Symbol:
Grk2
Name:
G protein-coupled receptor kinase 2
RGD ID:
2062
Description:
Enables several functions, including opioid receptor binding activity; protein kinase activity; and scaffold protein binding activity. Involved in several processes, including blood vessel diameter maintenance; regulation of phosphate metabolic process; and regulation of signal transduction. Located in several cellular components, including basolateral plasma membrane; caveola; and dendrite. Is active in glutamatergic synapse; postsynaptic density; and presynapse. Used to study hyperglycemia; impotence; and limb ischemia. Biomarker of Parkinson's disease; congestive heart failure; hypertension; and portal hypertension. Orthologous to human GRK2 (G protein-coupled receptor kinase 2); PARTICIPATES IN dopamine signaling pathway via D2 family of receptors; G protein mediated signaling pathway; somatostatin signaling pathway; INTERACTS WITH 2,2',4,4'-Tetrabromodiphenyl ether; 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
Adrbk1; adrenergic receptor kinase, beta 1; adrenergic, beta, receptor kinase 1; BARK1; beta-adrenergic receptor kinase 1; beta-adrenergic receptor kinase 1 beta ARK1; beta-adrenergic receptor kinase 1, beta ARK1; beta-ARK-1; G-protein-coupled receptor kinase 2; G-protein-linked receptor kinase (beta adrenergic receptor kinase 1); GRK-2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Is Marker For:
Strains:
SHHF
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 211,010,259 - 211,031,013 (-) NCBI GRCr8 mRatBN7.2 1 201,580,823 - 201,601,580 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 201,581,480 - 201,601,582 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 209,932,926 - 209,953,677 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 217,026,270 - 217,047,026 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 209,717,288 - 209,738,044 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 219,536,220 - 219,544,329 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 219,536,220 - 219,544,328 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 226,406,333 - 226,414,442 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 206,873,002 - 206,892,868 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 207,026,454 - 207,034,564 (-) NCBI Celera 1 199,125,797 - 199,145,728 (-) NCBI Celera RH 3.4 Map 1 1560.2 RGD Cytogenetic Map 1 q43 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Grk2 Rat (R)-adrenaline multiple interactions ISO GRK2 (Homo sapiens) 6480464 Epinephrine promotes the reaction [GRK2 protein results in increased phosphorylation of ADRB2 protein] CTD PMID:14722251 Grk2 Rat 1,2-dimethylhydrazine multiple interactions ISO Grk2 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of GRK2 mRNA CTD PMID:22206623 Grk2 Rat 1,2-dimethylhydrazine increases expression ISO Grk2 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of GRK2 mRNA CTD PMID:22206623 Grk2 Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression EXP 6480464 2 more ... CTD PMID:27291303 Grk2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Grk2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of GRK2 mRNA CTD PMID:21570461 Grk2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of GRK2 mRNA CTD PMID:34747641 Grk2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of GRK2 mRNA CTD PMID:34747641 Grk2 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of GRK2 mRNA CTD PMID:21346803 Grk2 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of GRK2 mRNA CTD PMID:21346803 Grk2 Rat 2-arachidonoylglycerol multiple interactions ISO GRK2 (Homo sapiens) 6480464 [GRK2 protein co-treated with glyceryl 2-arachidonate] affects the reaction [CNR1 protein affects the localization of ARRB2 protein] more ... CTD PMID:31024316 Grk2 Rat 2-butoxyethanol decreases expression ISO Grk2 (Mus musculus) 6480464 n-butoxyethanol results in decreased expression of GRK2 mRNA CTD PMID:19812364 Grk2 Rat 2-palmitoylglycerol increases expression ISO GRK2 (Homo sapiens) 6480464 2-palmitoylglycerol results in increased expression of GRK2 mRNA CTD PMID:37199045 Grk2 Rat 3',5'-cyclic AMP multiple interactions ISO GRK2 (Homo sapiens) 6480464 [[GCG protein binds to and results in increased activity of GLP1R protein] which results in increased chemical synthesis of Cyclic AMP] promotes the reaction [GRK2 protein binds to GLP1R protein] CTD PMID:25191754 Grk2 Rat 4,4'-sulfonyldiphenol decreases expression ISO Grk2 (Mus musculus) 6480464 bisphenol S results in decreased expression of GRK2 mRNA CTD PMID:39298647 Grk2 Rat 4-hydroxy-TEMPO multiple interactions EXP 6480464 tempol inhibits the reaction [Streptozocin results in increased localization of GRK2 protein] CTD PMID:16478977 Grk2 Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of GRK2 mRNA CTD PMID:28959563 Grk2 Rat aflatoxin B1 increases expression ISO Grk2 (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of GRK2 mRNA CTD PMID:19770486 Grk2 Rat aflatoxin B1 decreases methylation ISO GRK2 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of GRK2 intron CTD PMID:30157460 Grk2 Rat Aflatoxin B2 alpha decreases methylation ISO GRK2 (Homo sapiens) 6480464 aflatoxin B2 results in decreased methylation of GRK2 exon CTD PMID:30157460 Grk2 Rat all-trans-retinoic acid increases expression ISO GRK2 (Homo sapiens) 6480464 Tretinoin results in increased expression of GRK2 mRNA CTD PMID:33167477 Grk2 Rat alprenolol multiple interactions ISO Grk2 (Mus musculus) 6480464 Alprenolol inhibits the reaction [ADRB2 results in increased expression of GRK2 protein] CTD PMID:12198331 Grk2 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of GRK2 mRNA CTD PMID:16483693 Grk2 Rat antirheumatic drug decreases expression ISO GRK2 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of GRK2 mRNA CTD PMID:24449571 Grk2 Rat arsenite(3-) increases expression ISO Grk2 (Mus musculus) 6480464 arsenite results in increased expression of GRK2 protein CTD PMID:37955338 Grk2 Rat atenolol decreases expression ISO Grk2 (Mus musculus) 6480464 Atenolol results in decreased expression of GRK2 mRNA and Atenolol results in decreased expression of GRK2 protein CTD PMID:9788834 Grk2 Rat benzo[a]pyrene increases expression ISO Grk2 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of GRK2 mRNA CTD PMID:19770486 Grk2 Rat benzo[a]pyrene affects methylation ISO GRK2 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of GRK2 exon CTD PMID:30157460 Grk2 Rat beta-lapachone increases expression ISO GRK2 (Homo sapiens) 6480464 beta-lapachone results in increased expression of GRK2 mRNA CTD PMID:38218311 Grk2 Rat beta-lapachone decreases expression ISO GRK2 (Homo sapiens) 6480464 beta-lapachone results in decreased expression of GRK2 mRNA CTD PMID:38218311 Grk2 Rat bexarotene increases expression EXP 6480464 bexarotene results in increased expression of GRK2 mRNA CTD PMID:16648578 Grk2 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of GRK2 mRNA CTD PMID:26141625 Grk2 Rat bisphenol A decreases methylation ISO GRK2 (Homo sapiens) 6480464 bisphenol A results in decreased methylation of GRK2 gene CTD PMID:31601247 Grk2 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of GRK2 mRNA CTD PMID:25181051 and PMID:30816183 Grk2 Rat bisphenol F decreases expression EXP 6480464 4 and 4'-bisphenol F results in decreased expression of GRK2 mRNA CTD PMID:26186136 Grk2 Rat caffeine decreases phosphorylation