Oprd1 (opioid receptor, delta 1) - Rat Genome Database

Name: Oprd1
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Oprd1 (opioid receptor, delta 1) Rattus norvegicus

Analyze

Symbol:

Oprd1

Name:

opioid receptor, delta 1

RGD ID:

3233

Description:

Enables G protein-coupled enkephalin receptor activity and receptor serine/threonine kinase binding activity. Involved in several processes, including eating behavior; phospholipase C-activating G protein-coupled receptor signaling pathway; and regulation of calcium ion transport. Located in several cellular components, including axon terminus; dendrite membrane; and postsynaptic membrane. Is active in secretory vesicle; spine apparatus; and synaptic membrane. Used to study myocardial infarction. Orthologous to human OPRD1 (opioid receptor delta 1); INTERACTS WITH (D-Ala(2)-mephe(4)-gly-ol(5))enkephalin; (R)-noradrenaline; (R,R)-tramadol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

D-OR-1; delta-type opioid receptor; DOR-1; opioid receptor A; Opioid receptor delta 1

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	OPRD1 (opioid receptor delta 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Oprd1 (opioid receptor, delta 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Oprd1 (opioid receptor delta 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	OPRD1 (opioid receptor delta 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	OPRD1 (opioid receptor delta 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Oprd1 (opioid receptor delta 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	OPRD1 (opioid receptor delta 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	OPRD1 (opioid receptor delta 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Oprd1 (opioid receptor delta 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	NAPSA (napsin A aspartic peptidase)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Oprd1 (opioid receptor, delta 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	OPRD1 (opioid receptor delta 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	oprd1a (opioid receptor, delta 1a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	oprd1b (opioid receptor, delta 1b)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	AstC-R1	Alliance	DIOPT (Hieranoid\|OrthoFinder\|PANTHER)
Caenorhabditis elegans (roundworm):	npr-16	Alliance	DIOPT (OMA\|OrthoFinder\|PANTHER)
Caenorhabditis elegans (roundworm):	npr-24	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	AstC-R2	Alliance	DIOPT (Hieranoid\|OrthoFinder\|PANTHER)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	5	144,306,188 - 144,340,960 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	144,306,188 - 144,340,960 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	147,005,532 - 147,040,056 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	5	148,775,378 - 148,809,896 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	5	148,764,406 - 148,799,337 (-)	NCBI	Rnor_WKY
Rnor_6.0	5	150,288,126 - 150,323,063 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	150,288,126 - 150,323,063 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	153,962,767 - 153,997,858 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	150,979,252 - 151,014,066 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	150,989,290 - 151,024,105 (-)	NCBI
Celera	5	142,741,006 - 142,775,820 (-)	NCBI		Celera
RH 3.4 Map	5	965.9	RGD
Cytogenetic Map	5	q36	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Cardiac Arrhythmias (IDA)

epilepsy (ISO)

genetic disease (ISO)

Hyperphagia (IMP)

myocardial infarction (IDA,IMP)

Myocardial Reperfusion Injury (IDA)

Orthostatic Hypotension (ISO)

Pain (IDA)

substance-related disorder (ISO)

withdrawal disorder (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(D-Ala(2)-mephe(4)-gly-ol(5))enkephalin (EXP)

(R)-noradrenaline (EXP)

(R,R)-tramadol (EXP)

(S)-amphetamine (EXP)

(S)-nicotine (ISO)

1,2-dichloroethane (ISO)

17alpha-ethynylestradiol (EXP)

17beta-estradiol (ISO)

2,3',4,4',5-Pentachlorobiphenyl (ISO)

2,4,6-trinitrobenzenesulfonic acid (EXP)

4,4'-sulfonyldiphenol (ISO)

7-Hydroxymitragynine (ISO)

acetylmethadol (EXP)

aluminium atom (EXP)

aluminium(0) (EXP)

ammonium chloride (EXP)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

bisphenol A (ISO)

buprenorphine (EXP,ISO)

butorphanol (EXP)

