C>T (p.Arg316Trp) single nucleotide variant
not specified [RCV004414553 ]
Chr12:52899810 [GRCh38]
uncertain significance
NM_000224.3(KRT18):c.83C>T (p.Pro28Leu) single nucleotide variant
not specified [RCV004412215 ]
Chr12:52949256 [GRCh38]
uncertain significance
NM_000224.3(KRT18):c.11C>T (p.Thr4Ile) single nucleotide variant
not specified [RCV004412211 ]
Chr12:52949184 [GRCh38]
uncertain significance
NM_002273.4(KRT8):c.365A>C (p.Lys122Thr) single nucleotide variant
EBV-positive nodal T- and NK-cell lymphoma [RCV004557765 ]
Chr12:52902032 [GRCh38]
likely benign
NM_002273.4(KRT8):c.173G>A (p.Ser58Asn) single nucleotide variant
not specified [RCV004644592 ]
Chr12:52904809 [GRCh38]
uncertain significance
NM_002273.4(KRT8):c.772A>G (p.Ser258Gly) single nucleotide variant
not specified [RCV004644593 ]
Chr12:52899984 [GRCh38]
likely benign
NM_002273.4(KRT8):c.905G>A (p.Arg302His) single nucleotide variant
not specified [RCV004633744 ]
Chr12:52899851 [GRCh38]
uncertain significance
NM_002273.4(KRT8):c.1105C>T (p.Arg369Trp) single nucleotide variant
not specified [RCV004633745 ]
Chr12:52898776 [GRCh38]
uncertain significance
NM_002273.4(KRT8):c.1137C>T (p.Asn379=) single nucleotide variant
not specified [RCV004937696 ]
Chr12:52898744 [GRCh38]
likely benign
NM_002273.4(KRT8):c.119G>A (p.Arg40Gln) single nucleotide variant
not specified [RCV004937697 ]
Chr12:52904863 [GRCh38]
uncertain significance
NM_002273.4(KRT8):c.445C>T (p.Arg149Trp) single nucleotide variant
not specified [RCV004937698 ]
Chr12:52901952 [GRCh38]
uncertain significance
NM_002273.4(KRT8):c.683A>G (p.Tyr228Cys) single nucleotide variant
not specified [RCV004937695 ]
Chr12:52900595 [GRCh38]
uncertain significance
NM_000224.3(KRT18):c.306G>C (p.Glu102Asp) single nucleotide variant
not specified [RCV004934652 ]
Chr12:52949479 [GRCh38]
uncertain significance
NM_000224.3(KRT18):c.257G>C (p.Ser86Thr) single nucleotide variant
not specified [RCV004935961 ]
Chr12:52949430 [GRCh38]
uncertain significance
NM_002273.4(KRT8):c.1085G>A (p.Arg362Gln) single nucleotide variant
not specified [RCV004934709 ]
Chr12:52898796 [GRCh38]
uncertain significance
NM_002273.4(KRT8):c.1288C>A (p.Leu430Ile) single nucleotide variant
not specified [RCV004934710 ]
Chr12:52897592 [GRCh38]
uncertain significance
Predicted Target Of
Count of predictions: 5281 Count of miRNA genes: 1061 Interacting mature miRNAs: 1343 Transcripts: ENST00000293308, ENST00000546542, ENST00000546583, ENST00000546826, ENST00000546897, ENST00000546900, ENST00000546921, ENST00000547031, ENST00000547176, ENST00000547413, ENST00000548998, ENST00000549176, ENST00000549198, ENST00000550170, ENST00000551318, ENST00000552150, ENST00000552551, ENST00000552877 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