ISO GRK2 (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of GRK2 protein CTD PMID:35688186 Grk2 Rat carbon nanotube decreases expression ISO Grk2 (Mus musculus) 6480464 Nanotubes and Carbon results in decreased expression of GRK2 mRNA CTD PMID:25554681 Grk2 Rat carvedilol multiple interactions ISO GRK2 (Homo sapiens) 6480464 [carvedilol co-treated with ADRB2 protein] results in increased expression of GRK2 protein CTD PMID:10455254 Grk2 Rat carvedilol increases expression ISO Grk2 (Mus musculus) 6480464 carvedilol results in increased expression of GRK2 protein CTD PMID:10455254 Grk2 Rat carvedilol decreases expression ISO Grk2 (Mus musculus) 6480464 carvedilol results in decreased expression of GRK2 protein CTD PMID:9788834 Grk2 Rat carvedilol multiple interactions ISO Grk2 (Mus musculus) 6480464 carvedilol inhibits the reaction [ADRB2 results in increased expression of GRK2 protein] CTD PMID:12198331 Grk2 Rat chlorpyrifos multiple interactions EXP 6480464 Chlorpyrifos inhibits the reaction [GRK2 protein results in increased phosphorylation of CHRM2 protein] CTD PMID:16824341 Grk2 Rat chlorpyrifos increases expression ISO Grk2 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of GRK2 mRNA CTD PMID:37019170 Grk2 Rat chlorpyrifos increases expression EXP 6480464 Chlorpyrifos results in increased expression of GRK2 mRNA CTD PMID:20691718 Grk2 Rat chlorpyrifos decreases expression EXP 6480464 Chlorpyrifos results in decreased expression of GRK2 mRNA CTD PMID:17452286 Grk2 Rat cocaine affects expression EXP 6480464 Cocaine affects the expression of GRK2 mRNA CTD PMID:20187946 Grk2 Rat cocaine increases expression EXP 6480464 Cocaine results in increased expression of GRK2 mRNA CTD PMID:16076954 Grk2 Rat D-gluconic acid multiple interactions EXP 6480464 [gluconic acid co-treated with Deoxycholic Acid] results in increased expression of GRK2 mRNA CTD PMID:16556975 Grk2 Rat deoxycholic acid multiple interactions EXP 6480464 [gluconic acid co-treated with Deoxycholic Acid] results in increased expression of GRK2 mRNA CTD PMID:16556975 Grk2 Rat desipramine affects localization EXP 6480464 Desipramine affects the localization of GRK2 protein CTD PMID:12527474 Grk2 Rat dieldrin increases expression EXP 6480464 Dieldrin results in increased expression of GRK2 mRNA CTD PMID:18812211 Grk2 Rat diuron decreases expression ISO GRK2 (Homo sapiens) 6480464 Diuron results in decreased expression of GRK2 mRNA CTD PMID:35967413 Grk2 Rat dopamine multiple interactions ISO GRK2 (Homo sapiens) 6480464 GRK2 protein promotes the reaction [Dopamine promotes the reaction [DRD2 protein affects the localization of ARRB1 protein]] and GRK2 protein promotes the reaction [Dopamine promotes the reaction [DRD2 protein affects the localization of ARRB2 protein]] CTD PMID:31024316 Grk2 Rat doxorubicin decreases expression ISO GRK2 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of GRK2 mRNA CTD PMID:29803840 Grk2 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of GRK2 mRNA CTD PMID:29391264 Grk2 Rat ethanol multiple interactions ISO Grk2 (Mus musculus) 6480464 Ethanol affects the expression of and affects the splicing of GRK2 mRNA CTD PMID:30319688 Grk2 Rat folic acid multiple interactions ISO Grk2 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of GRK2 mRNA CTD PMID:22206623 Grk2 Rat FR900359 affects phosphorylation ISO GRK2 (Homo sapiens) 6480464 FR900359 affects the phosphorylation of GRK2 protein CTD PMID:37730182 Grk2 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of GRK2 mRNA CTD PMID:33387578 Grk2 Rat GW 1929 decreases expression EXP 6480464 GW 1929 results in decreased expression of GRK2 mRNA CTD PMID:19420904 Grk2 Rat ICI 118551 increases expression ISO Grk2 (Mus musculus) 6480464 ICI 118551 results in increased expression of GRK2 protein CTD PMID:10455254 Grk2 Rat ICI 118551 multiple interactions ISO GRK2 (Homo sapiens) 6480464 [ICI 118551 co-treated with ADRB2 protein] results in increased expression of GRK2 protein CTD PMID:10455254 Grk2 Rat isoprenaline increases expression EXP 6480464 Isoproterenol results in increased expression of GRK2 mRNA CTD PMID:16731636 Grk2 Rat isoprenaline increases expression ISO Grk2 (Mus musculus) 6480464 Isoproterenol results in increased expression of GRK2 mRNA and Isoproterenol results in increased expression of GRK2 protein CTD PMID:9788834 Grk2 Rat isoprenaline increases expression ISO GRK2 (Homo sapiens) 6480464 Isoproterenol results in increased expression of GRK2 protein CTD PMID:9788834 Grk2 Rat isoprenaline multiple interactions EXP 6480464 AGT affects the reaction [Isoproterenol results in decreased expression of GRK2 mRNA] CTD PMID:16731636 Grk2 Rat nickel atom increases expression EXP 6480464 Nickel results in increased expression of GRK2 mRNA CTD PMID:18812211 Grk2 Rat ozone multiple interactions ISO GRK2 (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of GRK2 mRNA CTD PMID:35430440 Grk2 Rat paracetamol affects expression ISO Grk2 (Mus musculus) 6480464 Acetaminophen affects the expression of GRK2 mRNA CTD PMID:17562736 Grk2 Rat paraquat decreases expression EXP 6480464 Paraquat results in decreased expression of GRK2 protein CTD PMID:24521700 Grk2 Rat phenylephrine multiple interactions ISO Grk2 (Mus musculus) 6480464 [Phenylephrine co-treated with ADRA1B protein] results in increased expression of GRK2 protein CTD PMID:11499749 Grk2 Rat phenylephrine increases expression EXP 6480464 Phenylephrine results in increased expression of GRK2 protein CTD PMID:28759639 Grk2 Rat phenylephrine multiple interactions EXP 6480464 GRK2 protein affects the reaction [Phenylephrine results in increased expression of MYH7 mRNA] more ... CTD PMID:28759639 Grk2 Rat propranolol multiple interactions ISO GRK2 (Homo sapiens) 6480464 [Propranolol co-treated with ADRB2 protein] results in increased expression of GRK2 protein CTD PMID:10455254 Grk2 Rat propranolol increases expression ISO Grk2 (Mus musculus) 6480464 Propranolol results in increased expression of GRK2 protein CTD PMID:10455254 Grk2 Rat propranolol decreases expression ISO GRK2 (Homo sapiens) 6480464 Propranolol results in decreased expression of GRK2 protein CTD PMID:9788834 Grk2 Rat protein kinase inhibitor multiple interactions ISO GRK2 (Homo sapiens) 6480464 Protein Kinase Inhibitors inhibits the reaction [gardiquimod results in increased expression of GRK2 mRNA] CTD PMID:28003376 Grk2 Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of GRK2 protein CTD PMID:35544339 Grk2 Rat S-nitroso-L-cysteine increases nitrosation ISO Grk2 (Mus musculus) 6480464 S-nitrosocysteine results in increased nitrosation of GRK2 protein CTD PMID:17482545 Grk2 Rat SCH772984 multiple interactions EXP 6480464 SCH772984 inhibits the reaction [APP protein modified form results in increased expression of GRK2 protein] CTD PMID:30399361 Grk2 Rat sevoflurane decreases methylation ISO Grk2 (Mus musculus) 6480464 Sevoflurane results in decreased methylation of GRK2 mRNA CTD PMID:35249202 Grk2 Rat sodium arsenite decreases expression ISO GRK2 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of GRK2 mRNA CTD PMID:25879800 Grk2 Rat streptozocin increases localization EXP 6480464 Streptozocin results in increased localization of GRK2 protein CTD PMID:16478977 Grk2 Rat streptozocin multiple interactions EXP 6480464 tempol inhibits the reaction [Streptozocin results in increased localization of GRK2 protein] CTD