C60 fullerene (EXP)

cadmium atom (EXP)

cannabidiol (EXP)

CGP 52608 (ISO)

chlorpyrifos (EXP)

clofibrate (ISO)

cocaine (EXP)

codeine (EXP)

copper atom (EXP)

copper(0) (EXP)

Deltorphin B (EXP)

dextran sulfate (ISO)

dextromethorphan (EXP)

dextropropoxyphene (EXP)

dextrorphan (EXP)

dibutyl phthalate (EXP)

DPDPE (EXP,ISO)

DSLET (EXP)

dynorphin A (ISO)

eluxadoline (ISO)

endosulfan (EXP)

ethanol (ISO)

fentanyl (EXP)

hydralazine (ISO)

hydrocodone (EXP)

Leu-enkephalin (ISO)

Levallorphan (EXP)

Levorphanol (EXP)

lipopolysaccharide (ISO)

loperamide (ISO)

magnesium atom (EXP)

manganese atom (EXP)

manganese(0) (EXP)

mercury atom (EXP)

mercury(0) (EXP)

mesalamine (EXP)

methadone (EXP)

Mitragynine (ISO)

morphine (EXP,ISO)

N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (EXP)

naloxone (EXP)

naltrexone (EXP)

Naltrindole (EXP,ISO)

nicotine (ISO)

Nonylphenol (EXP)

oxycodone (EXP)

paraquat (ISO)

resveratrol (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

serotonin (EXP)

tapentadol (EXP)

thioglycolic acid (EXP)

titanium dioxide (ISO)

tramadol (EXP)

trichloroethene (EXP)

triptonide (ISO)

U69593 (EXP)

valproic acid (ISO)

zinc atom (EXP)

zinc(0) (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adenylate cyclase-activating dopamine receptor signaling pathway (ISO)

adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway (ISO)

adult locomotory behavior (ISO)

cellular response to growth factor stimulus (IEP)

cellular response to hypoxia (ISO)

cellular response to toxic substance (ISO)

eating behavior (IMP)

G protein-coupled opioid receptor signaling pathway (IBA,ISO)

G protein-coupled receptor signaling pathway (ISO)

negative regulation of gene expression (ISO)

negative regulation of protein-containing complex assembly (ISO)

neuropeptide signaling pathway (IBA,ISO)

phospholipase C-activating G protein-coupled receptor signaling pathway (IDA)

positive regulation of peptidyl-serine phosphorylation (ISO)

regulation of calcium ion transport (IMP)

regulation of mitochondrial membrane potential (ISO)

Cellular Component

axon terminus (IDA)

dendrite membrane (IDA)

membrane (ISO)

neuron projection (IBA)

neuronal dense core vesicle (IDA,ISO)

plasma membrane (ISO)

postsynaptic density membrane (IDA)

postsynaptic membrane (IDA)

presynaptic membrane (IDA)

spine apparatus (IDA)

synaptic vesicle membrane (IDA)

vesicle (IDA)

Molecular Function

G protein-coupled enkephalin receptor activity (IBA,IDA,ISO)

G protein-coupled opioid receptor activity (ISO)

protein binding (ISO)

receptor serine/threonine kinase binding (IPI)