597146903 GWAS1242977_H prostate carcinoma QTL GWAS1242977 (human) 3e-18 prostate carcinoma 12 52918828 52918829 Human 597099158 GWAS1195232_H prostate carcinoma QTL GWAS1195232 (human) 1e-12 prostate carcinoma 12 52935447 52935448 Human 597098644 GWAS1194718_H prostate carcinoma QTL GWAS1194718 (human) 3e-12 prostate carcinoma 12 52915148 52915149 Human 597401055 GWAS1497129_H serum alanine aminotransferase measurement QTL GWAS1497129 (human) 1e-08 serum alanine aminotransferase measurement serum alanine aminotransferase activity level (CMO:0000575) 12 52901297 52901298 Human 597099217 GWAS1195291_H prostate carcinoma QTL GWAS1195291 (human) 2e-10 prostate carcinoma 12 52921881 52921882 Human 597477659 GWAS1573733_H serum alanine aminotransferase measurement QTL GWAS1573733 (human) 5e-08 serum alanine aminotransferase measurement serum alanine aminotransferase activity level (CMO:0000575) 12 52901297 52901298 Human 597450459 GWAS1546533_H pancreatic carcinoma QTL GWAS1546533 (human) 7e-10 pancreatic carcinoma 12 52902133 52902134 Human 597100880 GWAS1196954_H prostate carcinoma QTL GWAS1196954 (human) 2e-12 prostate carcinoma 12 52935447 52935448 Human 597203600 GWAS1299674_H familial sick sinus syndrome QTL GWAS1299674 (human) 9e-14 sick sinus syndrome 12 52904798 52904799 Human 597586066 GWAS1642926_H prostate carcinoma QTL GWAS1642926 (human) 3e-26 prostate carcinoma 12 52915148 52915149 Human 597331914 GWAS1427988_H prostate cancer QTL GWAS1427988 (human) 7e-12 prostate cancer 12 52909547 52909548 Human 597331915 GWAS1427989_H prostate cancer QTL GWAS1427989 (human) 1e-11 prostate cancer 12 52904991 52904992 Human 597462606 GWAS1558680_H prostate cancer QTL GWAS1558680 (human) 0.000009 prostate cancer 12 52915148 52915149 Human 597148165 GWAS1244239_H prostate carcinoma QTL GWAS1244239 (human) 3e-97 prostate carcinoma 12 52918828 52918829 Human 597494345 GWAS1590419_H serum alanine aminotransferase measurement QTL GWAS1590419 (human) 3e-10 serum alanine aminotransferase measurement serum alanine aminotransferase activity level (CMO:0000575) 12 52901610 52901611 Human 597148035 GWAS1244109_H prostate carcinoma QTL GWAS1244109 (human) 2e-27 prostate carcinoma 12 52921881 52921882 Human 597457993 GWAS1554067_H diastolic blood pressure QTL GWAS1554067 (human) 2e-08 diastolic blood pressure diastolic blood pressure (CMO:0000005) 12 52931778 52931779 Human 597148097 GWAS1244171_H prostate carcinoma QTL GWAS1244171 (human) 8e-115 prostate carcinoma 12 52918828 52918829 Human 597617737 GWAS1674597_H prostate specific antigen amount QTL GWAS1674597 (human) 3e-22 prostate specific antigen amount 12 52915148 52915149 Human 597100879 GWAS1196953_H prostate carcinoma QTL GWAS1196953 (human) 5e-58 prostate carcinoma 12 52915148 52915149 Human 597602178 GWAS1659038_H drug use measurement, prostate cancer QTL GWAS1659038 (human) 1e-15 drug use measurement, prostate cancer 12 52915800 52915801 Human 597607420 GWAS1664280_H prostate carcinoma QTL GWAS1664280 (human) 3e-67 prostate carcinoma 12 52915800 52915801 Human 407369573 GWAS1018549_H lung carcinoma, estrogen-receptor negative breast cancer, ovarian endometrioid carcinoma, colorectal cancer, prostate carcinoma, ovarian serous carcinoma, breast carcinoma, ovarian carcinoma, lung adenocarcinoma, squamous cell lung carcinoma QTL GWAS1018549 (human) 2e-15 mammary gland integrity trait (VT:0010552) 12 52918828 52918829 Human 597162741 