PMID:16478977 Grk2 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of GRK2 mRNA CTD PMID:34492290 Grk2 Rat titanium dioxide increases methylation ISO Grk2 (Mus musculus) 6480464 titanium dioxide results in increased methylation of GRK2 gene CTD PMID:35295148 Grk2 Rat titanium dioxide decreases methylation ISO Grk2 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of GRK2 gene CTD PMID:35295148 Grk2 Rat triphenyl phosphate affects expression ISO GRK2 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of GRK2 mRNA CTD PMID:37042841 Grk2 Rat valproic acid increases expression ISO Grk2 (Mus musculus) 6480464 Valproic Acid results in increased expression of GRK2 mRNA CTD PMID:21427059 Grk2 Rat valproic acid decreases expression ISO Grk2 (Mus musculus) 6480464 Valproic Acid results in decreased expression of GRK2 mRNA CTD PMID:21427059 Grk2 Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of GRK2 mRNA CTD PMID:19015723 Grk2 Rat WIN 55212-2 multiple interactions ISO GRK2 (Homo sapiens) 6480464 GRK2 protein affects the reaction [(3R)-((2 more ... CTD PMID:31024316 Grk2 Rat wortmannin multiple interactions EXP 6480464 wortmannin inhibits the reaction [GRK2 protein results in increased phosphorylation of AKT1 protein] more ... CTD PMID:28759639
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(R)-adrenaline (ISO) 1,2-dimethylhydrazine (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (EXP) 2,6-dinitrotoluene (EXP) 2-arachidonoylglycerol (ISO) 2-butoxyethanol (ISO) 2-palmitoylglycerol (ISO) 3',5'-cyclic AMP (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxy-TEMPO (EXP) acrylamide (EXP) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) all-trans-retinoic acid (ISO) alprenolol (ISO) ammonium chloride (EXP) antirheumatic drug (ISO) arsenite(3-) (ISO) atenolol (ISO) benzo[a]pyrene (ISO) beta-lapachone (ISO) bexarotene (EXP) bisphenol A (EXP,ISO) bisphenol F (EXP) caffeine (ISO) carbon nanotube (ISO) carvedilol (ISO) chlorpyrifos (EXP,ISO) cocaine (EXP) D-gluconic acid (EXP) deoxycholic acid (EXP) desipramine (EXP) dieldrin (EXP) diuron (ISO) dopamine (ISO) doxorubicin (ISO) endosulfan (EXP) ethanol (ISO) folic acid (ISO) FR900359 (ISO) gentamycin (EXP) GW 1929 (EXP) ICI 118551 (ISO) isoprenaline (EXP,ISO) nickel atom (EXP) ozone (ISO) paracetamol (ISO) paraquat (EXP) phenylephrine (EXP,ISO) propranolol (ISO) protein kinase inhibitor (ISO) rotenone (EXP) S-nitroso-L-cysteine (ISO) SCH772984 (EXP) sevoflurane (ISO) sodium arsenite (ISO) streptozocin (EXP) thioacetamide (EXP) titanium dioxide (ISO) triphenyl phosphate (ISO) valproic acid (ISO) vinclozolin (EXP) WIN 55212-2 (ISO) wortmannin (EXP)
Biological Process
cardiac muscle contraction (IEA,ISO) cellular response to catecholamine stimulus (IEP) cellular response to chemokine (IDA) cellular response to epidermal growth factor stimulus (IMP) cellular response to glucose stimulus (IDA) cellular response to phorbol 13-acetate 12-myristate (IEP) cellular response to rapamycin (IEP) desensitization of G protein-coupled receptor signaling pathway (IBA,IDA,IEA,IMP,ISO) follicle-stimulating hormone signaling pathway (IDA) G protein-coupled receptor signaling pathway (IBA,IDA,IEA,IEP,ISO) heart development (IEA,ISO) maintenance of protein location in nucleus (IMP) negative regulation of adenylate cyclase-activating G protein-coupled receptor signaling pathway (IMP) negative regulation of apoptotic process (IMP) negative regulation of apoptotic signaling pathway (IMP) negative regulation of cellular response to insulin stimulus (IMP) negative regulation of D-glucose import (IMP) negative regulation of peptidyl-serine phosphorylation (IMP) negative regulation of peptidyl-threonine phosphorylation (IMP) negative regulation of relaxation of smooth muscle (IEA,ISO,ISS) negative regulation of striated muscle contraction (IEA,ISO) negative regulation of the force of heart contraction by chemical signal (IEA,ISO) oligodendrocyte differentiation (IEP,IMP) peptidyl-serine phosphorylation (ISO) peptidyl-threonine phosphorylation (ISO) positive regulation of catecholamine secretion (IDA) positive regulation of ERK1 and ERK2 cascade (IMP) positive regulation of excitatory postsynaptic potential (IMP) positive regulation of fibroblast proliferation (IMP) positive regulation of interleukin-6 production (IMP) positive regulation of muscle cell apoptotic process (IMP) positive regulation of vascular associated smooth muscle cell proliferation (IMP) positive regulation of vasoconstriction (IMP) protein modification process (IDA) protein phosphorylation (ISO) receptor internalization (IEA,ISO) regulation of inositol trisphosphate biosynthetic process (IMP) regulation of the force of heart contraction (IBA,IEA,ISO) response to caloric restriction (IEP) response to hydrogen peroxide (IEP) response to leptin (IEP) response to muscle activity (IEP) response to oxidative stress (IDA) signal transduction (IEA) symbiont entry into host cell (IEA,ISO) tachykinin receptor signaling pathway (IEA,ISO) vasodilation (IMP) viral genome replication (IEA,ISO)
1.
Altered expression and subcellular distribution of GRK subtypes in the dopamine-depleted rat basal ganglia is not normalized by l-DOPA treatment.
Ahmed MR, etal., J Neurochem. 2008 Mar;104(6):1622-36. Epub 2007 Nov 7.
2.
The myocardial beta-adrenergic system in spontaneously hypertensive heart failure (SHHF) rats.
Anderson KM, etal., Hypertension. 1999 Jan;33(1 Pt 2):402-7.
3.
Impaired neutrophil chemotaxis in sepsis associates with GRK expression and inhibition of actin assembly and tyrosine phosphorylation.
Arraes SM, etal., Blood. 2006 Nov 1;108(9):2906-13. Epub 2006 Jul 18.
4.
The G-protein-coupled receptor kinases beta ARK1 and beta ARK2 are widely distributed at synapses in rat brain.
Arriza JL, etal., J Neurosci 1992 Oct;12(10):4045-55.
5.
Hydrogen peroxide causes uncoupling of dopamine D1-like receptors from G proteins via a mechanism involving protein kinase C and G-protein-coupled receptor kinase 2.
Asghar M, etal., Free Radic Biol Med. 2006 Jan 1;40(1):13-20. Epub 2005 Sep 8.
6.
Opsin 3 and 4 mediate light-induced pulmonary vasorelaxation that is potentiated by G protein-coupled receptor kinase 2 inhibition.
Barreto Ortiz S, etal., Am J Physiol Lung Cell Mol Physiol. 2018 Jan 1;314(1):L93-L106. doi: 10.1152/ajplung.00091.2017. Epub 2017 Sep 7.
7.
Effects of the dopamine D2 allosteric modulator, PAOPA, on the expression of GRK2, arrestin-3, ERK1/2, and on receptor internalization.
Basu D, etal., PLoS One. 2013 Aug 6;8(8):e70736. doi: 10.1371/journal.pone.0070736. Print 2013.
8.
The physiology, signaling, and pharmacology of dopamine receptors.
Beaulieu JM and Gainetdinov RR, Pharmacol Rev. 2011 Mar;63(1):182-217. doi: 10.1124/pr.110.002642. Epub 2011 Feb 8.
9.
GRK2 Constitutively Governs Peripheral Delta Opioid Receptor Activity.
Brackley AD, etal., Cell Rep. 2016 Sep 6;16(10):2686-2698. doi: 10.1016/j.celrep.2016.07.084. Epub 2016 Aug 25.
10.
Identification of a signaling cascade that maintains constitutive d-opioid receptor incompetence in peripheral sensory neurons.
Brackley AD, etal., J Biol Chem. 2017 May 26;292(21):8762-8772. doi: 10.1074/jbc.M117.776799. Epub 2017 Apr 5.
11.
ß1-adrenergic receptor and sphingosine-1-phosphate receptor 1 (S1PR1) reciprocal downregulation influences cardiac hypertrophic response and progression to heart failure: protective role of S1PR1 cardiac gene therapy.