References

References - curated

#	Reference Title	Reference Citation
1.	Characterization of a delta opioid receptor in rat pheochromocytoma cells.	Abood ME and Tao Q, J Pharmacol Exp Ther. 1995 Sep;274(3):1566-73.
2.	Molecular cloning and expression of a delta-opioid receptor from rat brain.	Abood ME, etal., J Neurosci Res. 1994 Apr 15;37(6):714-9.
3.	delta opioid receptor modulation of several voltage-dependent Ca(2+) currents in rat sensory neurons.	Acosta CG and Lopez HS, J Neurosci. 1999 Oct 1;19(19):8337-48.
4.	Identification of a signaling cascade that maintains constitutive d-opioid receptor incompetence in peripheral sensory neurons.	Brackley AD, etal., J Biol Chem. 2017 May 26;292(21):8762-8772. doi: 10.1074/jbc.M117.776799. Epub 2017 Apr 5.
5.	Coexpression of delta-opioid receptors with micro receptors in GH3 cells changes the functional response to micro agonists from inhibitory to excitatory.	Charles AC, etal., Mol Pharmacol 2003 Jan;63(1):89-95.
6.	Ultrastructural immunolabeling shows prominent presynaptic vesicular localization of delta-opioid receptor within both enkephalin- and nonenkephalin-containing axon terminals in the superficial layers of the rat cervical spinal cord.	Cheng PY, etal., J Neurosci. 1995 Sep;15(9):5976-88.
7.	Opioid-induced cardioprotection against myocardial infarction and arrhythmias: mitochondrial versus sarcolemmal ATP-sensitive potassium channels.	Fryer RM, etal., J Pharmacol Exp Ther. 2000 Aug;294(2):451-7.
8.	Primary structures and expression from cDNAs of rat opioid receptor delta- and mu-subtypes.	Fukuda K, etal., FEBS Lett 1993 Aug 2;327(3):311-4.
9.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
10.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
11.	Cholesterol reduction by methyl-beta-cyclodextrin attenuates the delta opioid receptor-mediated signaling in neuronal cells but enhances it in non-neuronal cells.	Huang P, etal., Biochem Pharmacol. 2007 Feb 15;73(4):534-49. Epub 2006 Nov 3.
12.	Spinal pharmacology of antinociception produced by microinjection of mu or delta opioid receptor agonists in the ventromedial medulla of the rat.	Hurley RW, etal., Neuroscience. 2003;118(3):789-96.
13.	NPY-induced feeding: pharmacological characterization using selective opioid antagonists and antisense probes in rats.	Israel Y, etal., Peptides. 2005 Jul;26(7):1167-75. Epub 2005 Feb 26.
14.	kappa -opioid receptor agonists modulate visceral nociception at a novel, peripheral site of action.	Joshi SK, etal., J Neurosci. 2000 Aug 1;20(15):5874-9.
15.	High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.	Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
16.	[Contribution of delta1-opioid receptors in regulation of cardiac resistance to ischemia-reperfusion]	Lasukova TV, etal., Ross Fiziol Zh Im I M Sechenova. 2002 May;88(5):568-80.
17.	Differential coupling of mu-, delta-, and kappa-opioid receptors to G alpha16-mediated stimulation of phospholipase C.	Lee JW, etal., J Neurochem. 1998 May;70(5):2203-11.
18.	Morphine-6beta-glucuronide-induced hyperphagia: characterization of opioid action by selective antagonists and antisense mapping in rats.	Leventhal L, etal., J Pharmacol Exp Ther. 1998 Nov;287(2):538-44.
19.	Activation of peripheral delta opioid receptors eliminates cardiac electrical instability in a rat model of post-infarction cardiosclerosis via mitochondrial ATP-dependent K+ channels.	Maslov LN, etal., Life Sci. 2003 Jul 4;73(7):947-52.
20.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
21.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
22.	Bradykinin-induced functional competence and trafficking of the delta-opioid receptor in trigeminal nociceptors.	Patwardhan AM, etal., J Neurosci. 2005 Sep 28;25(39):8825-32.
23.	Effect of exogenous kappa-opioid receptor activation in rat model of myocardial infarction.	Peart JN, etal., J Cardiovasc Pharmacol. 2004 Mar;43(3):410-5.
24.	GOA pipeline	RGD automated data pipeline
25.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
26.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
27.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
28.	Preferential cytoplasmic localization of delta-opioid receptors in rat striatal patches: comparison with plasmalemmal mu-opioid receptors.	Wang H and Pickel VM, J Neurosci. 2001 May 1;21(9):3242-50.
29.	cDNA cloning of an orphan opiate receptor gene family member and its splice variant.	Wang JB, etal., FEBS Lett 1994 Jul 4;348(1):75-9.
30.	Ultrastructural localization of delta-1 opioid receptor in the dorsal raphe nucleus of the rat.	Wang QP, etal., Synapse. 1997 Jul;26(3):243-53.

