Symbol:
Gper1
Name:
G protein-coupled estrogen receptor 1
RGD ID:
619845
Description:
Enables G protein-coupled estrogen receptor activity and estradiol binding activity. Involved in several processes, including apoptotic nuclear changes; cellular response to steroid hormone stimulus; and positive regulation of signal transduction. Acts upstream of with a positive effect on vasodilation. Located in several cellular components, including dendrite; postsynaptic density; and presynaptic membrane. Orthologous to human GPER1 (G protein-coupled estrogen receptor 1); PARTICIPATES IN epidermal growth factor/neuregulin signaling pathway; estrogen signaling pathway; serotonin signaling pathway; INTERACTS WITH (S)-amphetamine; 1,3,5-trinitro-1,3,5-triazinane; 17beta-estradiol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
chemoattractant receptor-like 2; chemokine receptor-like 2; G protein-coupled receptor 30; G-protein coupled estrogen receptor 1; G-protein coupled receptor 30; G-protein coupled receptor 41; Gper; Gpr30; GPR41; membrane estrogen receptor; mER
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Allele / Splice:
Gper1em1Bj
Genetic Models:
SS-Gper1em1Bj-/-
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 20,331,073 - 20,336,527 (-) NCBI GRCr8 mRatBN7.2 12 15,217,217 - 15,222,679 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 15,217,442 - 15,221,889 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 12 16,027,880 - 16,029,158 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 12 16,651,625 - 16,652,903 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 12 15,677,933 - 15,679,211 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 12 17,309,122 - 17,315,267 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 17,309,834 - 17,311,112 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 12 19,296,086 - 19,301,691 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 12 15,718,615 - 15,719,893 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 12 15,748,542 - 15,749,821 (-) NCBI Celera 12 16,971,703 - 16,972,981 (-) NCBI Celera Cytogenetic Map 12 q11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Gper1 Rat (S)-amphetamine increases expression EXP 6480464 Dextroamphetamine results in increased expression of GPER1 mRNA CTD PMID:16715494 Gper1 Rat (S)-naringenin multiple interactions ISO GPER1 (Homo sapiens) 6480464 [Tamoxifen co-treated with naringenin] results in decreased expression of GPER1 mRNA and [Tamoxifen co-treated with naringenin] results in decreased expression of GPER1 protein CTD PMID:30153467 Gper1 Rat (S)-naringenin decreases expression ISO GPER1 (Homo sapiens) 6480464 naringenin metabolite results in decreased expression of GPER1 mRNA more ... CTD PMID:30153467 and PMID:36235125 Gper1 Rat 1,2-dimethylhydrazine decreases expression ISO Gper1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of GPER1 mRNA CTD PMID:22206623 Gper1 Rat 1,3,5-trinitro-1,3,5-triazinane increases expression EXP 6480464 cyclonite results in increased expression of GPER1 mRNA CTD PMID:25559034 Gper1 Rat 17alpha-ethynylestradiol increases expression ISO GPER1 (Homo sapiens) 6480464 Ethinyl Estradiol results in increased expression of GPER1 mRNA CTD PMID:29783106 Gper1 Rat 17beta-estradiol multiple interactions ISO GPER1 (Homo sapiens) 6480464 2 more ... CTD PMID:15090535 more ... Gper1 Rat 17beta-estradiol increases expression ISO Gper1 (Mus musculus) 6480464 Estradiol results in increased expression of GPER1 protein CTD PMID:29360751 Gper1 Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of GPER1 mRNA CTD PMID:27174447 Gper1 Rat 17beta-estradiol increases expression ISO GPER1 (Homo sapiens) 6480464 Estradiol results in increased expression of GPER1 mRNA and Estradiol results in increased expression of GPER1 protein CTD PMID:17121429 more ... Gper1 Rat 17beta-estradiol affects binding ISO GPER1 (Homo sapiens) 6480464 Estradiol analog binds to GPER1 protein and Estradiol binds to GPER1 protein CTD PMID:25616260 more ... Gper1 Rat 17beta-estradiol affects response to substance EXP 6480464 GPER1 protein affects the susceptibility to Estradiol CTD PMID:22265196 Gper1 Rat 17beta-estradiol affects response to substance ISO GPER1 (Homo sapiens) 6480464 GPER1 protein affects the susceptibility to Estradiol CTD PMID:24440569 Gper1 Rat 17beta-estradiol multiple interactions EXP 6480464 [Estradiol co-treated with bisphenol A] results in decreased expression of GPER mRNA and GPER1 protein affects the reaction [Estradiol results in decreased expression of HTR1A protein] CTD PMID:22265196 and PMID:35700937 Gper1 Rat 17beta-estradiol decreases expression ISO GPER1 (Homo sapiens) 6480464 Estradiol results in decreased expression of GPER1 mRNA CTD PMID:21185374 more ... Gper1 Rat 17beta-estradiol multiple interactions ISO Gper1 (Mus musculus) 6480464 Estradiol affects the reaction [PTK2B protein affects the expression of GPER1 mRNA] and GPER1 affects the reaction [Estradiol results in increased expression of FOS mRNA] CTD PMID:21813366 and PMID:29428397 Gper1 Rat 17beta-estradiol increases activity ISO GPER1 (Homo sapiens) 6480464 Estradiol results in increased activity of GPER1 protein CTD PMID:19153601 Gper1 Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Gper1 (Mus musculus) 6480464 [Dietary Sucrose co-treated with Dietary Fats co-treated with bisphenol A co-treated with Diethylhexyl Phthalate co-treated with Tetrachlorodibenzodioxin co-treated with 2 more ... CTD PMID:30722647 and PMID:32784060 Gper1 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO GPER1 (Homo sapiens) 6480464 2 more ... CTD PMID:23146750 Gper1 Rat 2,2',4,4'-Tetrabromodiphenyl ether multiple interactions ISO GPER1 (Homo sapiens) 6480464 2 more ... CTD PMID:29790728 Gper1 Rat 2,2',4,5'-Tetrabromodiphenyl ether multiple interactions ISO GPER1 (Homo sapiens) 6480464 2 more ... CTD PMID:29790728 Gper1 Rat 2,2-(2-Chlorophenyl-4'-chlorophenyl)-1,1-dichloroethene affects binding ISO GPER1 (Homo sapiens) 6480464 2 more ... CTD PMID:17088055 Gper1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO GPER1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of GPER1 mRNA CTD PMID:20106945 more ... Gper1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Gper1 (Mus musculus) 6480464 [Dietary Sucrose co-treated with Dietary Fats co-treated with bisphenol A co-treated with Diethylhexyl Phthalate co-treated with Tetrachlorodibenzodioxin co-treated with 2 more ... CTD PMID:30722647 and PMID:32784060 Gper1 Rat 2,3-dimethoxynaphthalene-1,4-dione decreases expression ISO GPER1 (Homo sapiens) 6480464 2 more ... CTD PMID:17547211 Gper1 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether multiple interactions ISO GPER1 (Homo sapiens) 6480464 2 more ... CTD PMID:29790728 Gper1 Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO Gper1 (Mus musculus) 6480464 tetrabromobisphenol A results in decreased expression of GPER1 mRNA CTD PMID:25172293 Gper1 Rat 3,3',5,5'-tetrabromobisphenol A increases expression ISO Gper1 (Mus musculus) 6480464 tetrabromobisphenol A results in increased expression of GPER1 mRNA CTD PMID:30496566 Gper1 Rat 4,4'-sulfonyldiphenol affects binding ISO GPER1 (Homo sapiens) 6480464 bisphenol S binds to GPER1 protein CTD PMID:28858478 Gper1 Rat 4,4'-sulfonyldiphenol decreases expression ISO GPER1 (Homo sapiens) 6480464 bisphenol S results in decreased expression of GPER1 protein CTD PMID:34831106 Gper1 Rat 4,4'-sulfonyldiphenol decreases methylation ISO Gper1 (Mus musculus) 6480464 bisphenol S results in decreased methylation of GPER1 exon CTD PMID:33297965 Gper1 Rat 4,4'-sulfonyldiphenol decreases expression ISO Gper1 (Mus musculus) 6480464 bisphenol S results in decreased expression of GPER1 mRNA CTD PMID:35569583 Gper1 Rat 4,4'-thiodiphenol multiple interactions ISO GPER1 (Homo sapiens) 6480464 4-(6-bromo-1 more ... CTD PMID:27880919 Gper1 Rat 4,4'-thiodiphenol increases expression ISO GPER1 (Homo sapiens) 6480464 bis(4-oxyphenyl)sulfide results in increased expression of GPER1 protein CTD PMID:27880919 Gper1 Rat 4-nonylphenol increases expression ISO GPER1 (Homo sapiens) 6480464 4-nonylphenol results in increased expression of GPER1 mRNA CTD PMID:29783106 Gper1 Rat 4-tert-Octylphenol increases expression ISO GPER1 (Homo sapiens) 6480464 4-tert-octylphenol results in increased expression of GPER1 