Cannavo A, etal., Circulation. 2013 Oct 8;128(15):1612-22. doi: 10.1161/CIRCULATIONAHA.113.002659. Epub 2013 Aug 22.
12.
ß Adrenergic Receptor Kinase C-Terminal Peptide Gene-Therapy Improves ß2-Adrenergic Receptor-Dependent Neoangiogenesis after Hindlimb Ischemia.
Cannavo A, etal., J Pharmacol Exp Ther. 2016 Feb;356(2):503-13. doi: 10.1124/jpet.115.228411. Epub 2015 Nov 24.
13.
Prodeath signaling of G protein-coupled receptor kinase 2 in cardiac myocytes after ischemic stress occurs via extracellular signal-regulated kinase-dependent heat shock protein 90-mediated mitochondrial targeting.
Chen M, etal., Circ Res. 2013 Apr 12;112(8):1121-34. doi: 10.1161/CIRCRESAHA.112.300754. Epub 2013 Mar 6.
14.
Desensitization of G-protein-coupled receptors induces vascular hypocontractility in response to norepinephrine in the mesenteric arteries of cirrhotic patients and rats.
Chen W, etal., Hepatobiliary Pancreat Dis Int. 2013 Jun;12(3):295-304.
15.
G protein coupled receptor kinase-2 upregulation causes ¿-opioid receptor desensitization in diabetic heart.
Chen X, etal., Biochem Biophys Res Commun. 2017 Jan 22;482(4):658-664. doi: 10.1016/j.bbrc.2016.11.090. Epub 2016 Nov 16.
16.
GRK2/ß-arrestin mediates arginine vasopressin-induced cardiac fibroblast proliferation.
Chen Y, etal., Clin Exp Pharmacol Physiol. 2017 Feb;44(2):285-293. doi: 10.1111/1440-1681.12696.
17.
Does GRK-ß arrestin machinery work as a "switch on" for GPR17-mediated activation of intracellular signaling pathways?
Daniele S, etal., Cell Signal. 2014 Jun;26(6):1310-25. doi: 10.1016/j.cellsig.2014.02.016. Epub 2014 Mar 5.
18.
Dexmedetomidine alleviates rat post-ischemia induced allodynia through GRK2 upregulation in superior cervical ganglia.
Dong J, etal., Auton Neurosci. 2015 Jan;187:76-83. doi: 10.1016/j.autneu.2014.10.024. Epub 2014 Nov 1.
19.
GRK mythology: G-protein receptor kinases in cardiovascular disease.
Dorn GW 2nd J Mol Med (Berl). 2009 May;87(5):455-63. Epub 2009 Feb 20.
20.
Glytan decreases portal pressure via mesentery vasoconstriction in portal hypertensive rats.
Du QH, etal., World J Gastroenterol. 2014 Nov 28;20(44):16674-82. doi: 10.3748/wjg.v20.i44.16674.
21.
Beta-adrenergic stimulation and myocardial function in the failing heart.
El-Armouche A and Eschenhagen T, Heart Fail Rev. 2009 Dec;14(4):225-41.
22.
Transient decrease in nociceptor GRK2 expression produces long-term enhancement in inflammatory pain.
Ferrari LF, etal., Neuroscience. 2012 Oct 11;222:392-403. doi: 10.1016/j.neuroscience.2012.07.004. Epub 2012 Jul 13.
23.
Decreased immunodensities of micro-opioid receptors, receptor kinases GRK 2/6 and beta-arrestin-2 in postmortem brains of opiate addicts.
Ferrer-Alcón M, etal., Brain Res Mol Brain Res. 2004 Feb 5;121(1-2):114-22. doi: 10.1016/j.molbrainres.2003.11.009.
24.
The ubiquitin ligase Mdm2 controls oligodendrocyte maturation by intertwining mTOR with G protein-coupled receptor kinase 2 in the regulation of GPR17 receptor desensitization.
Fumagalli M, etal., Glia. 2015 Dec;63(12):2327-39. doi: 10.1002/glia.22896. Epub 2015 Jul 31.
25.
ß-Arrestin 1 and 2 and G protein-coupled receptor kinase 2 expression in pituitary adenomas: role in the regulation of response to somatostatin analogue treatment in patients with acromegaly.
Gatto F, etal., Endocrinology. 2013 Dec;154(12):4715-25. doi: 10.1210/en.2013-1672. Epub 2013 Oct 29.
26.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
27.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
28.
G-Protein-coupled receptor kinase activity in hypertension : increased vascular and lymphocyte G-protein receptor kinase-2 protein expression.
Gros R, etal., Hypertension. 2000 Jan;35(1 Pt 1):38-42.
29.
Biventricular differences in ß-adrenergic receptor signaling following burn injury.
Guillory AN, etal., PLoS One. 2017 Dec 12;12(12):e0189527. doi: 10.1371/journal.pone.0189527. eCollection 2017.
30.
Molecular properties of muscarinic acetylcholine receptors.
Haga T Proc Jpn Acad Ser B Phys Biol Sci. 2013;89(6):226-56.
31.
Cardiac beta ARK1 inhibition prolongs survival and augments beta blocker therapy in a mouse model of severe heart failure.
Harding VB, etal., Proc Natl Acad Sci U S A 2001 May 8;98(10):5809-14. Epub 2001 May 1.
32.
Prolonged Morphine Treatment Alters Expression and Plasma Membrane Distribution of ß-Adrenergic Receptors and Some Other Components of Their Signaling System in Rat Cerebral Cortex.
Hejnova L, etal., J Mol Neurosci. 2017 Dec;63(3-4):364-376. doi: 10.1007/s12031-017-0987-9. Epub 2017 Oct 28.
33.
Vascular dysfunction in human and rat cirrhosis: role of receptor-desensitizing and calcium-sensitizing proteins.
Hennenberg M, etal., Hepatology. 2007 Feb;45(2):495-506.
34.
Endothelin-1 suppresses insulin-stimulated Akt phosphorylation and glucose uptake via GPCR kinase 2 in skeletal muscle cells.
Horinouchi T, etal., Br J Pharmacol. 2016 Mar;173(6):1018-32. doi: 10.1111/bph.13406. Epub 2016 Feb 15.
35.
Convergence of G protein-coupled receptor and S-nitrosylation signaling determines the outcome to cardiac ischemic injury.
Huang ZM, etal., Sci Signal. 2013 Oct 29;6(299):ra95. doi: 10.1126/scisignal.2004225.
36.
G protein-coupled receptor kinase (GRK)2 is a key negative regulator of itch: L-glutamine attenuates itch via a rapid induction of GRK2 in an ERK-dependent way.
Im YN, etal., J Invest Dermatol. 2018 Mar 9. pii: S0022-202X(18)30220-3. doi: 10.1016/j.jid.2018.02.036.
37.
GRK2 Up-Regulation Creates a Positive Feedback Loop for Catecholamine Production in Chromaffin Cells.
Jafferjee M, etal., Mol Endocrinol. 2016 Mar;30(3):372-81. doi: 10.1210/me.2015-1305. Epub 2016 Feb 5.
38.
Small molecule disruption of G protein ß¿ subunit signaling reprograms human macrophage phenotype and prevents autoimmune myocarditis in rats.
Karuppagounder V, etal., PLoS One. 2018 Jul 19;13(7):e0200697. doi: 10.1371/journal.pone.0200697. eCollection 2018.
39.
The GRK2 Promoter Is Regulated by Early-Growth Response Transcription Factor EGR-1.
Klenke S, etal., Basic Clin Pharmacol Toxicol. 2018 Jun 15. doi: 10.1111/bcpt.13055.
40.
High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.
Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
41.
Parathyroid hormone signaling in bone and kidney.
Lee M and Partridge NC, Curr Opin Nephrol Hypertens. 2009 Jul;18(4):298-302. doi: 10.1097/MNH.0b013e32832c2264.
42.
Downregulation of Spinal G Protein-Coupled Kinase 2 Abolished the Antiallodynic Effect of Electroacupuncture.
Liu H, etal., Evid Based Complement Alternat Med. 2015;2015:848603. doi: 10.1155/2015/848603. Epub 2015 Apr 29.