Additional References at PubMed

PMID:8393575	PMID:8738226	PMID:9548483	PMID:9915326	PMID:10835636	PMID:12113946	PMID:12855366	PMID:14608598	PMID:14689476	PMID:15467355	PMID:15862537	PMID:16159882
PMID:16316997	PMID:16325578	PMID:16405927	PMID:16514101	PMID:17175187	PMID:17352824	PMID:17513490	PMID:18417105	PMID:18541716	PMID:18559244	PMID:18572383	PMID:18579738
PMID:18602454	PMID:19036960	PMID:19056363	PMID:19180644	PMID:19279569	PMID:19295160	PMID:19545549	PMID:19581316	PMID:19619588	PMID:19686472	PMID:19709398	PMID:20399742
PMID:20574683	PMID:20615975	PMID:20730419	PMID:20977770	PMID:21280046	PMID:21444630	PMID:21600884	PMID:22072818	PMID:22184124	PMID:22200548	PMID:22575599	PMID:22592774
PMID:22796630	PMID:23272051	PMID:23272113	PMID:23286559	PMID:23843537	PMID:23844255	PMID:24033469	PMID:24416361	PMID:24613828	PMID:24758591	PMID:24847082	PMID:24976397
PMID:25480575	PMID:25639363	PMID:27246300	PMID:27376372	PMID:27568556	PMID:28645621	PMID:29262398	PMID:29563057	PMID:29687347	PMID:30132200	PMID:30560518	PMID:31030416
PMID:32228617	PMID:33197884	PMID:35674691	PMID:36592113

Genomics

Comparative Map Data

Oprd1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	5	144,306,188 - 144,340,960 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	144,306,188 - 144,340,960 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	147,005,532 - 147,040,056 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	5	148,775,378 - 148,809,896 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	5	148,764,406 - 148,799,337 (-)	NCBI	Rnor_WKY
Rnor_6.0	5	150,288,126 - 150,323,063 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	150,288,126 - 150,323,063 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	153,962,767 - 153,997,858 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	150,979,252 - 151,014,066 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	150,989,290 - 151,024,105 (-)	NCBI
Celera	5	142,741,006 - 142,775,820 (-)	NCBI		Celera
RH 3.4 Map	5	965.9	RGD
Cytogenetic Map	5	q36	NCBI

OPRD1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	28,812,170 - 28,871,267 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	1	28,812,170 - 28,871,267 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	29,138,682 - 29,197,779 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	29,011,241 - 29,062,795 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	28,959,269 - 29,010,821	NCBI
Celera	1	27,534,800 - 27,586,335 (+)	NCBI		Celera
Cytogenetic Map	1	p35.3	NCBI
HuRef	1	27,391,067 - 27,442,611 (+)	NCBI		HuRef
CHM1_1	1	29,254,016 - 29,305,583 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	28,654,162 - 28,713,229 (+)	NCBI		T2T-CHM13v2.0

Oprd1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	131,834,980 - 131,872,042 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	131,838,037 - 131,871,797 (-)	Ensembl		GRCm39 Ensembl
GRCm38	4	132,110,188 - 132,144,486 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	132,110,726 - 132,144,486 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	131,666,641 - 131,700,401 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	131,382,802 - 131,416,562 (-)	NCBI		MGSCv36	mm8
Celera	4	130,271,660 - 130,305,734 (-)	NCBI		Celera
Cytogenetic Map	4	D2.3	NCBI
cM Map	4	64.78	NCBI

Oprd1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955452	7,866,758 - 7,913,399 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955452	7,866,790 - 7,913,399 (+)	NCBI	ChiLan1.0	ChiLan1.0

OPRD1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	1	197,090,112 - 197,149,063 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	28,068,053 - 28,143,053 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	29,112,328 - 29,163,464 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	29,112,152 - 29,163,464 (+)	Ensembl	panpan1.1		panPan2