mRNA CTD PMID:29783106 Gper1 Rat 5-aza-2'-deoxycytidine affects expression ISO GPER1 (Homo sapiens) 6480464 Decitabine affects the expression of GPER1 mRNA CTD PMID:23300844 Gper1 Rat 5-aza-2'-deoxycytidine decreases methylation ISO GPER1 (Homo sapiens) 6480464 Decitabine results in decreased methylation of GPER1 promoter CTD PMID:23300844 Gper1 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of GPER1 mRNA CTD PMID:22504374 Gper1 Rat afimoxifene multiple interactions ISO GPER1 (Homo sapiens) 6480464 GPER1 protein affects the reaction [afimoxifene results in increased cleavage of CCNE1 protein] more ... CTD PMID:19153601 and PMID:23624423 Gper1 Rat afimoxifene increases activity ISO GPER1 (Homo sapiens) 6480464 afimoxifene results in increased activity of GPER1 protein CTD PMID:19153601 Gper1 Rat afimoxifene affects response to substance ISO GPER1 (Homo sapiens) 6480464 GPER1 protein affects the susceptibility to afimoxifene CTD PMID:19153601 Gper1 Rat aflatoxin B1 decreases expression ISO GPER1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of GPER1 mRNA CTD PMID:27153756 Gper1 Rat all-trans-retinoic acid increases expression ISO GPER1 (Homo sapiens) 6480464 Tretinoin results in increased expression of GPER1 mRNA CTD PMID:23724009 Gper1 Rat all-trans-retinoic acid multiple interactions ISO Gper1 (Mus musculus) 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in decreased expression of GPER1 mRNA CTD PMID:36189433 Gper1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of GPER1 mRNA CTD PMID:16483693 Gper1 Rat antirheumatic drug increases expression ISO GPER1 (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of GPER1 mRNA CTD PMID:24449571 Gper1 Rat aristolochic acid A increases expression ISO GPER1 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of GPER1 mRNA CTD PMID:33212167 Gper1 Rat arsenite(3-) increases expression ISO GPER1 (Homo sapiens) 6480464 arsenite results in increased expression of GPER1 mRNA CTD PMID:31646340 Gper1 Rat arsenous acid decreases expression ISO GPER1 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of GPER1 mRNA CTD PMID:17547211 and PMID:19128835 Gper1 Rat atrazine multiple interactions ISO GPER1 (Homo sapiens) 6480464 Atrazine binds to and results in increased activity of GPER1 protein more ... CTD PMID:25616260 Gper1 Rat atrazine affects expression ISO GPER1 (Homo sapiens) 6480464 Atrazine affects the expression of GPER1 mRNA CTD PMID:26955487 Gper1 Rat atrazine decreases expression EXP 6480464 Atrazine results in decreased expression of GPER1 mRNA CTD PMID:36841081 Gper1 Rat benzo[a]pyrene increases methylation ISO GPER1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of GPER exon CTD PMID:27901495 Gper1 Rat benzo[a]pyrene affects methylation ISO GPER1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of GPER 5' UTR and Benzo(a)pyrene affects the methylation of GPER promoter CTD PMID:27901495 Gper1 Rat Benzo[ghi]perylene increases expression ISO Gper1 (Mus musculus) 6480464 1 and 12-benzoperylene results in increased expression of GPER1 mRNA CTD PMID:26377693 Gper1 Rat bis(2-ethylhexyl) phthalate decreases expression EXP 6480464 Diethylhexyl Phthalate results in decreased expression of GPER1 mRNA CTD PMID:15620428 Gper1 Rat bis(2-ethylhexyl) phthalate decreases expression ISO GPER1 (Homo sapiens) 6480464 Diethylhexyl Phthalate results in decreased expression of GPER1 mRNA CTD PMID:33846374 Gper1 Rat bis(2-ethylhexyl) phthalate increases expression ISO Gper1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of GPER1 mRNA CTD PMID:34600010 Gper1 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Gper1 (Mus musculus) 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with diethyl phthalate co-treated with di-n-octyl phthalate co-treated with diisodecyl phthalate co-treated with diisononyl phthalate] results in increased expression of GPER1 protein more ... CTD PMID:30722647 more ... Gper1 Rat bisphenol A multiple interactions ISO GPER1 (Homo sapiens) 6480464 [Estradiol co-treated with bisphenol A] results in increased expression of GPER1 mRNA more ... CTD PMID:17088055 more ... Gper1 Rat bisphenol A multiple interactions EXP 6480464 [Estradiol co-treated with bisphenol A] results in decreased expression of GPER mRNA CTD PMID:35700937 Gper1 Rat bisphenol A decreases expression ISO Gper1 (Mus musculus) 6480464 bisphenol A results in decreased expression of GPER1 mRNA and bisphenol A results in decreased expression of GPER1 protein CTD PMID:30149043 more ... Gper1 Rat bisphenol A affects binding ISO GPER1 (Homo sapiens) 6480464 bisphenol A binds to GPER1 protein CTD PMID:28858478 and PMID:34328988 Gper1 Rat bisphenol A decreases methylation ISO Gper1 (Mus musculus) 6480464 bisphenol A results in decreased methylation of GPER1 promoter CTD PMID:27312807 Gper1 Rat bisphenol A increases expression ISO GPER1 (Homo sapiens) 6480464 bisphenol A results in increased expression of GPER mRNA more ... CTD PMID:28426875 more ... Gper1 Rat bisphenol A decreases expression ISO GPER1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of GPER1 mRNA and bisphenol A results in decreased expression of GPER1 protein CTD PMID:25878060 more ... Gper1 Rat bisphenol A increases activity ISO Gper1 (Mus musculus) 6480464 bisphenol A results in increased activity of GPER1 protein CTD PMID:24604882 Gper1 Rat bisphenol A increases expression ISO Gper1 (Mus musculus) 6480464 bisphenol A results in increased expression of GPER1 mRNA and bisphenol A results in increased expression of GPER1 protein CTD PMID:22707478 more ... Gper1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of GPER1 mRNA CTD PMID:24189132 Gper1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of GPER1 mRNA CTD PMID:25181051 and PMID:30755151 Gper1 Rat bisphenol A multiple interactions ISO Gper1 (Mus musculus) 6480464 2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one inhibits the reaction [bisphenol A promotes the reaction [FOS protein binds to GPER1 promoter]] more ... CTD PMID:21813366 more ... Gper1 Rat bisphenol AF multiple interactions ISO GPER1 (Homo sapiens) 6480464 GPER1 protein affects the reaction [bisphenol AF results in increased phosphorylation of AKT1 protein] CTD PMID:30590302 Gper1 Rat bisphenol AF affects binding ISO GPER1 (Homo sapiens) 6480464 bisphenol AF binds to GPER1 protein CTD PMID:28858478 and PMID:34328988 Gper1 Rat bisphenol AF increases expression ISO GPER1 (Homo sapiens) 6480464 bisphenol AF results in increased expression of GPER1 mRNA and bisphenol AF results in increased expression of GPER1 protein CTD PMID:30590302 and PMID:36190352 Gper1 Rat bisphenol AF multiple interactions ISO Gper1 (Mus musculus) 6480464 4-(6-bromo-1 more ... CTD PMID:31981723 Gper1 Rat bisphenol AF increases expression ISO Gper1 (Mus musculus) 6480464 bisphenol AF results in increased expression of GPER1 mRNA and bisphenol AF results in increased expression of GPER1 protein CTD PMID:31981723 Gper1 Rat Bisphenol B affects binding ISO GPER1 (Homo sapiens) 6480464 bisphenol B binds to GPER1 protein CTD PMID:28858478 and PMID:34328988 Gper1 Rat Bisphenol B decreases expression ISO GPER1 (Homo sapiens) 6480464 bisphenol B results in decreased expression of GPER1 mRNA CTD PMID:32387340 Gper1 Rat bisphenol F multiple interactions ISO GPER1 (Homo sapiens) 6480464 4-(6-bromo-1 more ... CTD PMID:30195206 Gper1 Rat bisphenol F decreases expression ISO GPER1 (Homo sapiens) 6480464 bisphenol F results in decreased expression of GPER1 protein CTD PMID:34831106 Gper1 Rat bisphenol F increases expression EXP 6480464 bisphenol F results in increased expression of GPER1 mRNA and bisphenol F results in increased expression of GPER1 protein CTD PMID:35803362 Gper1 Rat bisphenol F affects binding ISO GPER1 (Homo sapiens) 6480464 bisphenol F binds to GPER1 protein CTD PMID:34328988 Gper1 Rat bisphenol F increases expression ISO GPER1 (Homo sapiens) 6480464 4 and 4'-bisphenol F results in increased expression of GPER1 protein CTD PMID:30195206 Gper1 Rat Bisphenol Z decreases expression ISO GPER1 (Homo sapiens) 6480464 bisphenol Z results in decreased expression of GPER1 mRNA CTD PMID:32387340 Gper1 Rat Butylbenzyl phthalate multiple interactions ISO Gper1 (Mus musculus) 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with diethyl phthalate co-treated with di-n-octyl phthalate co-treated with