43.
Caveolin 1 and G-Protein-Coupled Receptor Kinase-2 Coregulate Endothelial Nitric Oxide Synthase Activity in Sinusoidal Endothelial Cells.
Liu S, etal., Am J Pathol. 2017 Apr;187(4):896-907. doi: 10.1016/j.ajpath.2016.11.017. Epub 2017 Feb 3.
44.
A crucial role for GRK2 in regulation of endothelial cell nitric oxide synthase function in portal hypertension.
Liu S, etal., Nat Med. 2005 Sep;11(9):952-8. Epub 2005 Sep 4.
45.
Decreased expression and activity of G-protein-coupled receptor kinases in peripheral blood mononuclear cells of patients with rheumatoid arthritis.
Lombardi MS, etal., FASEB J. 1999 Apr;13(6):715-25.
46.
A Single Intrathecal or Intraperitoneal Injection of CB2 Receptor Agonist Attenuates Bone Cancer Pain and Induces a Time-Dependent Modification of GRK2.
Lu C, etal., Cell Mol Neurobiol. 2017 Jan;37(1):101-109. doi: 10.1007/s10571-016-0349-0. Epub 2016 Mar 2.
47.
Modulation of adrenal catecholamine secretion by in vivo gene transfer and manipulation of G protein-coupled receptor kinase-2 activity.
Lymperopoulos A, etal., Mol Ther. 2008 Feb;16(2):302-7. doi: 10.1038/sj.mt.6300371. Epub 2007 Nov 27.
48.
G protein-coupled receptor kinase 2 and beta-arrestins are recruited to FSH receptor in stimulated rat primary Sertoli cells.
Marion S, etal., J Endocrinol. 2006 Aug;190(2):341-50.
49.
Tempol reduces oxidative stress and restores renal dopamine D1-like receptor- G protein coupling and function in hyperglycemic rats.
Marwaha A and Lokhandwala MF, Am J Physiol Renal Physiol. 2006 Jul;291(1):F58-66. Epub 2006 Feb 14.
50.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
51.
beta2- and beta1-Adrenoceptor Expression Exhibits a Common Regulatory Pattern With GRK2 and GRK5 in Human and Animal Models of Cardiovascular Diseases.
Monto F, etal., J Cardiovasc Pharmacol. 2015 Nov;66(5):478-86. doi: 10.1097/FJC.0000000000000299.
52.
G protein-coupled receptor kinase 2 and arrestin2 regulate arterial smooth muscle P2Y-purinoceptor signalling.
Morris GE, etal., Cardiovasc Res. 2011 Jan 1;89(1):193-203. Epub 2010 Aug 12.
53.
Differential regulation of ß2-adrenoceptor and adenosine A2B receptor signalling by GRK and arrestin proteins in arterial smooth muscle.
Nash CA, etal., Cell Signal. 2018 Nov;51:86-98. doi: 10.1016/j.cellsig.2018.07.013. Epub 2018 Jul 31.
54.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
55.
Hypertensive left ventricular hypertrophy: relation to beta-adrenergic receptor kinase-1 (betaARK1) in peripheral lymphocytes.
Park SJ, etal., J Hypertens. 2004 May;22(5):1025-32.
56.
Leptin-induced downregulation of the rat hippocampal somatostatinergic system may potentiate its anorexigenic effects.
Perianes-Cachero A, etal., Neurochem Int. 2012 Dec;61(8):1385-96. doi: 10.1016/j.neuint.2012.09.019. Epub 2012 Oct 13.
57.
Beta-arrestin- and G protein receptor kinase-mediated calcium-sensing receptor desensitization.
Pi M, etal., Mol Endocrinol. 2005 Apr;19(4):1078-87. Epub 2005 Jan 6.
58.
GRK2-mediated inhibition of adrenergic and dopaminergic signaling in right ventricular hypertrophy: therapeutic implications in pulmonary hypertension.
Piao L, etal., Circulation. 2012 Dec 11;126(24):2859-69. doi: 10.1161/CIRCULATIONAHA.112.109868. Epub 2012 Nov 2.
59.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
60.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
61.
Radiofrequency Renal Denervation Protects the Ischemic Heart via Inhibition of GRK2 and Increased Nitric Oxide Signaling.
Polhemus DJ, etal., Circ Res. 2016 Jul 22;119(3):470-80. doi: 10.1161/CIRCRESAHA.115.308278. Epub 2016 Jun 13.
62.
GOA pipeline
RGD automated data pipeline
63.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
64.
G protein-coupled receptor kinase 2 (GRK2) is a Rho-activated scaffold protein for the ERK MAP kinase cascade.
Robinson JD and Pitcher JA, Cell Signal. 2013 Dec;25(12):2831-9. doi: 10.1016/j.cellsig.2013.08.031. Epub 2013 Sep 7.
65.
Expression of a beta-adrenergic receptor kinase 1 inhibitor prevents the development of myocardial failure in gene-targeted mice.
Rockman HA, etal., Proc Natl Acad Sci U S A 1998 Jun 9;95(12):7000-5.
66.
IL-8 inhibits cAMP-stimulated alveolar epithelial fluid transport via a GRK2/PI3K-dependent mechanism.
Roux J, etal., FASEB J. 2013 Mar;27(3):1095-106. doi: 10.1096/fj.12-219295. Epub 2012 Dec 6.
67.
G protein-coupled receptor kinase 2 promotes cardiac hypertrophy.
Schlegel P, etal., PLoS One. 2017 Jul 31;12(7):e0182110. doi: 10.1371/journal.pone.0182110. eCollection 2017.
68.
Decline in caveolin-1 expression and scaffolding of G protein receptor kinase-2 with age in Fischer 344 aortic vascular smooth muscle.
Schutzer WE, etal., Am J Physiol Heart Circ Physiol. 2005 May;288(5):H2457-64. Epub 2004 Dec 30.
69.
Angiotensin II-stimulated signaling through G proteins and beta-arrestin.
Shenoy SK and Lefkowitz RJ, Sci STKE. 2005 Nov 22;2005(311):cm14.
70.
Integrating GRK2 and NFkappaB in the Pathophysiology of Cardiac Hypertrophy.
Sorriento D, etal., J Cardiovasc Transl Res. 2015 Nov;8(8):493-502. doi: 10.1007/s12265-015-9646-0. Epub 2015 Jul 30.
71.
Anabolic effects of a G protein-coupled receptor kinase inhibitor expressed in osteoblasts.
Spurney RF, etal., J Clin Invest 2002 May;109(10):1361-71.
72.
Granulocyte chemotaxis and disease expression are differentially regulated by GRK subtype in an acute inflammatory arthritis model (K/BxN).
Tarrant TK, etal., Clin Immunol. 2008 Oct;129(1):115-22. Epub 2008 Jul 26.
73.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
74.
Regulation of cellular oxidative stress and apoptosis by G protein-coupled receptor kinase-2; The role of NADPH oxidase 4.
Theccanat T, etal., Cell Signal. 2016 Mar;28(3):190-203. doi: 10.1016/j.cellsig.2015.11.013. Epub 2015 Nov 27.
75.
Gene expression analysis of TREM1 and GRK2 in polymorphonuclear leukocytes as the surrogate biomarkers of acute bacterial infections.
Ubagai T, etal., Int J Med Sci. 2014 Jan 10;11(2):215-21. doi: 10.7150/ijms.7231. eCollection 2014.
76.
G protein-coupled receptor kinase 2 mediates endothelin-1-induced insulin resistance via the inhibition of both Galphaq/11 and insulin receptor substrate-1 pathways in 3T3-L1 adipocytes.
Usui I, etal., Mol Endocrinol. 2005 Nov;19(11):2760-8. Epub 2005 Jun 30.
77.
Renoprotective effects of berberine and its possible molecular mechanisms in combination of high-fat diet and low-dose streptozotocin-induced diabetic rats.
Wang FL, etal., Mol Biol Rep. 2013 Mar;40(3):2405-18. doi: 10.1007/s11033-012-2321-5. Epub 2012 Nov 30.
78.