OPRD1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	2	71,685,129 - 71,721,692 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	2	71,689,084 - 71,721,875 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	2	68,264,922 - 68,297,415 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	2	72,248,368 - 72,280,856 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	2	72,247,773 - 72,281,077 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	2	69,077,265 - 69,109,751 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	2	70,084,707 - 70,117,198 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	2	71,082,831 - 71,115,319 (-)	NCBI		UU_Cfam_GSD_1.0

Oprd1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	47,035,433 - 47,078,632 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936474	12,860,293 - 12,903,466 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936474	12,860,293 - 12,902,389 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

OPRD1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	85,785,276 - 85,830,877 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	85,775,576 - 85,827,170 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	79,611,950 - 79,662,042 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

OPRD1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	103,950,505 - 104,002,459 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666033	12,520,984 - 12,574,525 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Oprd1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624764	12,604,164 - 12,676,279 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624764	12,604,051 - 12,676,368 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Oprd1
276 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	142
Count of miRNA genes:	100
Interacting mature miRNAs:	116
Transcripts:	ENSRNOT00000014084
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	2138965	166875058	Rat
1549845	Scl44	Serum cholesterol level QTL 44	6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	40128307	148607290	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	46711509	161317411	Rat
61393	Bp7	Blood pressure QTL 7	4.5	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	60293434	161481680	Rat
1354598	Srn6	Serum renin concentration QTL 6	3.8		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	5	69540295	151018848	Rat
1302790	Scl20	Serum cholesterol level QTL 20	6.4	0.0001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	82394392	166664054	Rat
1331796	Thshl2	Thyroid stimulating hormone level QTL 2	2.3		blood thyroid-stimulating hormone amount (VT:0005119)	serum thyroid stimulating hormone level (CMO:0001248)	5	97059760	147465714	Rat
1358187	Emca1	Estrogen-induced mammary cancer QTL 1	4.4		mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	5	99216724	148607142	Rat
1578673	Bmd13	Bone mineral density QTL 13	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	5	103689353	148689353	Rat
2317056	Wbc3	White blood cell count QTL 3	2.51	0.01	leukocyte quantity (VT:0000217)	white blood cell count (CMO:0000027)	5	105999803	150999803	Rat
7207488	Bss110	Bone structure and strength QTL 1	8.4		femur strength trait (VT:0010010)	femur stiffness (CMO:0001674)	5	106906205	151906205	Rat
7207491	Bss112	Bone structure and strength QTL 112	7		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	5	106906205	151906205	Rat
7207481	Bss106	Bone structure and strength QTL 106	7.9		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	106906205	151906205	Rat
7207486	Bss109	Bone structure and strength QTL 109			femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	5	106906205	151906205	Rat
1549838	Bss4	Bone structure and strength QTL 4	9.2		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	5	106906205	151906205	Rat
1298089	Scl14	Serum cholesterol level QTL 14	5.8	0.0004	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	108845856	153845856	Rat
1598847	Cm62	Cardiac mass QTL 62	3.4		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	108845856	153845856	Rat
8657050	Bw146	Body weight QTL 146	19.84	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	108938288	153938288	Rat
8694441	Bw169	Body weight QTL 169	17.61	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	5	111416838	156416838	Rat
8694198	Abfw3	Abdominal fat weight QTL 3	16.13	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	5	111416838	156416838	Rat
8694389	Bw160	Body weight QTL 160	6.17	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	5	111416838	156416838	Rat
8552960	Pigfal15	Plasma insulin-like growth factor 1 level QTL 15			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	111416838	156416838	Rat
2293642	Bss37	Bone structure and strength QTL 37	4.64	0.0001	femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	120740824	151018848	Rat
1641920	Colcs1	Colorectal carcinoma susceptibility QTL 1	2.99	0.0055	intestine integrity trait (VT:0010554)	benign colorectal tumor surface area measurement (CMO:0001799)	5	121846814	166846814	Rat
10053720	Scort26	Serum corticosterone level QTL 26	2.06	0.0147	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	124965598	166875058	Rat
724525	Bp147	Blood pressure QTL 147	4.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	126424772	166875058	Rat
1598819	Bp292	Blood pressure QTL 292	4.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	127798274	166875058	Rat
1598861	Cm64	Cardiac mass QTL 64	2.9		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	127798274	166875058	Rat
8552908	Pigfal4	Plasma insulin-like growth factor 1 level QTL 4	6.6		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	128506074	166875058	Rat
8694169	Bw148	Body weight QTL 148	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	128506074	166875058	Rat
634349	Bp139	Blood pressure QTL 139		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	128924607	166875058	Rat
70156	Niddm30	Non-insulin dependent diabetes mellitus QTL 30	3.98		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	5	129132447	151006154	Rat
738018	Anxrr4	Anxiety related response QTL 4	5.1		exploratory behavior trait (VT:0010471)	percentage of entries into a discrete space in an experimental apparatus (CMO:0000961)	5	130130159	166875058	Rat
7794791	Mcs33	Mammary carcinoma susceptibility QTL 33	1.93		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	5	131345754	166875058	Rat
631505	Bp103	Blood pressure QTL 103	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	132717196	165560427	Rat
631562	Apr2	Acute phase response QTL 2	3.7		blood murinoglobulin 1 amount (VT:0010597)	plasma murinoglobulin 1 level (CMO:0001931)	5	135927956	166875058	Rat
61444	Strs2	Sensitivity to stroke QTL 2	4.7		cerebrum integrity trait (VT:0010549)	post-insult time to onset of cerebrovascular lesion (CMO:0002343)	5	135929696	166875058	Rat
1331721	Bp210	Blood pressure QTL 210	3.413		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	5	143069996	166846814	Rat
2302369	Scl60	Serum cholesterol level QTL 60	3.13		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	143608201	161165651	Rat
631263	Cm24	Cardiac mass QTL 24	3.5		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	5	143799107	158428037	Rat