GWAS1258815_H prostate carcinoma QTL GWAS1258815 (human) 1e-17 prostate carcinoma 12 52918828 52918829 Human 597098996 GWAS1195070_H prostate carcinoma QTL GWAS1195070 (human) 5e-09 prostate carcinoma 12 52915148 52915149 Human 597089278 GWAS1185352_H mean reticulocyte volume QTL GWAS1185352 (human) 2e-09 reticulocyte morphology trait (VT:0002424) mean corpuscular volume (CMO:0000038) 12 52915985 52915986 Human 597105915 GWAS1201989_H prostate carcinoma QTL GWAS1201989 (human) 1e-20 prostate carcinoma 12 52909547 52909548 Human 597246901 GWAS1342975_H opioid dependence QTL GWAS1342975 (human) 0.0000007 opioid dependence 12 52911490 52911491 Human 597168041 GWAS1264115_H prostate carcinoma QTL GWAS1264115 (human) 2e-17 prostate carcinoma 12 52921881 52921882 Human 597603041 GWAS1659901_H prostate cancer QTL GWAS1659901 (human) 9e-36 prostate cancer 12 52915800 52915801 Human
D12S765
Human Assembly Chr Position (strand) Source JBrowse GRCh37 12 53,291,129 - 53,291,563 UniSTS GRCh37 Build 36 12 51,577,396 - 51,577,830 RGD NCBI36 Celera 12 52,937,679 - 52,938,113 RGD Cytogenetic Map 12 q13 UniSTS HuRef 12 50,334,827 - 50,335,261 UniSTS
GDB:376877
Human Assembly Chr Position (strand) Source JBrowse GRCh37 12 53,295,118 - 53,295,467 UniSTS GRCh37 Build 36 12 51,581,385 - 51,581,734 RGD NCBI36 Celera 12 52,941,668 - 52,942,017 RGD Cytogenetic Map 12 q13 UniSTS HuRef 12 50,338,816 - 50,339,165 UniSTS
D17S1697
Human Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 12 q13 UniSTS
RH79790
Human Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 12 q13 UniSTS
RH47175
Human Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 12 q13 UniSTS GeneMap99-GB4 RH Map 12 227.97 UniSTS NCBI RH Map 12 442.2 UniSTS
GDB:277179
Human Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 12 q13 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
entire extraembryonic component
1204
2438
2788
2246
4942
1725
2350
5
624
1803
465
2268
7142
6311
52
3708
1
851
1739
1615
171
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENST00000293308 ⟹ ENSP00000293308
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 12 52,897,194 - 52,906,618 (-) Ensembl
Ensembl Acc Id:
ENST00000546542 ⟹ ENSP00000450228
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 12 52,904,676 - 52,907,060 (-) Ensembl
Ensembl Acc Id:
ENST00000546583
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 12 52,897,208 - 52,905,052 (-) Ensembl
Ensembl Acc Id:
ENST00000546826 ⟹ ENSP00000447881
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 12 52,899,935 - 52,949,882 (-) Ensembl
Ensembl Acc Id:
ENST00000546897 ⟹ ENSP00000447402
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 12 52,897,281 - 52,949,824 (-) Ensembl
Ensembl Acc Id:
ENST00000546900 ⟹ ENSP00000450340
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 12 52,900,588 - 52,903,648 (-) Ensembl
Ensembl Acc Id:
ENST00000546921
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 12 52,949,216 - 52,949,954 (-) Ensembl
Ensembl Acc Id:
ENST00000547031
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 12 52,898,469 - 52,901,867 (-) Ensembl