Paroxetine alleviates T lymphocyte activation and infiltration to joints of collagen-induced arthritis.
Wang Q, etal., Sci Rep. 2017 Mar 28;7:45364. doi: 10.1038/srep45364.
79.
G protein-coupled receptor kinase 2 inhibition improves erectile function through amelioration of endothelial dysfunction and oxidative stress in a rat model of type 2 diabetes.
Wans ZH, etal., Asian J Androl. 2018 Sep 14. pii: 241306.
80.
The regulation of M1 muscarinic acetylcholine receptor desensitization by synaptic activity in cultured hippocampal neurons.
Willets JM, etal., J Neurochem. 2007 Dec;103(6):2268-80. Epub 2007 Oct 1.
81.
The glial-neuronal GRK2 pathway participates in the development of trigeminal neuropathic pain in rats.
Won KA, etal., J Pain. 2014 Mar;15(3):250-61. doi: 10.1016/j.jpain.2013.10.013. Epub 2013 Nov 8.
82.
Cardiac Fibroblast GRK2 Deletion Enhances Contractility and Remodeling Following Ischemia/Reperfusion Injury.
Woodall MC, etal., Circ Res. 2016 Oct 28;119(10):1116-1127. doi: 10.1161/CIRCRESAHA.116.309538. Epub 2016 Sep 6.
83.
Improvement of vascular insulin sensitivity by downregulation of GRK2 mediates exercise-induced alleviation of hypertension in spontaneously hypertensive rats.
Xing W, etal., Am J Physiol Heart Circ Physiol. 2013 Oct 15;305(8):H1111-9. doi: 10.1152/ajpheart.00290.2013. Epub 2013 Aug 2.
84.
GRK2 Mediates Arginine Vasopressin-Induced Interleukin-6 Production via Nuclear Factor-¿B Signaling Neonatal Rat Cardiac Fibroblast.
Xu F, etal., Mol Pharmacol. 2017 Sep;92(3):278-284. doi: 10.1124/mol.116.107698. Epub 2017 Feb 13.
85.
Myocyte redistribution of GRK2 and GRK5 in hypertensive, heart-failure-prone rats.
Yi XP, etal., Hypertension 2002 Jun;39(6):1058-63.
86.
A Non-Canonical Function of Gbeta as a Subunit of E3 Ligase in Targeting GRK2 Ubiquitylation.
Zha Z, etal., Mol Cell. 2015 Jun 4;58(5):794-803. doi: 10.1016/j.molcel.2015.04.017. Epub 2015 May 14.
87.
Vasopressin V1Areceptor mediates cell proliferation through GRK2-EGFR-ERK1/2pathway in A7r5 cells.
Zhang L, etal., Eur J Pharmacol. 2016 Dec 5;792:15-25. doi: 10.1016/j.ejphar.2016.10.023. Epub 2016 Oct 20.
88.
(-)-Epigallocatechin-3-gallate, the major green tea catechin, regulates the desensitization of ß1 adrenoceptor via GRK2 in experimental heart failure.
Zhang Q, etal., Inflammopharmacology. 2017 Dec 16. pii: 10.1007/s10787-017-0429-x. doi: 10.1007/s10787-017-0429-x.
89.
Inhibition of ß-ARK1 Ameliorates Morphine-induced Tolerance and Hyperalgesia Via Modulating the Activity of Spinal NMDA Receptors.
Zhang X, etal., Mol Neurobiol. 2017 Oct 3. pii: 10.1007/s12035-017-0780-3. doi: 10.1007/s12035-017-0780-3.
90.
2K1C-activated Angiotensin II (Ang II) exacerbates vascular damage in a rat model of arthritis through the ATR/ERK1/2 signaling pathway.
Zhang Y, etal., Inflamm Res. 2017 Oct;66(10):881-890. doi: 10.1007/s00011-017-1069-8. Epub 2017 Jun 26.
91.
Immune Tolerance Effect in Mesenteric Lymph Node Lymphocytes of Geniposide on Adjuvant Arthritis Rats.
Zhang ZR, etal., Phytother Res. 2017 Aug;31(8):1249-1256. doi: 10.1002/ptr.5847. Epub 2017 Jun 19.
92.
Arginine vasopressin enhances cell survival via a G protein-coupled receptor kinase 2/ß-arrestin1/extracellular-regulated kinase 1/2-dependent pathway in H9c2 cells.
Zhu W, etal., Mol Pharmacol. 2013 Aug;84(2):227-35. doi: 10.1124/mol.113.086322. Epub 2013 May 20.
93.
Dysregulation of cannabinoid CB1 receptor and associated signaling networks in brains of cocaine addicts and cocaine-treated rodents.
Álvaro-Bartolomé M and García-Sevilla JA, Neuroscience. 2013 Sep 5;247:294-308. doi: 10.1016/j.neuroscience.2013.05.035. Epub 2013 May 29.
Grk2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 211,010,259 - 211,031,013 (-) NCBI GRCr8 mRatBN7.2 1 201,580,823 - 201,601,580 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 201,581,480 - 201,601,582 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 209,932,926 - 209,953,677 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 217,026,270 - 217,047,026 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 209,717,288 - 209,738,044 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 219,536,220 - 219,544,329 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 219,536,220 - 219,544,328 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 226,406,333 - 226,414,442 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 206,873,002 - 206,892,868 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 207,026,454 - 207,034,564 (-) NCBI Celera 1 199,125,797 - 199,145,728 (-) NCBI Celera RH 3.4 Map 1 1560.2 RGD Cytogenetic Map 1 q43 NCBI
GRK2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 11 67,266,473 - 67,286,556 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 11 67,266,473 - 67,286,556 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 11 67,033,944 - 67,054,027 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 11 66,790,481 - 66,810,605 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 11 66,790,668 - 66,810,945 NCBI Celera 11 64,377,313 - 64,386,599 (+) NCBI Celera Cytogenetic Map 11 q13.2 NCBI HuRef 11 63,362,803 - 63,382,690 (+) NCBI HuRef CHM1_1 11 66,912,110 - 66,937,037 (+) NCBI CHM1_1 T2T-CHM13v2.0 11 67,260,429 - 67,280,532 (+) NCBI T2T-CHM13v2.0
Grk2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 19 4,336,029 - 4,356,356 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 19 4,336,029 - 4,356,250 (-) Ensembl GRCm39 Ensembl GRCm38 19 4,285,999 - 4,306,222 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 19 4,286,001 - 4,306,222 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 19 4,286,001 - 4,305,955 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 19 4,286,001 - 4,305,955 (-) NCBI MGSCv36 mm8 Celera 19 4,157,228 - 4,177,197 (-) NCBI Celera Cytogenetic Map 19 A NCBI cM Map 19 3.98 NCBI
Grk2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955422 18,170,616 - 18,192,412 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955422 18,173,438 - 18,192,357 (-) NCBI ChiLan1.0 ChiLan1.0
GRK2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 9 68,493,145 - 68,513,349 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 11 69,535,713 - 69,555,914 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 11 62,624,647 - 62,644,846 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 11 65,939,169 - 65,959,066 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 11 65,939,164 - 65,959,066 (+) Ensembl panpan1.1 panPan2
GRK2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 18 50,148,566 - 50,167,422 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 18 50,148,598 - 50,167,428 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 18 48,758,688 - 48,777,641 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 18 51,097,619 - 51,116,589 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 18 51,097,625 - 51,116,667 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 18 50,283,520 - 50,302,482 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 18 49,858,001 - 49,876,975 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 18 50,652,610 - 50,671,586 (-) NCBI UU_Cfam_GSD_1.0
Grk2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404947 5,994,712 - 6,013,796 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936599 2,437,032 - 2,456,147 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936599 2,437,061 - 2,456,141 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
GRK2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 2 5,209,439 - 5,227,758 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 2 5,209,435 - 5,227,543 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 2 3,992,505 - 4,000,952 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
GRK2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 1 6,975,202 - 6,995,369 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 1 6,975,002 - 6,995,259 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666038 104,263,440 - 104,283,759 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Grk2
.