diisodecyl phthalate co-treated with diisononyl phthalate] results in increased expression of GPER1 protein and [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with diethyl phthalate co-treated with diisononyl phthalate co-treated with di-n-octyl phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with diisodecyl phthalate] results in increased expression of GPER1 mRNA CTD PMID:35739755 and PMID:37364641 Gper1 Rat Butylparaben increases expression ISO GPER1 (Homo sapiens) 6480464 butylparaben results in increased expression of GPER1 mRNA and butylparaben results in increased expression of GPER1 protein CTD PMID:17121429 and PMID:26253279 Gper1 Rat cadmium atom decreases expression ISO GPER1 (Homo sapiens) 6480464 Cadmium results in decreased expression of GPER1 mRNA CTD PMID:17547211 and PMID:31646340 Gper1 Rat cadmium atom multiple interactions ISO GPER1 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of GPER1 mRNA more ... CTD PMID:20153348 more ... Gper1 Rat cadmium dichloride decreases expression ISO GPER1 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of GPER1 mRNA CTD PMID:17547211 and PMID:38568856 Gper1 Rat cadmium dichloride increases expression ISO GPER1 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of GPER1 mRNA CTD PMID:38382870 Gper1 Rat cadmium dichloride multiple interactions ISO GPER1 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of GPER1 mRNA more ... CTD PMID:31468104 Gper1 Rat chlordecone multiple interactions ISO GPER1 (Homo sapiens) 6480464 Chlordecone binds to and results in increased activity of GPER1 protein CTD PMID:17088055 Gper1 Rat chlorpyrifos increases expression ISO Gper1 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of GPER1 mRNA CTD PMID:37019170 Gper1 Rat chromium atom decreases expression ISO GPER1 (Homo sapiens) 6480464 Chromium results in decreased expression of GPER1 mRNA CTD PMID:17547211 Gper1 Rat cisplatin affects expression ISO GPER1 (Homo sapiens) 6480464 Cisplatin affects the expression of GPER1 mRNA CTD PMID:23300844 Gper1 Rat clobetasol increases expression ISO Gper1 (Mus musculus) 6480464 Clobetasol results in increased expression of GPER1 mRNA CTD PMID:27462272 Gper1 Rat cocaine increases expression EXP 6480464 Cocaine results in increased expression of GPER1 mRNA CTD PMID:17898221 Gper1 Rat copper(II) sulfate decreases expression ISO GPER1 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of GPER1 mRNA CTD PMID:19549813 Gper1 Rat coumestrol multiple interactions ISO GPER1 (Homo sapiens) 6480464 [Coumestrol co-treated with resveratrol] results in decreased expression of GPER1 mRNA CTD PMID:19167446 Gper1 Rat cumene multiple interactions ISO Gper1 (Mus musculus) 6480464 [cumene co-treated with KRAS gene mutant form] results in decreased expression of GPER1 mRNA CTD PMID:18648096 Gper1 Rat curcumin decreases expression ISO GPER1 (Homo sapiens) 6480464 Curcumin results in decreased expression of GPER1 mRNA CTD PMID:17198877 Gper1 Rat cyanazine affects expression ISO GPER1 (Homo sapiens) 6480464 cyanazine affects the expression of GPER1 mRNA CTD PMID:26955487 Gper1 Rat cyclosporin A decreases expression ISO GPER1 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of GPER1 mRNA CTD PMID:20106945 and PMID:25562108 Gper1 Rat cyclosporin A increases expression ISO GPER1 (Homo sapiens) 6480464 Cyclosporine results in increased expression of GPER1 mRNA CTD PMID:27989131 Gper1 Rat cytarabine decreases expression ISO GPER1 (Homo sapiens) 6480464 Cytarabine results in decreased expression of GPER1 mRNA CTD PMID:21198554 Gper1 Rat daidzein multiple interactions ISO GPER1 (Homo sapiens) 6480464 daidzein inhibits the reaction [bisphenol A results in decreased expression of GPER1 mRNA] CTD PMID:32963737 Gper1 Rat DDT affects binding ISO GPER1 (Homo sapiens) 6480464 DDT binds to GPER1 protein CTD PMID:17088055 Gper1 Rat DDT affects expression ISO Gper1 (Mus musculus) 6480464 DDT affects the expression of GPER1 mRNA CTD PMID:28263910 Gper1 Rat DDT decreases expression ISO Gper1 (Mus musculus) 6480464 DDT results in decreased expression of GPER1 protein CTD PMID:28263910 Gper1 Rat DDT increases methylation ISO Gper1 (Mus musculus) 6480464 DDT results in increased methylation of GPER1 gene CTD PMID:28263910 Gper1 Rat dehydroepiandrosterone multiple interactions ISO GPER1 (Homo sapiens) 6480464 4-(6-bromo-1 more ... CTD PMID:25969534 Gper1 Rat dehydroepiandrosterone increases expression ISO GPER1 (Homo sapiens) 6480464 Dehydroepiandrosterone results in increased expression of GPER1 mRNA and Dehydroepiandrosterone results in increased expression of GPER1 protein CTD PMID:25969534 Gper1 Rat dexamethasone decreases expression ISO Gper1 (Mus musculus) 6480464 Dexamethasone results in decreased expression of GPER1 mRNA CTD PMID:22733784 Gper1 Rat Di-n-octyl phthalate multiple interactions ISO Gper1 (Mus musculus) 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with diethyl phthalate co-treated with di-n-octyl phthalate co-treated with diisodecyl phthalate co-treated with diisononyl phthalate] results in increased expression of GPER1 protein and [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with diethyl phthalate co-treated with diisononyl phthalate co-treated with di-n-octyl phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with diisodecyl phthalate] results in increased expression of GPER1 mRNA CTD PMID:35739755 and PMID:37364641 Gper1 Rat diarsenic trioxide decreases expression ISO GPER1 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of GPER1 mRNA CTD PMID:17547211 and PMID:19128835 Gper1 Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of GPER1 mRNA CTD PMID:15620428 Gper1 Rat dibutyl phthalate multiple interactions ISO Gper1 (Mus musculus) 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with diethyl phthalate co-treated with di-n-octyl phthalate co-treated with diisodecyl phthalate co-treated with diisononyl phthalate] results in increased expression of GPER1 protein and [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with diethyl phthalate co-treated with diisononyl phthalate co-treated with di-n-octyl phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with diisodecyl phthalate] results in increased expression of GPER1 mRNA CTD PMID:35739755 and PMID:37364641 Gper1 Rat diethyl phthalate multiple interactions ISO Gper1 (Mus musculus) 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with diethyl phthalate co-treated with di-n-octyl phthalate co-treated with diisodecyl phthalate co-treated with diisononyl phthalate] results in increased expression of GPER1 protein and [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with diethyl phthalate co-treated with diisononyl phthalate co-treated with di-n-octyl phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with diisodecyl phthalate] results in increased expression of GPER1 mRNA CTD PMID:35739755 and PMID:37364641 Gper1 Rat diethylstilbestrol increases expression ISO GPER1 (Homo sapiens) 6480464 Diethylstilbestrol results in increased expression of GPER1 mRNA CTD PMID:29783106 Gper1 Rat Diisodecyl phthalate multiple interactions ISO Gper1 (Mus musculus) 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with diethyl phthalate co-treated with di-n-octyl phthalate co-treated with diisodecyl phthalate co-treated with diisononyl phthalate] results in increased expression of GPER1 protein and [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with diethyl phthalate co-treated with diisononyl phthalate co-treated with di-n-octyl phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with diisodecyl phthalate] results in increased expression of GPER1 mRNA CTD PMID:35739755 and PMID:37364641 Gper1 Rat diisononyl phthalate multiple interactions ISO Gper1 (Mus musculus) 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with diethyl phthalate co-treated with di-n-octyl phthalate co-treated with diisodecyl phthalate co-treated with diisononyl phthalate] results in increased expression of GPER1 protein and [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with diethyl phthalate co-treated with diisononyl phthalate co-treated with di-n-octyl phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with diisodecyl phthalate] results in increased expression of GPER1 mRNA CTD PMID:35739755 and PMID:37364641 Gper1 Rat dioxygen multiple interactions