Ensembl Acc Id:
ENST00000547176 ⟹ ENSP00000449010
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 12 52,899,996 - 52,901,947 (-) Ensembl
Ensembl Acc Id:
ENST00000548998 ⟹ ENSP00000447040
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 12 52,900,008 - 52,949,776 (-) Ensembl
Ensembl Acc Id:
ENST00000549176
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 12 52,899,794 - 52,902,204 (-) Ensembl
Ensembl Acc Id:
ENST00000549198
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 12 52,948,484 - 52,949,831 (-) Ensembl
Ensembl Acc Id:
ENST00000550170
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 12 52,897,216 - 52,905,044 (-) Ensembl
Ensembl Acc Id:
ENST00000551318
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 12 52,948,651 - 52,949,920 (-) Ensembl
Ensembl Acc Id:
ENST00000552150 ⟹ ENSP00000449404
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 12 52,897,297 - 52,926,469 (-) Ensembl
Ensembl Acc Id:
ENST00000552551 ⟹ ENSP00000447566
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 12 52,897,187 - 52,949,842 (-) Ensembl
Ensembl Acc Id:
ENST00000619952 ⟹ ENSP00000489174
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 12 52,946,614 - 52,949,874 (-) Ensembl
Ensembl Acc Id:
ENST00000692008 ⟹ ENSP00000509398
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 12 52,897,191 - 52,905,076 (-) Ensembl
RefSeq Acc Id:
NM_001256282 ⟹ NP_001243211
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 12 52,897,191 - 52,926,469 (-) NCBI GRCh37 12 53,290,971 - 53,343,650 (-) NCBI HuRef 12 50,334,669 - 50,387,466 (-) NCBI CHM1_1 12 53,257,746 - 53,287,034 (-) NCBI T2T-CHM13v2.0 12 52,861,778 - 52,891,057 (-) NCBI
Sequence:
ATTCAGCAAATGTTTGCGGAATGAATGGGGTGAGCTGGAGCCAGGACCTGCAGGAAGGGATCTCCGCCTGGTTCGGCCCGCCTGCCTCCACTCCTGCCTCTACCATGTCCATCAGGGTGACCCAGAAG
hide sequence
RefSeq Acc Id:
NM_001256293 ⟹ NP_001243222
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 12 52,897,191 - 52,949,860 (-) NCBI HuRef 12 50,334,669 - 50,387,466 (-) NCBI CHM1_1 12 53,257,746 - 53,310,407 (-) NCBI T2T-CHM13v2.0 12 52,861,778 - 52,914,419 (-) NCBI
Sequence:
CTTTCCTTACCTCCCTCCATGCTGTCCACTTCCTCTGTAAAGCTCTCAACCCTGTCCCCTTCCC
hide sequence
RefSeq Acc Id:
NM_002273 ⟹ NP_002264
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 12 52,897,191 - 52,905,076 (-) NCBI GRCh37 12 53,290,971 - 53,343,650 (-) NCBI Build 36 12 51,577,238 - 51,585,127 (-) NCBI Archive HuRef 12 50,334,669 - 50,387,466 (-) NCBI CHM1_1 12 53,257,746 - 53,265,652 (-) NCBI T2T-CHM13v2.0 12 52,861,778 - 52,869,657 (-) NCBI
Sequence:
ATTCCTGAGAGCTCTCCTCACCAAGAAGCAGCTTCTCCGCTCCTTCTAGGATCTCCGCCTGGTT
hide sequence
RefSeq Acc Id:
NR_045962
RefSeq Status:
REVIEWED
Type:
NON-CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 12 52,897,191 - 52,949,860 (-) NCBI GRCh37 12 53,290,971 - 53,343,650 (-) NCBI HuRef 12 50,334,669 - 50,387,466 (-) NCBI CHM1_1 12 53,257,746 - 53,310,407 (-) NCBI T2T-CHM13v2.0 12 52,861,778 - 52,914,419 (-) NCBI
Sequence:
CTTTCCTTACCTCCCTCCATGCTGTCCACTTCCTCTGTAAAGCTCTCAACCCTGTCCCCTTCCC
hide sequence
RefSeq Acc Id:
XM_054372022 ⟹ XP_054227997