Predicted Target Of
Count of predictions: 231 Count of miRNA genes: 137 Interacting mature miRNAs: 164 Transcripts: ENSRNOT00000025847 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1578778 Pur4 Proteinuria QTL 4 3.3 0.003 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 1 150700247 252085048 Rat 1354646 Kidm18 Kidney mass QTL 18 5.7 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 256448636 Rat 1357335 Bw39 Body weight QTL 39 3.3 body mass (VT:0001259) body weight (CMO:0000012) 1 197814409 242814409 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 2302375 Bw83 Body weight QTL 83 4.87 0.0002 body mass (VT:0001259) body weight (CMO:0000012) 1 197697768 242697768 Rat 1354652 Kidm20 Kidney mass QTL 20 4.3 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 177227632 256448636 Rat 2293674 Bss39 Bone structure and strength QTL 39 7.1 0.0001 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 1 201554356 246554356 Rat 2302378 Insul11 Insulin level QTL 11 3.25 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 1 144267353 251128347 Rat 1354653 Despr9 Despair related QTL 9 0.00019 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 1 167909849 212909849 Rat 2293673 Bss27 Bone structure and strength QTL 27 18.63 0.0001 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 1 171629477 216629477 Rat 2293677 Bss41 Bone structure and strength QTL 41 9.38 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 1 171629477 216629477 Rat 1302787 Stl25 Serum triglyceride level QTL 25 2.7 0.0073 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 1 180359209 210702199 Rat 1549830 Bss1 Bone structure and strength QTL 1 4.8 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 1 172609619 217609619 Rat 7794788 Mcs32 Mammary carcinoma susceptibility QTL 32 2.61 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 1 115540693 238914717 Rat 70163 Bw20 Body weight QTL 20 5.1 body mass (VT:0001259) body weight (CMO:0000012) 1 174133260 219133260 Rat 1578763 Kidm29 Kidney mass QTL 29 3.3 0.0001 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 1 179567751 260522016 Rat 1600395 Niddm69 Non-insulin dependent diabetes mellitus QTL 69 4.14 0.0002 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 195804352 257091168 Rat 1354624 Cm35 Cardiac mass QTL35 5.7 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 177227632 256448636 Rat 1600396 Niddm68 Non-insulin dependent diabetes mellitus QTL 68 4.97 0.0003 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 195804352 257091168 Rat 1558658 Bw59 Body weight QTL 59 3.5 0.0003 body mass (VT:0001259) body weight (CMO:0000012) 1 178784622 223784622 Rat 631838 Niddm36 Non-insulin dependent diabetes mellitus QTL 36 0.01 insulin secretion trait (VT:0003564) calculated pancreatic islet insulin release measurement (CMO:0001217) 1 184550676 229550676 Rat 1549837 Hcar15 Hepatocarcinoma resistance QTL 15 0.05 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 153136852 260522016 Rat 2293689 Bss47 Bone structure and strength QTL 47 7.25 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra trabecular cross-sectional area (CMO:0001692) 1 171629477 216629477 Rat 152025235 Bw194 Body weight QTL 194 4.86 body mass (VT:0001259) 1 123556856 242907031 Rat 1600388 Niddm67 Non-insulin dependent diabetes mellitus QTL 67 5.84 0.000004 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 195804352 257091168 Rat 2293694 Bss38 Bone structure and strength QTL 38 7.05 0.0001 femur strength trait (VT:0010010) femur stiffness (CMO:0001674) 1 201554356 246554356 Rat 1598853 Memor3 Memory QTL 3 4.5 exploratory behavior trait (VT:0010471) total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443) 1 143506580 212458660 Rat 61341 Bp26 Blood pressure QTL 26 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 169537671 214537671 Rat 1578759 Uae30 Urinary albumin excretion QTL 30 3.3 0.003 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 150700247 252085048 Rat 2293693 Bss22 Bone structure and strength QTL 22 33.52 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 1 171629477 216629477 Rat 2300161 Bmd43 Bone mineral density QTL 43 8.4 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 171629477 216629477 Rat 1300145 Rf7 Renal function QTL 7 2.96 urine creatinine amount (VT:0010540) urine creatinine level (CMO:0000125) 1 185145134 221264292 Rat 61347 Bp197 Blood pressure QTL 197 4.2 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 1 158633083 203633083 Rat 8655655 Arrd2 Age-related retinal degeneration QTL 2 7.79 retinal layer morphology trait (VT:0003727) percentage of study population developing retinopathy during a period of time (CMO:0002453) 1 183970203 243914901 Rat 1358898 Bp255 Blood pressure QTL 255 3.6 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 191019702 246062233 Rat 631214 Bw61 Body weight QTL61 3.4 0.0001 intramuscular adipose amount (VT:0010044) intramuscular fat area (CMO:0001162) 1 173108781 218108781 Rat 7771612 Cm80 Cardiac mass QTL 80 8.4 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 1 149448574 221264292 Rat 731168 Bp154 Blood pressure QTL 154 3.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94642644 214537671 Rat 2300175 Bmd40 Bone mineral density QTL 40 15.4 0.0001 femur mineral mass (VT:0010011) bone mineral density (CMO:0001226) 1 201554356 246554356 Rat 2300174 Bmd42 Bone mineral density QTL 42 8.4 0.0001 lumbar vertebra mineral mass (VT:0010511) bone mineral density (CMO:0001226) 1 171629477 216629477 Rat 737828 Hcas3 Hepatocarcinoma susceptibility QTL 3 4.9 liver integrity trait (VT:0010547) liver tumorous lesion volume to total liver volume ratio (CMO:0001082) 1 144267353 222987745 Rat 1354661 Bw33 Body weight QTL 33 5.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 1358886 Bp260 Blood pressure QTL 260 3.67 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 151162766 225824951 Rat 737977 Bp160 Blood pressure QTL 160 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 181133855 226133855 Rat 2293654 Bss30 Bone structure and strength QTL 30 32.65 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 1 171629477 216629477 Rat 2293655 Bss36 Bone structure and strength QTL 36 10.66 0.0001 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 1 201554356 246554356 Rat 1298084 Thym4 Thymus enlargement QTL 4 10.68 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 1 197814409 242814409 Rat 724531 Uae5 Urinary albumin excretion QTL 5 4 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 1 150700142 252085212 Rat 2300187 Bmd41 Bone mineral density QTL 41 8.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 171629477 216629477 Rat 2314011 Gluco56 Glucose level QTL 56 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 199773958 202166723 Rat 8552891 Epfw5 Epididymal fat weight QTL 5 4.4 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 1 193113876 238113876 Rat 1359018 Hrtrt20 Heart rate QTL 20 3.08 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 185356336 202902618 Rat 1354580 Scort1 Serum corticosterone level QTL 1 3.4 blood corticosterone amount (VT:0005345) blood corticosterone level (CMO:0001172) 1 156677124 256448636 Rat 1358292 Cm37 Cardiac mass QTL 37 6.2 8e-07 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 1 196248093 241248093 Rat 61376 Bp42 Blood pressure QTL 42 23.