ISO Gper1 (Mus musculus) 6480464 Raloxifene Hydrochloride inhibits the reaction [Oxygen deficiency results in increased expression of GPER1 mRNA] CTD PMID:24846829 Gper1 Rat dioxygen increases expression ISO Gper1 (Mus musculus) 6480464 Oxygen deficiency results in increased expression of GPER1 mRNA CTD PMID:24846829 Gper1 Rat disodium selenite increases expression ISO Gper1 (Mus musculus) 6480464 Sodium Selenite results in increased expression of GPER1 protein CTD PMID:37142062 Gper1 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of GPER1 mRNA CTD PMID:29391264 Gper1 Rat folic acid decreases expression ISO Gper1 (Mus musculus) 6480464 Folic Acid results in decreased expression of GPER1 mRNA CTD PMID:25629700 Gper1 Rat FR900359 multiple interactions ISO GPER1 (Homo sapiens) 6480464 FR900359 inhibits the reaction [[GPER1 protein co-treated with Estradiol] results in increased phosphorylation of MAPK1 protein] and FR900359 inhibits the reaction [[GPER1 protein co-treated with Estradiol] results in increased phosphorylation of MAPK3 protein] CTD PMID:37372083 Gper1 Rat fulvestrant multiple interactions ISO GPER1 (Homo sapiens) 6480464 4-(6-bromo-1 more ... CTD PMID:20211987 more ... Gper1 Rat fulvestrant multiple interactions ISO Gper1 (Mus musculus) 6480464 Fulvestrant inhibits the reaction [bisphenol A results in increased expression of GPER1 mRNA] more ... CTD PMID:28446726 and PMID:37084542 Gper1 Rat fulvestrant increases expression ISO GPER1 (Homo sapiens) 6480464 Fulvestrant results in increased expression of GPER1 mRNA and Fulvestrant results in increased expression of GPER1 protein CTD PMID:25969534 more ... Gper1 Rat fulvestrant decreases response to substance ISO GPER1 (Homo sapiens) 6480464 GPER1 mutant form results in decreased susceptibility to fulvestrant CTD PMID:24169358 Gper1 Rat fulvestrant affects response to substance ISO GPER1 (Homo sapiens) 6480464 GPER1 protein affects the susceptibility to fulvestrant CTD PMID:24440569 Gper1 Rat gefitinib multiple interactions ISO GPER1 (Homo sapiens) 6480464 Gefitinib inhibits the reaction [tetrachlorodian results in increased expression of GPER1 mRNA] CTD PMID:36190352 Gper1 Rat genistein multiple interactions ISO GPER1 (Homo sapiens) 6480464 Genistein binds to and results in increased activity of GPER1 protein more ... CTD PMID:15090535 more ... Gper1 Rat glyphosate increases expression EXP 6480464 Glyphosate results in increased expression of GPER1 mRNA and Glyphosate results in increased expression of GPER1 protein CTD PMID:24930125 Gper1 Rat herbicide increases expression EXP 6480464 Herbicides results in increased expression of GPER1 mRNA and Herbicides results in increased expression of GPER1 protein CTD PMID:24930125 Gper1 Rat hexachlorobenzene increases expression ISO Gper1 (Mus musculus) 6480464 Hexachlorobenzene results in increased expression of GPER1 protein CTD PMID:37169060 Gper1 Rat hydroquinone O-beta-D-glucopyranoside increases expression ISO Gper1 (Mus musculus) 6480464 Arbutin results in increased expression of GPER1 protein CTD PMID:29360751 Gper1 Rat hydroquinone O-beta-D-glucopyranoside increases expression ISO GPER1 (Homo sapiens) 6480464 Arbutin results in increased expression of GPER1 protein CTD PMID:29360751 Gper1 Rat iron dichloride decreases expression ISO GPER1 (Homo sapiens) 6480464 ferrous chloride results in decreased expression of GPER1 mRNA CTD PMID:35984750 Gper1 Rat KT 5720 multiple interactions EXP 6480464 KT 5720 inhibits the reaction [[1-(4-(6-bromobenzo(1 more ... CTD PMID:22645130 Gper1 Rat KT 5823 multiple interactions ISO Gper1 (Mus musculus) 6480464 KT 5823 inhibits the reaction [bisphenol A promotes the reaction [FOS protein binds to GPER1 promoter]] more ... CTD PMID:23274518 Gper1 Rat LY294002 multiple interactions EXP 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [[1-(4-(6-bromobenzo(1 more ... CTD PMID:22645130 and PMID:33035625 Gper1 Rat manganese atom multiple interactions EXP 6480464 [1-(4-(6-bromobenzo(1 more ... CTD PMID:22645130 Gper1 Rat manganese(0) multiple interactions EXP 6480464 [1-(4-(6-bromobenzo(1 more ... CTD PMID:22645130 Gper1 Rat mercury atom decreases expression ISO GPER1 (Homo sapiens) 6480464 Mercury results in decreased expression of GPER1 mRNA CTD PMID:17547211 Gper1 Rat mercury(0) decreases expression ISO GPER1 (Homo sapiens) 6480464 Mercury results in decreased expression of GPER1 mRNA CTD PMID:17547211 Gper1 Rat mestranol increases expression ISO Gper1 (Mus musculus) 6480464 Mestranol results in increased expression of GPER1 protein CTD PMID:36098747 Gper1 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of GPER1 mRNA CTD PMID:22504374 Gper1 Rat methylparaben increases expression ISO GPER1 (Homo sapiens) 6480464 methylparaben results in increased expression of GPER1 mRNA and methylparaben results in increased expression of GPER1 protein CTD PMID:17121429 and PMID:26253279 Gper1 Rat mono(2-ethylhexyl) phthalate multiple interactions ISO Gper1 (Mus musculus) 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in decreased expression of GPER1 mRNA CTD PMID:36189433 Gper1 Rat N-[2-(4-bromocinnamylamino)ethyl]isoquinoline-5-sulfonamide multiple interactions EXP 6480464 N-(2-(4-bromocinnamylamino)ethyl)-5-isoquinolinesulfonamide inhibits the reaction [[1-(4-(6-bromobenzo(1 more ... CTD PMID:22645130 Gper1 Rat N-[2-(4-bromocinnamylamino)ethyl]isoquinoline-5-sulfonamide multiple interactions ISO GPER1 (Homo sapiens) 6480464 N-(2-(4-bromocinnamylamino)ethyl)-5-isoquinolinesulfonamide inhibits the reaction [[GPER1 protein co-treated with Estradiol] results in increased phosphorylation of MAPK1 protein] and N-(2-(4-bromocinnamylamino)ethyl)-5-isoquinolinesulfonamide inhibits the reaction [[GPER1 protein co-treated with Estradiol] results in increased phosphorylation of MAPK3 protein] CTD PMID:37372083 Gper1 Rat N-methyl-4-phenylpyridinium multiple interactions EXP 6480464 GPER1 protein promotes the reaction [IGF1 inhibits the reaction [1-Methyl-4-phenylpyridinium results in increased expression of NOS2 mRNA]] more ... CTD PMID:33035625 Gper1 Rat N-nitrosodimethylamine decreases expression ISO GPER1 (Homo sapiens) 6480464 Dimethylnitrosamine results in decreased expression of GPER1 mRNA CTD PMID:17547211 Gper1 Rat nickel atom decreases expression ISO GPER1 (Homo sapiens) 6480464 Nickel results in decreased expression of GPER1 mRNA CTD PMID:25583101 Gper1 Rat nickel dichloride decreases expression ISO GPER1 (Homo sapiens) 6480464 nickel chloride results in decreased expression of GPER1 mRNA CTD PMID:17547211 Gper1 Rat nickel sulfate increases expression ISO GPER1 (Homo sapiens) 6480464 nickel sulfate results in increased expression of GPER1 mRNA CTD PMID:22714537 Gper1 Rat Nonylphenol increases activity ISO Gper1 (Mus musculus) 6480464 nonylphenol results in increased activity of GPER1 protein CTD PMID:24604882 Gper1 Rat Nonylphenol multiple interactions ISO GPER1 (Homo sapiens) 6480464 nonylphenol binds to and results in increased activity of GPER1 protein CTD PMID:17088055 Gper1 Rat Nonylphenol decreases expression EXP 6480464 nonylphenol results in decreased expression of GPER1 mRNA CTD PMID:15620428 Gper1 Rat oxybenzone affects expression EXP 6480464 oxybenzone affects the expression of GPER1 protein CTD PMID:30099065 Gper1 Rat p-tert-Amylphenol increases expression ISO GPER1 (Homo sapiens) 6480464 4-tert-octylphenol results in increased expression of GPER1 mRNA CTD PMID:29783106 Gper1 Rat paracetamol increases expression ISO GPER1 (Homo sapiens) 6480464 Acetaminophen results in increased expression of GPER1 mRNA CTD PMID:21420995 Gper1 Rat paracetamol decreases expression ISO GPER1 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of GPER1 mRNA CTD PMID:26690555 and PMID:29067470 Gper1 Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of GPER1 mRNA CTD PMID:17077588 Gper1 Rat perfluorohexanesulfonic acid increases expression ISO Gper1 (Mus musculus) 6480464 perfluorohexanesulfonic acid results in increased expression of GPER1 mRNA CTD PMID:37995155 Gper1 Rat perfluorononanoic acid decreases expression ISO GPER1 (Homo sapiens) 6480464 perfluoro-n-nonanoic acid results in decreased expression of GPER1 mRNA CTD PMID:32588087 Gper1 Rat phenobarbital affects expression ISO GPER1 (Homo sapiens) 6480464 Phenobarbital affects the expression of GPER1 mRNA CTD