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 12 52,861,778 - 52,891,052 (-) NCBI
RefSeq Acc Id:
NP_002264 ⟸ NM_002273
- Peptide Label:
isoform 2
- UniProtKB:
Q6P4C7 (UniProtKB/Swiss-Prot), Q6GMY0 (UniProtKB/Swiss-Prot), Q6DHW5 (UniProtKB/Swiss-Prot), Q53GJ0 (UniProtKB/Swiss-Prot), Q14717 (UniProtKB/Swiss-Prot), Q14716 (UniProtKB/Swiss-Prot), Q14099 (UniProtKB/Swiss-Prot), F8VXB4 (UniProtKB/Swiss-Prot), B0AZN5 (UniProtKB/Swiss-Prot), A8K4H3 (UniProtKB/Swiss-Prot), Q96J60 (UniProtKB/Swiss-Prot), P05787 (UniProtKB/Swiss-Prot)
- Sequence:
MSIRVTQKSYKVSTSGPRAFSSRSYTSGPGSRISSSSFSRVGSSNFRGGLGGGYGGASGMGGITAVTVNQSLLSPLVLEVDPNIQAVRTQEKEQIKTLNNKFASFIDKVRFLEQQNKMLETKWSLLQQ
hide sequence
RefSeq Acc Id:
NP_001243222 ⟸ NM_001256293
- Peptide Label:
isoform 2
- UniProtKB:
Q6P4C7 (UniProtKB/Swiss-Prot), Q6GMY0 (UniProtKB/Swiss-Prot), Q6DHW5 (UniProtKB/Swiss-Prot), Q53GJ0 (UniProtKB/Swiss-Prot), Q14717 (UniProtKB/Swiss-Prot), Q14716 (UniProtKB/Swiss-Prot), Q14099 (UniProtKB/Swiss-Prot), F8VXB4 (UniProtKB/Swiss-Prot), B0AZN5 (UniProtKB/Swiss-Prot), A8K4H3 (UniProtKB/Swiss-Prot), Q96J60 (UniProtKB/Swiss-Prot), P05787 (UniProtKB/Swiss-Prot)
- Sequence:
MSIRVTQKSYKVSTSGPRAFSSRSYTSGPGSRISSSSFSRVGSSNFRGGLGGGYGGASGMGGITAVTVNQSLLSPLVLEVDPNIQAVRTQEKEQIKTLNNKFASFIDKVRFLEQQNKMLETKWSLLQQ
hide sequence
RefSeq Acc Id:
NP_001243211 ⟸ NM_001256282
- Peptide Label:
isoform 1
- UniProtKB:
Q7L4M3 (UniProtKB/TrEMBL)
- Sequence:
MNGVSWSQDLQEGISAWFGPPASTPASTMSIRVTQKSYKVSTSGPRAFSSRSYTSGPGSRISSSSFSRVGSSNFRGGLGGGYGGASGMGGITAVTVNQSLLSPLVLEVDPNIQAVRTQEKEQIKTLNN
hide sequence
Ensembl Acc Id:
ENSP00000293308 ⟸ ENST00000293308
Ensembl Acc Id:
ENSP00000450228 ⟸ ENST00000546542
Ensembl Acc Id:
ENSP00000450340 ⟸ ENST00000546900
Ensembl Acc Id:
ENSP00000447881 ⟸ ENST00000546826
Ensembl Acc Id:
ENSP00000447402 ⟸ ENST00000546897
Ensembl Acc Id:
ENSP00000449010 ⟸ ENST00000547176
Ensembl Acc Id:
ENSP00000447040 ⟸ ENST00000548998
Ensembl Acc Id:
ENSP00000489174 ⟸ ENST00000619952
Ensembl Acc Id:
ENSP00000447566 ⟸ ENST00000552551
Ensembl Acc Id:
ENSP00000449404 ⟸ ENST00000552150
Ensembl Acc Id:
ENSP00000509398 ⟸ ENST00000692008
RefSeq Acc Id:
XP_054227997 ⟸ XM_054372022
- Peptide Label:
isoform X1
RGD ID: 6810327 Promoter ID: HG_ACW:17071 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: K562, Lymphoblastoid, NB4 Transcripts: KRT8.NAPR07 Position: Human Assembly Chr Position (strand) Source Build 36 12 51,583,639 - 51,584,139 (-) MPROMDB
RGD ID: 6790185 Promoter ID: HG_KWN:15718 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: HeLa_S3, K562 Transcripts: NM_002273, UC009ZMJ.1 Position: Human Assembly Chr Position (strand) Source Build 36 12 51,584,766 - 51,585,266 (-) MPROMDB
RGD ID: 7224049 Promoter ID: EPDNEW_H17770 Type: initiation region Name: KRT8_1 Description: keratin 8 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 12 52,926,469 - 52,926,529 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-03-14
KRT8
keratin 8
keratin 8, type II
Symbol and/or name change
5135510 APPROVED
2015-01-27
KRT8
keratin 8, type II
keratin 8
Symbol and/or name change
5135510 APPROVED