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 197814409 242814409 Rat 634313 Niddm43 Non-insulin dependent diabetes mellitus QTL 43 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 199050459 259647894 Rat 634312 Bp143 Blood pressure QTL 143 3 0.0002 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 182623426 219932796 Rat 1358294 Bw37 Body weight QTL 37 5 0.000011 body mass (VT:0001259) body weight (CMO:0000012) 1 171310381 216310381 Rat 724559 Pancm1 Pancreatic morphology QTL 1 7.1 islet of Langerhans morphology trait (VT:0005215) pancreatic islet damage composite score (CMO:0001156) 1 181759564 214537555 Rat 2312420 Pur17 Proteinuria QTL 17 7.1 0.0001 urine protein amount (VT:0005160) urine total protein excretion rate (CMO:0000756) 1 156677124 218753816 Rat 10059600 Bp378 Blood pressure QTL 378 3.08 0.05 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 176869060 221869060 Rat 7421630 Bp362 Blood pressure QTL 362 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118608292 241799120 Rat 619613 Bp77 Blood pressure QTL 77 0.01 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 164747424 209747424 Rat 2312564 Glom18 Glomerulus QTL 18 2.4 0.003 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 1 185356336 231689108 Rat 634321 Hc1 Hypercalciuria QTL 1 2.91 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 1 178810256 240830002 Rat 2292218 Kidm35 Kidney mass QTL 35 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 199368955 224569684 Rat 724562 Rends1 Renal damage susceptibility QTL 1 0.05 kidney glomerulus integrity trait (VT:0010546) index of glomerular damage (CMO:0001135) 1 169537671 214537671 Rat 1331790 Bp201 Blood pressure QTL 201 3.127 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 198211513 225126682 Rat 2292222 Bp307 Blood pressure QTL 307 3.06 0.0014 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 213533942 Rat 2292220 Bp306 Blood pressure QTL 306 3.47 0.00087 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 243914901 Rat 10059590 Kidm44 Kidney mass QTL 44 3.42 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 191033875 236033875 Rat 1641926 Teswt2 Testicular weight QTL 2 2.82 testis mass (VT:1000644) both testes wet weight (CMO:0000175) 1 197697768 238755659 Rat 631658 Cm7 Cardiac mass QTL 7 5.32 0.0001 aorta mass (VT:0002845) aorta weight (CMO:0000076) 1 196248093 241248093 Rat 1600380 Niddm70 Non-insulin dependent diabetes mellitus QTL 70 3.1 0.0008 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 176550523 221550523 Rat 1354610 Bw34 Body weight QTL 34 4.1 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 1582206 Kidm33 Kidney mass QTL 33 6.9 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 188377360 224054420 Rat 8655855 Arrd3 Age-related retinal degeneration QTL 3 3.07 lens clarity trait (VT:0001304) cataract incidence/prevalence measurement (CMO:0001585) 1 183970203 243914901 Rat 634338 Hcar4 Hepatocarcinoma resistance QTL 4 4.6 liver integrity trait (VT:0010547) liver tumorous lesion number to liver area ratio (CMO:0001210) 1 193422268 214537671 Rat 6903303 Scl34 Serum cholesterol QTL 34 2.5 0.0033 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 1 180359209 218108781 Rat 1600374 Mcs17 Mammary carcinoma susceptibility QTL 17 3 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 1 197670404 242670404 Rat 2293083 Iddm25 Insulin dependent diabetes mellitus QTL 25 4.18 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 181829673 224569684 Rat 1354606 Bp246 Blood pressure QTL 246 3.6 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 102813953 218753816 Rat 738032 Hcas5 Hepatocarcinoma susceptibility QTL 5 3.12 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 176426412 257976495 Rat 1358191 Ept10 Estrogen-induced pituitary tumorigenesis QTL 10 3.8 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 1 192825253 243914732 Rat 7394701 Uae46 Urinary albumin excretion QTL 46 3.6 0.0056 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 201554356 246554356 Rat
D1Bda45
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 1 211,011,361 - 211,011,659 (+) Marker Load Pipeline mRatBN7.2 1 201,581,925 - 201,582,223 (+) MAPPER mRatBN7.2 Rnor_6.0 1 219,536,666 - 219,536,963 NCBI Rnor6.0 Rnor_5.0 1 226,406,779 - 226,407,076 UniSTS Rnor5.0 RGSC_v3.4 1 206,873,448 - 206,873,745 UniSTS RGSC3.4 Celera 1 199,126,243 - 199,126,540 UniSTS Cytogenetic Map 1 q42 UniSTS
RH94463
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 201,581,490 - 201,581,666 (+) MAPPER mRatBN7.2 Rnor_6.0 1 219,536,231 - 219,536,406 NCBI Rnor6.0 Rnor_5.0 1 226,406,344 - 226,406,519 UniSTS Rnor5.0 RGSC_v3.4 1 206,873,013 - 206,873,188 UniSTS RGSC3.4 Celera 1 199,125,808 - 199,125,983 UniSTS RH 3.4 Map 1 1560.2 UniSTS Cytogenetic Map 1 q42 UniSTS
Adrbk1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 201,581,049 - 201,582,234 (+) MAPPER mRatBN7.2 Rnor_6.0 1 219,535,790 - 219,536,974 NCBI Rnor6.0 Rnor_5.0 1 226,405,903 - 226,407,087 UniSTS Rnor5.0 RGSC_v3.4 1 206,872,572 - 206,873,756 UniSTS RGSC3.4 Celera 1 199,125,367 - 199,126,551 UniSTS Cytogenetic Map 1 q42 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000025847 ⟹ ENSRNOP00000025847
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 201,581,480 - 201,601,582 (-) Ensembl Rnor_6.0 Ensembl 1 219,536,220 - 219,544,328 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000100617 ⟹ ENSRNOP00000081551
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 201,581,480 - 201,589,920 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000100730 ⟹ ENSRNOP00000094741
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 201,581,480 - 201,589,920 (-) Ensembl
RefSeq Acc Id:
NM_012776 ⟹ NP_036908
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 211,010,259 - 211,031,013 (-) NCBI mRatBN7.2 1 201,580,823 - 201,601,580 (-) NCBI Rnor_6.0 1 219,536,220 - 219,544,329 (-) NCBI Rnor_5.0 1 226,406,333 - 226,414,442 (-) NCBI RGSC_v3.4 1 206,873,002 - 206,892,868 (-) RGD Celera 1 199,125,797 - 199,145,728 (-) RGD
Sequence:
GAATTCGGGCGGGCGACGAGCGAGGACCGGGCGGGGCGGCGGCGGCGCCGAGGCCGACAAGCCGCGCGGGCCGGGCCGGGCCGAGCGAGCGGGAGCGGAGCGGAGCCTCGGGCGGCGGGAGGAACAGC
hide sequence
RefSeq Acc Id:
NP_036908 ⟸ NM_012776
- UniProtKB:
P26817 (UniProtKB/Swiss-Prot)
- Sequence:
MADLEAVLADVSYLMAMEKSKATPAARASKKILLPEPSIRSVMQKYLEDRGEVTFEKIFSQKLGYLLFRDFYLNHLEEAKPLVEFYEEIEKYEKLETEEERVVRSREIFDSYIMKELLACSHPFSKNA
hide sequence
Ensembl Acc Id:
ENSRNOP00000025847 ⟸ ENSRNOT00000025847
Ensembl Acc Id:
ENSRNOP00000094741 ⟸ ENSRNOT00000100730
Ensembl Acc Id:
ENSRNOP00000081551 ⟸ ENSRNOT00000100617
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-05-20
Grk2
G protein-coupled receptor kinase 2
Adrbk1
adrenergic, beta, receptor kinase 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-09-25
Adrbk1
adrenergic, beta, receptor kinase 1
Adrbk1
adrenergic receptor kinase, beta 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2001-06-29
Adrbk1
G-protein-linked receptor kinase (beta adrenergic receptor kinase 1)
Name withdrawn
67952 WITHDRAWN
2001-06-29
Adrbk1
adrenergic receptor kinase, beta 1
Name updated to reflect Human and Mouse nomenclature
67952 APPROVED
Note Type
Note
Reference
gene_cellular_localization
specifically accumulated in the intercalated disks of myocytes
70720
gene_disease
associated with the development of cardiac hypertrophy
70720
gene_expression
expressed in brain
632163
gene_expression
expressed in cardiac myocytes
70720
gene_function
catalyzes the phosphorylation of agonist-bound beta-adrenergic receptors
632163
gene_function
kinase
70720
gene_physical_interaction
co-localized with sarcomeric alpha-actinin and G protein
70720
gene_process
involved in G protein-coupled receptor phosphorylation and desensitization
70720
gene_process
plays a role in regulating GPCRs (G-protein-coupled receptors) in bone; mediates bone formation
625698
gene_process
regulates G-protein signaling
70720
gene_process
mediates a reduction in adenylate cyclase activity
632163
gene_process
may play a role in desensitization of synaptic receptors
632163
gene_product
member of the serine/ threonine kinase family
70720
gene_regulation
protein expression remained unchanged during cardiac hypertrophy in 6 month-old animals
70720