PMID:19159669 Gper1 Rat potassium dichromate decreases expression ISO GPER1 (Homo sapiens) 6480464 Potassium Dichromate results in decreased expression of GPER1 mRNA CTD PMID:17547211 Gper1 Rat propylparaben increases expression ISO GPER1 (Homo sapiens) 6480464 propylparaben results in increased expression of GPER1 mRNA and propylparaben results in increased expression of GPER1 protein CTD PMID:26253279 Gper1 Rat puerarin multiple interactions ISO GPER1 (Homo sapiens) 6480464 Sirolimus inhibits the reaction [puerarin results in increased expression of GPER1 protein] CTD PMID:27796870 Gper1 Rat puerarin increases expression ISO GPER1 (Homo sapiens) 6480464 puerarin results in increased expression of GPER1 protein CTD PMID:27796870 Gper1 Rat pyrrolidine dithiocarbamate multiple interactions EXP 6480464 pyrrolidine dithiocarbamic acid inhibits the reaction [[1-(4-(6-bromobenzo(1 more ... CTD PMID:22645130 Gper1 Rat quercetin multiple interactions ISO GPER1 (Homo sapiens) 6480464 GPER1 protein affects the reaction [Quercetin results in increased expression of FOS protein] and Tamoxifen inhibits the reaction [Quercetin results in increased expression of GPER1 mRNA] CTD PMID:15090535 and PMID:32530119 Gper1 Rat quercetin increases expression ISO GPER1 (Homo sapiens) 6480464 Quercetin results in increased expression of GPER1 mRNA CTD PMID:32530119 and PMID:36982678 Gper1 Rat quercetin decreases expression ISO GPER1 (Homo sapiens) 6480464 Quercetin results in decreased expression of GPER1 mRNA CTD PMID:15309432 Gper1 Rat quinazolines multiple interactions EXP 6480464 Quinazolines inhibits the reaction [[1-(4-(6-bromobenzo(1 more ... CTD PMID:22645130 Gper1 Rat raloxifene multiple interactions ISO GPER1 (Homo sapiens) 6480464 GPER1 protein affects the reaction [Raloxifene Hydrochloride affects the localization of FOXO3 protein] more ... CTD PMID:22453024 more ... Gper1 Rat raloxifene multiple interactions EXP 6480464 [4-(6-bromo-1 more ... CTD PMID:24782323 Gper1 Rat raloxifene increases activity EXP 6480464 Raloxifene Hydrochloride results in increased activity of GPER1 protein CTD PMID:24782323 Gper1 Rat raloxifene multiple interactions ISO Gper1 (Mus musculus) 6480464 Raloxifene Hydrochloride inhibits the reaction [Oxygen deficiency results in increased expression of GPER1 mRNA] CTD PMID:24846829 Gper1 Rat resveratrol multiple interactions ISO GPER1 (Homo sapiens) 6480464 [Coumestrol co-treated with resveratrol] results in decreased expression of GPER1 mRNA CTD PMID:19167446 Gper1 Rat S-(1,2-dichlorovinyl)-L-cysteine decreases expression ISO GPER1 (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine results in decreased expression of GPER1 mRNA CTD PMID:33725128 Gper1 Rat silicon dioxide decreases expression ISO GPER1 (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of GPER1 mRNA CTD PMID:25895662 Gper1 Rat silicon dioxide increases expression ISO GPER1 (Homo sapiens) 6480464 Silicon Dioxide results in increased expression of GPER1 mRNA CTD PMID:34973136 Gper1 Rat simazine affects expression ISO GPER1 (Homo sapiens) 6480464 Simazine affects the expression of GPER1 mRNA CTD PMID:26955487 Gper1 Rat sirolimus multiple interactions ISO GPER1 (Homo sapiens) 6480464 Sirolimus inhibits the reaction [puerarin results in increased expression of GPER1 protein] CTD PMID:27796870 Gper1 Rat sodium arsenite increases expression ISO GPER1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of GPER1 mRNA CTD PMID:22714537 Gper1 Rat sodium arsenite increases expression ISO Gper1 (Mus musculus) 6480464 sodium arsenite results in increased expression of GPER1 mRNA CTD PMID:37682722 Gper1 Rat sodium arsenite affects expression ISO GPER1 (Homo sapiens) 6480464 sodium arsenite affects the expression of GPER1 mRNA CTD PMID:34032870 Gper1 Rat sulforaphane decreases expression ISO GPER1 (Homo sapiens) 6480464 sulforaphane results in decreased expression of GPER1 mRNA CTD PMID:31838189 Gper1 Rat sunitinib decreases expression ISO GPER1 (Homo sapiens) 6480464 Sunitinib results in decreased expression of GPER1 mRNA CTD PMID:31533062 Gper1 Rat tamoxifen multiple interactions ISO GPER1 (Homo sapiens) 6480464 [Tamoxifen co-treated with naringenin] results in decreased expression of GPER1 mRNA more ... CTD PMID:20211987 more ... Gper1 Rat tamoxifen decreases expression ISO GPER1 (Homo sapiens) 6480464 Tamoxifen results in decreased expression of GPER1 mRNA and Tamoxifen results in decreased expression of GPER1 protein CTD PMID:30153467 and PMID:32530119 Gper1 Rat tamoxifen decreases response to substance ISO GPER1 (Homo sapiens) 6480464 GPER1 protein results in decreased susceptibility to Tamoxifen CTD PMID:19911269 Gper1 Rat tamoxifen increases activity ISO GPER1 (Homo sapiens) 6480464 Tamoxifen analog results in increased activity of GPER1 protein CTD PMID:19549922 Gper1 Rat temozolomide increases expression ISO GPER1 (Homo sapiens) 6480464 Temozolomide results in increased expression of GPER1 mRNA CTD PMID:31758290 Gper1 Rat tert-butyl hydroperoxide decreases expression ISO GPER1 (Homo sapiens) 6480464 tert-Butylhydroperoxide results in decreased expression of GPER1 mRNA CTD PMID:15336504 Gper1 Rat testosterone decreases expression ISO Gper1 (Mus musculus) 6480464 Testosterone deficiency results in decreased expression of GPER1 mRNA CTD PMID:33848595 Gper1 Rat Tetrachlorobisphenol A affects binding ISO GPER1 (Homo sapiens) 6480464 tetrachlorodian binds to GPER1 protein CTD PMID:28858478 Gper1 Rat Tetrachlorobisphenol A increases expression ISO GPER1 (Homo sapiens) 6480464 tetrachlorodian results in increased expression of GPER1 mRNA and tetrachlorodian results in increased expression of GPER1 protein CTD PMID:33582643 and PMID:36190352 Gper1 Rat Tetrachlorobisphenol A multiple interactions ISO GPER1 (Homo sapiens) 6480464 4-(6-bromo-1 more ... CTD PMID:36190352 Gper1 Rat Tetrachlorobisphenol A increases expression ISO Gper1 (Mus musculus) 6480464 tetrachlorodian results in increased expression of GPER1 mRNA and tetrachlorodian results in increased expression of GPER1 protein CTD PMID:37992829 Gper1 Rat Tetrachlorobisphenol A affects expression EXP 6480464 tetrachlorodian affects the expression of GPER1 mRNA CTD PMID:37992829 Gper1 Rat Tetrachlorobisphenol A multiple interactions ISO Gper1 (Mus musculus) 6480464 4-(6-bromo-1 more ... CTD PMID:37992829 Gper1 Rat thiram decreases expression ISO GPER1 (Homo sapiens) 6480464 Thiram results in decreased expression of GPER1 mRNA CTD PMID:38568856 Gper1 Rat toluene increases expression EXP 6480464 Toluene results in increased expression of GPER1 mRNA CTD PMID:22967744 Gper1 Rat triclocarban increases expression EXP 6480464 triclocarban results in increased expression of GPER1 mRNA CTD PMID:31576746 Gper1 Rat tyrphostin AG 1478 multiple interactions ISO GPER1 (Homo sapiens) 6480464 RTKI cpd inhibits the reaction [EGF protein results in increased expression of GPER1 protein] more ... CTD PMID:19749156 Gper1 Rat tyrphostin AG 1478 multiple interactions EXP 6480464 RTKI cpd inhibits the reaction [[1-(4-(6-bromobenzo(1 more ... CTD PMID:22645130 Gper1 Rat tyrphostin AG 1478 multiple interactions ISO Gper1 (Mus musculus) 6480464 RTKI cpd inhibits the reaction [bisphenol A promotes the reaction [FOS protein binds to GPER1 promoter]] more ... CTD PMID:23274518 Gper1 Rat urethane decreases expression ISO GPER1 (Homo sapiens) 6480464 Urethane results in decreased expression of GPER1 mRNA CTD PMID:28818685 Gper1 Rat valproic acid increases expression ISO GPER1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of GPER1 mRNA CTD PMID:29154799 Gper1 Rat valproic acid increases methylation ISO GPER1 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of GPER1 gene CTD PMID:29154799 Gper1 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of GPER1 mRNA CTD PMID:23869203 Gper1 Rat vinclozolin decreases expression ISO Gper1 (Mus musculus) 6480464 vinclozolin results in decreased expression of GPER1 mRNA and vinclozolin results in decreased expression of GPER1 protein CTD PMID:36642194 Gper1 Rat wortmannin multiple interactions ISO GPER1 (Homo sapiens) 6480464 Wortmannin inhibits the reaction [tetrachlorodian results in increased expression of GPER1 mRNA] CTD PMID:36190352 Gper1 Rat zearalenone affects binding ISO GPER1 (Homo sapiens) 6480464 Zearalenone binds to GPER1 protein CTD PMID:17088055 Gper1 Rat zearalenone decreases expression ISO GPER1 (Homo sapiens) 6480464 Zearalenone results in decreased expression of GPER1 mRNA CTD PMID:28965971