Markers in Region

D5Mgh21

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	144,377,876 - 144,378,094 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	150,360,936 - 150,361,153	NCBI	Rnor6.0
Rnor_5.0	5	154,034,053 - 154,034,270	UniSTS	Rnor5.0
RGSC_v3.4	5	151,060,403 - 151,060,621	RGD	RGSC3.4
RGSC_v3.4	5	151,060,404 - 151,060,621	UniSTS	RGSC3.4
RGSC_v3.1	5	151,070,442 - 151,070,660	RGD
Celera	5	142,812,193 - 142,812,410	UniSTS
RH 3.4 Map	5	988.6	UniSTS
RH 3.4 Map	5	988.6	RGD
RH 2.0 Map	5	157.0	RGD
Cytogenetic Map	5	q36	UniSTS

D5Rat103

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	144,358,090 - 144,358,281 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	150,340,838 - 150,341,028	NCBI	Rnor6.0
Rnor_5.0	5	154,014,163 - 154,014,353	UniSTS	Rnor5.0
RGSC_v3.4	5	151,039,725 - 151,039,965	RGD	RGSC3.4
RGSC_v3.4	5	151,039,766 - 151,039,956	UniSTS	RGSC3.4
RGSC_v3.1	5	151,049,805 - 151,049,995	RGD
Celera	5	142,792,480 - 142,792,670	UniSTS
RH 3.4 Map	5	964.21	UniSTS
RH 3.4 Map	5	964.21	RGD
SHRSP x BN Map	5	80.7699	UniSTS
SHRSP x BN Map	5	80.7699	RGD
Cytogenetic Map	5	q36	UniSTS

RH94603

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	144,306,218 - 144,306,372 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	150,288,157 - 150,288,309	NCBI	Rnor6.0
Rnor_5.0	5	153,962,798 - 153,962,950	UniSTS	Rnor5.0
RGSC_v3.4	5	150,979,283 - 150,979,435	UniSTS	RGSC3.4
Celera	5	142,741,037 - 142,741,188	UniSTS
RH 3.4 Map	5	965.9	UniSTS
Cytogenetic Map	5	q36	UniSTS