(S)-amphetamine (EXP) (S)-naringenin (ISO) 1,2-dimethylhydrazine (ISO) 1,3,5-trinitro-1,3,5-triazinane (EXP) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP,ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,2',4,5'-Tetrabromodiphenyl ether (ISO) 2,2-(2-Chlorophenyl-4'-chlorophenyl)-1,1-dichloroethene (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,3-dimethoxynaphthalene-1,4-dione (ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 4,4'-sulfonyldiphenol (ISO) 4,4'-thiodiphenol (ISO) 4-nonylphenol (ISO) 4-tert-Octylphenol (ISO) 5-aza-2'-deoxycytidine (ISO) 6-propyl-2-thiouracil (EXP) afimoxifene (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) ammonium chloride (EXP) antirheumatic drug (ISO) aristolochic acid A (ISO) arsenite(3-) (ISO) arsenous acid (ISO) atrazine (EXP,ISO) benzo[a]pyrene (ISO) Benzo[ghi]perylene (ISO) bis(2-ethylhexyl) phthalate (EXP,ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (EXP,ISO) Bisphenol Z (ISO) Butylbenzyl phthalate (ISO) Butylparaben (ISO) cadmium atom (ISO) cadmium dichloride (ISO) chlordecone (ISO) chlorpyrifos (ISO) chromium atom (ISO) cisplatin (ISO) clobetasol (ISO) cocaine (EXP) copper(II) sulfate (ISO) coumestrol (ISO) cumene (ISO) curcumin (ISO) cyanazine (ISO) cyclosporin A (ISO) cytarabine (ISO) daidzein (ISO) DDT (ISO) dehydroepiandrosterone (ISO) dexamethasone (ISO) Di-n-octyl phthalate (ISO) diarsenic trioxide (ISO) dibutyl phthalate (EXP,ISO) diethyl phthalate (ISO) diethylstilbestrol (ISO) Diisodecyl phthalate (ISO) diisononyl phthalate (ISO) dioxygen (ISO) disodium selenite (ISO) endosulfan (EXP) folic acid (ISO) FR900359 (ISO) fulvestrant (ISO) gefitinib (ISO) genistein (ISO) glyphosate (EXP) herbicide (EXP) hexachlorobenzene (ISO) hydroquinone O-beta-D-glucopyranoside (ISO) iron dichloride (ISO) KT 5720 (EXP) KT 5823 (ISO) LY294002 (EXP) manganese atom (EXP) manganese(0) (EXP) mercury atom (ISO) mercury(0) (ISO) mestranol (ISO) methimazole (EXP) methylparaben (ISO) mono(2-ethylhexyl) phthalate (ISO) N-[2-(4-bromocinnamylamino)ethyl]isoquinoline-5-sulfonamide (EXP,ISO) N-methyl-4-phenylpyridinium (EXP) N-nitrosodimethylamine (ISO) nickel atom (ISO) nickel dichloride (ISO) nickel sulfate (ISO) Nonylphenol (EXP,ISO) oxybenzone (EXP) p-tert-Amylphenol (ISO) paracetamol (ISO) paraquat (EXP) perfluorohexanesulfonic acid (ISO) perfluorononanoic acid (ISO) phenobarbital (ISO) potassium dichromate (ISO) propylparaben (ISO) puerarin (ISO) pyrrolidine dithiocarbamate (EXP) quercetin (ISO) quinazolines (EXP) raloxifene (EXP,ISO) resveratrol (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) silicon dioxide (ISO) simazine (ISO) sirolimus (ISO) sodium arsenite (ISO) sulforaphane (ISO) sunitinib (ISO) tamoxifen (ISO) temozolomide (ISO) tert-butyl hydroperoxide (ISO) testosterone (ISO) Tetrachlorobisphenol A (EXP,ISO) thiram (ISO) toluene (EXP) triclocarban (EXP) tyrphostin AG 1478 (EXP,ISO) urethane (ISO) valproic acid (ISO) vinclozolin (EXP,ISO) wortmannin (ISO) zearalenone (ISO)
Biological Process
adenylate cyclase-activating G protein-coupled receptor signaling pathway (ISO,ISS) apoptotic chromosome condensation (IDA) apoptotic process (IEA) cell communication (IEA) cell differentiation (IEA) cellular response to estradiol stimulus (IBA,IDA,IEA,ISO,ISS) cellular response to glucose stimulus (ISO,ISS) cellular response to mineralocorticoid stimulus (IDA) cellular response to peptide hormone stimulus (ISO,ISS) cellular response to tumor necrosis factor (ISO,ISS) estrogen receptor signaling pathway (IMP) G protein-coupled receptor signaling pathway (IEA,ISO) immune system process (IEA) inflammatory response (IEA) innate immune response (IEA) modulation of chemical synaptic transmission (ISO) negative regulation of cell cycle process (ISO) negative regulation of cell population proliferation (IDA) negative regulation of ERK1 and ERK2 cascade (ISO) negative regulation of fat cell differentiation (ISO,ISS) negative regulation of gene expression (IDA,ISO) negative regulation of inflammatory response (ISO,ISS) negative regulation of leukocyte activation (ISO,ISS) negative regulation of lipid biosynthetic process (ISO,ISS) negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction (ISO) negative regulation of receptor binding (IMP) negative regulation of vascular associated smooth muscle cell migration (ISO) negative regulation of vascular associated smooth muscle cell proliferation (ISO) nervous system development (IEA) neuronal action potential (ISS) nuclear fragmentation involved in apoptotic nuclear change (IDA) nuclear receptor-mediated steroid hormone signaling pathway (IBA,IDA,ISO) positive regulation of apoptotic process (IDA,IMP) positive regulation of cardiac vascular smooth muscle cell differentiation (ISO) positive regulation of cell migration (ISO,ISS) positive regulation of cell population proliferation (ISO,ISS) positive regulation of cytosolic calcium ion concentration (ISO,ISS) positive regulation of endothelial cell apoptotic process (IDA) positive regulation of epidermal growth factor receptor signaling pathway (IMP,ISO) positive regulation of ERK1 and ERK2 cascade (IDA,IMP,ISO) positive regulation of extrinsic apoptotic signaling pathway (IDA) positive regulation of G protein-coupled receptor signaling pathway (ISO,ISS) positive regulation of gene expression (IDA,IMP,ISO) positive regulation of inositol trisphosphate biosynthetic process (ISO,ISS) positive regulation of insulin secretion (ISO,ISS) positive regulation of MAPK cascade (ISO,ISS) positive regulation of neurogenesis (ISO,ISS) positive regulation of neurotransmitter secretion (ISS) positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction (IDA,IMP,ISO) positive regulation of protein import into nucleus (IMP) positive regulation of protein localization to plasma membrane (ISO,ISS) positive regulation of protein phosphorylation (IMP,ISO) positive regulation of release of cytochrome c from mitochondria (IDA) positive regulation of release of sequestered calcium ion into cytosol (ISO,ISS) positive regulation of transcription by RNA polymerase II (ISO,ISS) positive regulation of uterine smooth muscle contraction (ISO,ISS) positive regulation of voltage-gated sodium channel activity (IMP) regulation of cell cycle (ISO,ISS) regulation of cytosolic calcium ion concentration (ISS) serotonin receptor signaling pathway (IMP) signal transduction (IEA) steroid hormone receptor signaling pathway (ISO) vasodilation (IDA,IMP)
Cellular Component
axon (IDA,IEA) axon terminus (IDA) cell projection (IEA) cytoplasm (IDA,IEA,ISO,ISS) cytoplasmic vesicle (IEA) cytoplasmic vesicle membrane (IEA,ISO,ISS) cytoskeleton (IEA) cytosol (ISO) dendrite (IDA,IEA) dendritic shaft (IDA) dendritic spine head (IDA) dendritic spine membrane (IDA,IEA) early endosome (IEA,ISO,ISS) endoplasmic reticulum (IEA,ISO,ISS) endoplasmic reticulum membrane (IDA,IEA) endosome (IEA) Golgi apparatus (IBA,IDA,IEA,ISO,ISS) Golgi membrane (IEA) hippocampal mossy fiber to CA3 synapse (ISO) intracellular membrane-bounded organelle (ISO) keratin filament (ISO,ISS) membrane (IEA) mitochondrial membrane (IDA,IEA) mitochondrion (IEA) neuronal cell body (IDA) nuclear envelope (ISO,ISS) nucleolus (ISO) nucleoplasm (ISO) nucleus (IEA,ISO,ISS) perinuclear region of cytoplasm (IEA,ISO,ISS) plasma membrane (IDA,IEA,ISO) postsynaptic density (IDA,IEA) postsynaptic membrane (IEA) presynaptic active zone (IDA) presynaptic membrane (IDA) recycling endosome (IEA,ISO,ISS) synapse (IEA) trans-Golgi network (ISO,ISS)
1.
Estrogen receptors are found in glia and at extranuclear neuronal sites in the dorsal striatum of female rats: evidence for cholinergic but not dopaminergic colocalization.
Almey A, etal., Endocrinology. 2012 Nov;153(11):5373-83. doi: 10.1210/en.2012-1458. Epub 2012 Aug 23.
2.
The roles of membrane estrogen receptor subtypes in modulating dopamine transporters in PC-12 cells.
Alyea RA, etal., J Neurochem. 2008 Aug;106(4):1525-33. Epub 2008 May 19.
3.
Breast cancer, estrogen receptor and ligands.
Bai Z and Gust R, Arch Pharm (Weinheim). 2009 Mar;342(3):133-49.
4.
Molecular cloning and tissue expression of a novel orphan G protein-coupled receptor from rat lung.
Bonini JA, etal., Biochem Biophys Res Commun 1997 May 8;234(1):190-3.
5.
Selective GPER activation decreases proliferation and activates apoptosis in tumor Leydig cells.
Chimento A, etal., Cell Death Dis. 2013 Aug 1;4:e747. doi: 10.1038/cddis.2013.275.
6.
Structural and mechanistic insights into bisphenols action provide guidelines for risk assessment and discovery of bisphenol A substitutes.
Delfosse V, etal., Proc Natl Acad Sci U S A. 2012 Sep 11;109(37):14930-5. doi: 10.1073/pnas.1203574109. Epub 2012 Aug 27.
7.
Activation of a novel estrogen receptor, GPER, is cardioprotective in male and female rats.
Deschamps AM and Murphy E, Am J Physiol Heart Circ Physiol. 2009 Nov;297(5):H1806-13. Epub 2009 Aug 28.
8.
Serum levels of G protein-coupled estrogen receptor 1 (GPER1) in drug-naive patients with generalized anxiety disorder.
Fındıklı E, etal., Psychiatry Res. 2016 Oct 30;244:312-6. doi: 10.1016/j.psychres.2016.04.098. Epub 2016 Jul 22.
9.
Expression of G protein-coupled oestrogen receptor in melanoma and in pregnancy-associated melanoma.
Fábián M, etal., J Eur Acad Dermatol Venereol. 2017 Sep;31(9):1453-1461. doi: 10.1111/jdv.14304. Epub 2017 Jun 20.
10.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
11.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
12.
Estradiol activates epithelial sodium channels in rat alveolar cells through the G protein-coupled estrogen receptor.
Greenlee MM, etal., Am J Physiol Lung Cell Mol Physiol. 2013 Dec;305(11):L878-89. doi: 10.1152/ajplung.00008.2013. Epub 2013 Oct 4.
13.
Aldosterone mediates its rapid effects in vascular endothelial cells through GPER activation.
Gros R, etal., Am J Physiol Cell Physiol. 2013 Mar;304(6):C532-40. doi: 10.1152/ajpcell.00203.2012. Epub 2013 Jan 2.
14.
G-protein coupled estrogen receptor 1 mediated estrogenic neuroprotection against spinal cord injury.
Hu R, etal., Crit Care Med. 2012 Dec;40(12):3230-7. doi: 10.1097/CCM.0b013e3182657560.
15.
2-methoxyestradiol binding of GPR30 down-regulates angiotensin AT(1) receptor.
Koganti S, etal., Eur J Pharmacol. 2014 Jan 15;723:131-40. doi: 10.1016/j.ejphar.2013.10.064. Epub 2013 Nov 18.
16.
G protein-coupled estrogen receptor1 (GPER1) may mediate Rho-kinase (ROCK-2) up-regulation in coronary endothelial cells.
Kurt AH, etal., Endocr Regul. 2013 Apr;47(2):75-84. doi: 10.4149/endo_2013_02_75.
17.
Expression and signaling of G protein-coupled estrogen receptor 1 (GPER) in rat sertoli cells.
Lucas TF, etal., Biol Reprod. 2010 Aug 1;83(2):307-17. Epub 2010 May 5.
18.
The unfolding stories of GPR30, a new membrane-bound estrogen receptor.
Maggiolini M and Picard D, J Endocrinol. 2010 Feb;204(2):105-14. Epub 2009 Sep 18.
19.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
20.
Spatial and temporal changes in the expression of steroid hormone receptors in mouse model of endometriosis.
Mishra A, etal., J Assist Reprod Genet. 2020 May;37(5):1069-1081. doi: 10.1007/s10815-020-01725-6. Epub 2020 Mar 9.
21.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
22.
Bisphenol A and human chronic diseases: Current evidences, possible mechanisms, and future perspectives.
Rezg R, etal., Environ Int. 2014 Mar;64C:83-90. doi: 10.1016/j.envint.2013.12.007. Epub 2013 Dec 29.
23.
GOA pipeline
RGD automated data pipeline
24.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
25.
Expression of the G protein-coupled estrogen receptor (GPER) in endometriosis: a tissue microarray study.
Samartzis N, etal., Reprod Biol Endocrinol. 2012 Apr 20;10:30. doi: 10.1186/1477-7827-10-30.
26.
G-protein oestrogen receptor 1: trials and tribulations of a membrane oestrogen receptor.
Srivastava DP and Evans PD, J Neuroendocrinol. 2013 Nov;25(11):1219-30. doi: 10.1111/jne.12071.
27.
Attenuation of Microbiotal Dysbiosis and Hypertension in a CRISPR/Cas9 Gene Ablation Rat Model of GPER1.
Waghulde H, etal., Hypertension. 2018 Nov;72(5):1125-1132. doi: 10.1161/HYPERTENSIONAHA.118.11175.
28.
Extra-nuclear estrogen receptor GPR30 regulates serotonin function in rat hypothalamus.
Xu H, etal., Neuroscience. 2009 Feb 18;158(4):1599-607. doi: 10.1016/j.neuroscience.2008.11.028. Epub 2008 Nov 21.
Gper1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 20,331,073 - 20,336,527 (-) NCBI GRCr8 mRatBN7.2 12 15,217,217 - 15,222,679 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 15,217,442 - 15,221,889 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 12 16,027,880 - 16,029,158 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 12 16,651,625 - 16,652,903 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 12 15,677,933 - 15,679,211 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 12 17,309,122 - 17,315,267 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 17,309,834 - 17,311,112 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 12 19,296,086 - 19,301,691 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 12 15,718,615 - 15,719,893 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 12 15,748,542 - 15,749,821 (-) NCBI Celera 12 16,971,703 - 16,972,981 (-) NCBI Celera Cytogenetic Map 12 q11 NCBI
GPER1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 7 1,087,118 - 1,093,810 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 7 1,082,208 - 1,093,815 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 7 1,126,754 - 1,133,446 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 7 1,092,969 - 1,099,977 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 7 899,752 - 906,692 NCBI Celera 7 1,094,088 - 1,101,068 (+) NCBI Celera Cytogenetic Map 7 p22.3 NCBI HuRef 7 1,041,713 - 1,048,693 (+) NCBI HuRef CHM1_1 7 1,126,080 - 1,133,090 (+) NCBI CHM1_1 T2T-CHM13v2.0 7 1,192,020 - 1,198,681 (+) NCBI T2T-CHM13v2.0 CRA_TCAGchr7v2 7 1,180,870 - 1,187,850 (+) NCBI
Gper1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 139,408,905 - 139,413,555 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 139,408,906 - 139,413,555 (+) Ensembl GRCm39 Ensembl GRCm38 5 139,423,150 - 139,427,800 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 139,423,151 - 139,427,800 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 139,899,133 - 139,903,754 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 139,676,821 - 139,681,430 (+) NCBI MGSCv36 mm8 Celera 5 136,477,197 - 136,481,822 (+) NCBI Celera Cytogenetic Map 5 G2 NCBI cM Map 5 78.58 NCBI
Gper1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955460 8,790,798 - 8,794,902 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955460 8,790,798 - 8,794,902 (+) NCBI ChiLan1.0 ChiLan1.0
GPER1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 6 6,038,040 - 6,040,197 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 7 54,349,340 - 54,364,886 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 7 1,331,586 - 1,338,194 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 7 1,454,768 - 1,461,376 (+) NCBI panpan1.1 PanPan1.1 panPan2
GPER1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 6 15,792,072 - 15,796,922 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 6 15,792,897 - 15,794,051 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 6 17,265,181 - 17,311,159 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 6 15,922,801 - 15,968,766 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 6 15,922,807 - 15,927,433 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 6 15,725,481 - 15,771,429 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 6 15,652,239 - 15,698,182 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 6 15,940,139 - 15,986,136 (-) NCBI UU_Cfam_GSD_1.0
Gper1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409344 143,716,868 - 143,723,998 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936754 1,288,912 - 1,293,427 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936754 1,288,891 - 1,293,555 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
GPER1
GPER1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 28 20,491,874 - 20,497,966 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 28 20,492,188 - 20,493,315 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666090 1,198,018 - 1,204,300 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Gper1
.