BE119486

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	144,316,650 - 144,316,823 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	150,298,478 - 150,298,650	NCBI	Rnor6.0
Rnor_5.0	5	153,973,040 - 153,973,212	UniSTS	Rnor5.0
RGSC_v3.4	5	150,990,090 - 150,990,262	UniSTS	RGSC3.4
Celera	5	142,751,643 - 142,751,815	UniSTS
RH 3.4 Map	5	965.41	UniSTS
Cytogenetic Map	5	q36	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium
Low		2	2	2		2			33	1	12
Below cutoff	3	23	13	5	3	5	4	5	37	25	22	1	4

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_012617	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473968	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	D16348	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000162	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U00475	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000014084 ⟹ ENSRNOP00000014084

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	144,306,188 - 144,340,960 (-)	Ensembl
Rnor_6.0 Ensembl	5	150,288,126 - 150,323,063 (-)	Ensembl

RefSeq Acc Id:

NM_012617 ⟹ NP_036749

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	5	144,306,188 - 144,340,960 (-)	NCBI
Rnor_6.0	5	150,288,126 - 150,323,063 (-)	NCBI
Rnor_5.0	5	153,962,767 - 153,997,858 (-)	NCBI
RGSC_v3.4	5	150,979,252 - 151,014,066 (-)	RGD
Celera	5	142,741,006 - 142,775,820 (-)	RGD

Sequence:

show sequence

GAGCGCTGCAGCCTGCGACGTCGGGGCCGTGGCCTCCGTTTTCCGCGCGCCACTCGCTGGGTCC
CTGCGCCCAGGGCGCACGGTGGAGACGGACGCGGAGGCGCCATGGAGCCGGTGCCTTCTGCCCG
TGCGGAGCTGCAGTTTTCGCTCCTCGCCAACGTCTCGGACACCTTCCCTAGCGCCTTCCCCAGT
GCGAGCGCCAATGCGTCGGGGTCGCCGGGCGCCCGCAGTGCCTCGTCCCTGGCTCTGGCCATCG
CCATCACCGCGCTCTACTCGGCTGTGTGCGCCGTGGGGCTGCTGGGCAACGTGCTCGTCATGTT
TGGAATCGTCCGGTACACTAAGCTGAAGACGGCCACCAACATCTACATCTTCAATCTGGCCTTG
GCGGATGCGCTGGCCACCAGCACACTGCCCTTCCAGAGCGCCAAGTACCTGATGGAAACGTGGC
CGTTCGGAGAGCTGCTGTGCAAGGCTGTGCTCTCCATTGACTACTACAACATGTTCACCAGCAT
CTTCACGCTCACCATGATGAGCGTGGACCGCTACATTGCGGTCTGCCACCCTGTCAAGGCCTTG
GACTTCCGGACACCGGCCAAGGCCAAGCTGATCAACATATGCATCTGGGTCTTGGCTTCAGGTG
TTGGGGTCCCCATCATGGTCATGGCAGTGACCCAACCCCGGGATGGAGCAGTGGTATGCACGCT
CCAGTTCCCCAGCCCCAGCTGGTACTGGGACACTGTGACCAAGATCTGCGTGTTCCTCTTCGCC
TTCGTGGTGCCCATTCTCATCATCACCGTGTGCTATGGCCTCATGCTGCTGCGCCTGCGCAGCG
TGCGCCTGCTGTCCGGCTCCAAGGAGAAGGACCGCAGCCTGCGGCGCATCACGCGCATGGTGCT
GGTGGTGGTGGGAGCCTTCGTGGTGTGCTGGGCGCCCATCCACATCTTCGTCATCGTCTGGACG
CTGGTGGACATCAATCGGCGCGACCCACTTGTGGTGGCCGCGCTGCACTTGTGCATTGCGCTGG
GCTACGCCAACAGCAGCCTCAACCCGGTTCTCTACGCCTTCCTGGACGAGAACTTCAAGCGCTG
CTTCCGCCAGCTCTGTCGCGCGCCCTGCGGCGGCCAAGAACCCGGCAGCCTCCGCCGTCCCCGC
CAGGCCACCGCGCGTGAGCGTGTCACCGCCTGCACCCCCTCCGACGGCCCGGGCGGTGGCGCTG
CCGCCTGACCTACCCGGCCCTCTGCTTAAACGCCCCACCCAAGTGAAGTGATGCAGTGGCCACA
CCGAGCTCCCTGGGAGGCCATGGCCACCATTGGGACAGCTAGAATAGGGCCCACACGGGGGGGG
GGAGGCCTCCCATGAGGGCCGGGCCTGAGGAATCAAAGGCTCCGGGTTGGAGGGGTGGGGGTTG
GGAGGGCAGA