Predicted Target Of
Count of predictions: 83 Count of miRNA genes: 74 Interacting mature miRNAs: 74 Transcripts: ENSRNOT00000001732 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2312418 Kidm41 Kidney mass QTL 41 3.7 0.0001 kidney mass (VT:0002707) single kidney wet weight to body weight ratio (CMO:0000622) 12 1 19611090 Rat 61443 Btemp2 Thermal response to stress QTL 2 3.3 0.000094 body temperature trait (VT:0005535) core body temperature (CMO:0001036) 12 15025183 20794014 Rat 8552964 Pigfal17 Plasma insulin-like growth factor 1 level QTL 17 3.5 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564495 46669029 Rat 7411641 Foco19 Food consumption QTL 19 27.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 1549912 Bp268 Blood pressure QTL 268 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 10 13182736 46669029 Rat 2302060 Pia37 Pristane induced arthritis QTL 37 6.1 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 12 13198157 46669029 Rat 9590147 Scort7 Serum corticosterone level QTL 7 13.61 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 12 1 42110980 Rat 1641928 Alcrsp5 Alcohol response QTL 5 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 12 12812385 46669029 Rat 8552912 Pigfal6 Plasma insulin-like growth factor 1 level QTL 6 5 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564498 46669029 Rat 1549829 Scl48 Serum cholesterol level QTL 48 5 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 12 9603277 46669029 Rat 10059594 Kidm46 Kidney mass QTL 46 3.79 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 12 6107579 46669029 Rat 61331 Eau2 Experimental allergic uveoretinitis QTL 2 0.0005 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 12 8525423 28064601 Rat 1581516 Cm56 Cardiac mass QTL 56 4.2 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 12 1 29333307 Rat 9590086 Insglur6 Insulin/glucose ratio QTL 6 18.97 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 12 1 42110980 Rat 8552918 Pigfal7 Plasma insulin-like growth factor 1 level QTL 7 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564495 46669029 Rat 6893681 Bw109 Body weight QTL 109 2.3 0.004 body mass (VT:0001259) body weight (CMO:0000012) 12 1 23297788 Rat 1549902 Bp269 Blood pressure QTL 269 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 12 13182736 46669029 Rat 1302792 Scl21 Serum cholesterol level QTL 21 3.8 0.0011 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 12 7196730 46669029 Rat 61404 Bw120 Body weight QTL 120 5.1 body mass (VT:0001259) body mass index (BMI) (CMO:0000105) 12 12351619 46669029 Rat 1331786 Kidm11 Kidney mass QTL 11 3.571 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 12 11073825 24234895 Rat 1598855 Bp294 Blood pressure QTL 294 3.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 12 1 34851688 Rat 1600391 Edcs2 Endometrial carcinoma susceptibility QTL2 3.5 0.01 uterus morphology trait (VT:0001120) percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759) 12 6833190 17870186 Rat 2293699 Bss49 Bone structure and strength QTL 49 5.61 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra trabecular cross-sectional area (CMO:0001692) 12 10474137 46669029 Rat 10755457 Coatc14 Coat color QTL 14 0.01759 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 12 1 22591684 Rat 1331761 Bp218 Blood pressure QTL 218 2.973 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 12 11073825 45055165 Rat 634351 Apr5 Acute phase response QTL 5 6.7 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 12 1 44503507 Rat 8694179 Bw150 Body weight QTL 150 2.9 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 12 1 42110980 Rat 634350 Apr4 Acute phase response QTL 4 6 orosomucoid 1 amount (VT:0010541) plasma orosomucoid 1 level (CMO:0001467) 12 1172005 46172005 Rat 7411545 Bw128 Body weight QTL 128 5.2 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 12 1 42110980 Rat 61416 Pia4 Pristane induced arthritis QTL 4 8.4 joint integrity trait (VT:0010548) arthritic paw count (CMO:0001460) 12 13635523 30827399 Rat 7204484 Bp358 Blood pressure QTL 358 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 12 13008296 19212979 Rat 7411547 Bw129 Body weight QTL 129 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 6 5564495 46669029 Rat 7387292 Kidm42 Kidney mass QTL 42 3.03 0.0004 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 12 1 36247923 Rat 61421 Cia12 Collagen induced arthritis QTL 12 4.6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 13635523 35682913 Rat 1300157 Rf21 Renal function QTL 21 4.4 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 12 9318216 32103380 Rat 737979 Pia22 Pristane induced arthritis QTL 22 53.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 1 44465750 Rat 2303569 Gluco44 Glucose level QTL 44 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 12 12812385 46669029 Rat 7411586 Foco5 Food consumption QTL 5 5.4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 2303575 Insul14 Insulin level QTL 14 4 blood insulin amount (VT:0001560) blood insulin level (CMO:0000349) 12 1 42450532 Rat 7411588 Foco6 Food consumption QTL 6 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 2302042 Pia38 Pristane induced arthritis QTL 38 3.5 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 12 1 44503507 Rat 2300186 Bmd59 Bone mineral density QTL 59 7.1 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 12 10474137 46669029 Rat 7411595 Foco9 Food consumption QTL 9 4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 7411597 Foco10 Food consumption QTL 10 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 2293086 Iddm30 Insulin dependent diabetes mellitus QTL 30 3.82 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 12 8449490 28302290 Rat 7411660 Foco28 Food consumption QTL 28 10.9 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 1331755 Bp219 Blood pressure QTL 219 3.041 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 12 11073825 28064557 Rat
This gene Gper1 is modified in the following models/strains:
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
83
82
51
25
51
6
210
97
93
45
59
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000001732 ⟹ ENSRNOP00000001732
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 15,217,442 - 15,221,889 (-) Ensembl Rnor_6.0 Ensembl 12 17,309,834 - 17,311,112 (-) Ensembl
RefSeq Acc Id:
NM_133573 ⟹ NP_598257
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 20,331,791 - 20,333,069 (-) NCBI mRatBN7.2 12 15,217,935 - 15,219,213 (-) NCBI Rnor_6.0 12 17,309,834 - 17,311,112 (-) NCBI Rnor_5.0 12 19,296,086 - 19,301,691 (-) NCBI RGSC_v3.4 12 15,718,615 - 15,719,893 (-) RGD Celera 12 16,971,703 - 16,972,981 (-) RGD
Sequence:
TTCTGTGACCCTTTCAGCAAGTCCTGAAAGCTTCTACGGGAAGCCATGGCTGCAACTACTCCAGCACAAGATGTTGGCGTAGAGATCTACCTAGGTCCCGTGTGGCCAGCCCCTTCCAACAGCACCCC
hide sequence
RefSeq Acc Id:
XM_006248914 ⟹ XP_006248976
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 20,331,073 - 20,336,527 (-) NCBI mRatBN7.2 12 15,217,217 - 15,222,679 (-) NCBI Rnor_6.0 12 17,309,122 - 17,315,267 (-) NCBI Rnor_5.0 12 19,296,086 - 19,301,691 (-) NCBI
Sequence:
ACACACACACACACACACACACACACACACAGAGCTATCTACATGCAGGTAACTGCTTCATTTTTTATAAATAAAAATATGTTATGTGTATGACTGTCTTATCAGCATGTGTGCCACCTGTGTGCCTG
hide sequence
RefSeq Acc Id:
NP_598257 ⟸ NM_133573
- UniProtKB:
O08878 (UniProtKB/Swiss-Prot), G3V654 (UniProtKB/TrEMBL), A6K1V7 (UniProtKB/TrEMBL)
- Sequence:
MAATTPAQDVGVEIYLGPVWPAPSNSTPLALNLSLALREDAPGNLTGDLSEHQQYVIALFLSCLYTIFLFPIGFVGNILILVVNISFREKMTIPDLYFINLAAADLILVADSLIEVFNLDEQYYDIAV
hide sequence
RefSeq Acc Id:
XP_006248976 ⟸ XM_006248914
- Peptide Label:
isoform X1
- UniProtKB:
O08878 (UniProtKB/Swiss-Prot), G3V654 (UniProtKB/TrEMBL), A6K1V7 (UniProtKB/TrEMBL)
- Sequence:
MAATTPAQDVGVEIYLGPVWPAPSNSTPLALNLSLALREDAPGNLTGDLSEHQQYVIALFLSCLYTIFLFPIGFVGNILILVVNISFREKMTIPDLYFINLAAADLILVADSLIEVFNLDEQYYDIAV
hide sequence
Ensembl Acc Id:
ENSRNOP00000001732 ⟸ ENSRNOT00000001732
BioCyc Gene G2FUF-19895 BioCyc
Ensembl Genes ENSRNOG00000001287 Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript ENSRNOT00000001732.4 UniProtKB/TrEMBL
ENSRNOT00000160681 ENTREZGENE
Gene3D-CATH Rhodopsin 7-helix transmembrane proteins UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro GPCR_Rhodpsn UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
GPCR_Rhodpsn_7TM UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
GPER1-like UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report rno:171104 UniProtKB/Swiss-Prot
NCBI Gene 171104 ENTREZGENE
PANTHER G-PROTEIN COUPLED ESTROGEN RECEPTOR 1 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
G-PROTEIN COUPLED RECEPTOR 182 AND ESTROGEN RECEPTOR 1 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam 7tm_1 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen Gper1 PhenoGen
PRINTS GPCRRHODOPSN UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE G_PROTEIN_RECEP_F1_1 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
G_PROTEIN_RECEP_F1_2 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx ENSRNOG00000001287 RatGTEx
Superfamily-SCOP Family A G protein-coupled receptor-like UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt A6K1V7 ENTREZGENE, UniProtKB/TrEMBL
G3V654 ENTREZGENE, UniProtKB/TrEMBL
GPER1_RAT UniProtKB/Swiss-Prot, ENTREZGENE
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2013-09-16
Gper1
G protein-coupled estrogen receptor 1
Gper
G protein-coupled estrogen receptor 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-02-22
Gper
G protein-coupled estrogen receptor 1
Gpr30
G protein-coupled receptor 30
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2004-02-26
Gpr30
G protein-coupled receptor 30
Symbol and Name status set to approved
625702 APPROVED
2002-08-07
Gpr30
G protein-coupled receptor 30
Symbol and Name status set to provisional
70820 PROVISIONAL