hide sequence

Protein Sequences


Protein RefSeqs	NP_036749	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA19939	(Get FASTA)	NCBI Sequence Viewer
	BAA03851	(Get FASTA)	NCBI Sequence Viewer
	EDL80617	(Get FASTA)	NCBI Sequence Viewer
	P33533	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:

NP_036749 ⟸ NM_012617

- UniProtKB:

P33533 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MEPVPSARAELQFSLLANVSDTFPSAFPSASANASGSPGARSASSLALAIAITALYSAVCAVGL
LGNVLVMFGIVRYTKLKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELLCKAVLSID
YYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVGVPIMVMAVTQPR
DGAVVCTLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRLRSVRLLSGSKEKDRSL
RRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDINRRDPLVVAALHLCIALGYANSSLNPVLYAF
LDENFKRCFRQLCRAPCGGQEPGSLRRPRQATARERVTACTPSDGPGGGAAA

hide sequence

RefSeq Acc Id:

ENSRNOP00000014084 ⟸ ENSRNOT00000014084

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P33533-F1-model_v2	AlphaFold	P33533	1-372	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:3233	AgrOrtholog
BioCyc Gene	G2FUF-39716	BioCyc
Ensembl Genes	ENSRNOG00000010531	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Protein	ENSRNOP00000014084	ENTREZGENE
	ENSRNOP00000014084.2	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000014084	ENTREZGENE
	ENSRNOT00000014084.4	UniProtKB/Swiss-Prot
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/Swiss-Prot
InterPro	Delta_opi_rcpt	UniProtKB/Swiss-Prot
	GPCR_Rhodpsn	UniProtKB/Swiss-Prot
	GPCR_Rhodpsn_7TM	UniProtKB/Swiss-Prot
	Opioid_rcpt	UniProtKB/Swiss-Prot
KEGG Report	rno:24613	UniProtKB/Swiss-Prot
NCBI Gene	24613	ENTREZGENE
PANTHER	DELTA-TYPE OPIOID RECEPTOR	UniProtKB/Swiss-Prot
	NEUROPEPTIDES RECEPTOR	UniProtKB/Swiss-Prot
Pfam	7tm_1	UniProtKB/Swiss-Prot
PharmGKB	OPRD1	RGD
PhenoGen	Oprd1	PhenoGen
PRINTS	DELTAOPIOIDR	UniProtKB/Swiss-Prot
	GPCRRHODOPSN	UniProtKB/Swiss-Prot
	OPIOIDR	UniProtKB/Swiss-Prot
PROSITE	G_PROTEIN_RECEP_F1_1	UniProtKB/Swiss-Prot
	G_PROTEIN_RECEP_F1_2	UniProtKB/Swiss-Prot
SMART	7TM_GPCR_Srsx	UniProtKB/Swiss-Prot
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/Swiss-Prot
TIGR	TC224017
UniProt	OPRD_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2002-06-10	Oprd1	Opioid receptor delta 1			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_physical_interaction	may interact with micro-opioid receptors to effect action potentials in GH3 cells	729249

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD