Symbol:
CDC42
Name:
cell division cycle 42
RGD ID:
730976
HGNC Page
HGNC:1736
Description:
Enables several functions, including GBD domain binding activity; GTP binding activity; and enzyme binding activity. Involved in several processes, including cell surface receptor signaling pathway; positive regulation of cellular component biogenesis; and regulation of cell cycle process. Located in several cellular components, including filopodium; microtubule cytoskeleton; and midbody. Part of Golgi transport complex. Implicated in fibrosarcoma. Biomarker of Alzheimer's disease; bipolar disorder; pancreatic cancer; and rhinitis.
Type:
protein-coding
RefSeq Status:
REVIEWED
Previously known as:
CDC42Hs; cell division control protein 42 homolog; cell division cycle 42 (GTP binding protein, 25kDa); dJ224A6.1.1 (cell division cycle 42 (GTP-binding protein, 25kD)); dJ224A6.1.2 (cell division cycle 42 (GTP-binding protein, 25kD)); G25K; G25K GTP-binding protein; growth-regulating protein; GTP binding protein, 25kDa; GTP-binding protein, 25kD; small GTP binding protein CDC42; TKS
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Mus musculus (house mouse):
Cdc42 (cell division cycle 42) HGNC
EggNOG, Ensembl, HGNC, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Cdc42 (cell division cycle 42) HGNC
EggNOG, Ensembl, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Chinchilla lanigera (long-tailed chinchilla):
Cdc42 (cell division cycle 42) NCBI
Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):
CDC42 (cell division cycle 42) NCBI
Ortholog
Canis lupus familiaris (dog):
LOC403934 (cell division cycle 42) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Cdc42 (cell division cycle 42) NCBI
Ortholog
Sus scrofa (pig):
CDC42 (cell division cycle 42) HGNC
EggNOG, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Chlorocebus sabaeus (green monkey):
CDC42 (cell division cycle 42) NCBI
Ortholog
Heterocephalus glaber (naked mole-rat):
Cdc42 (cell division cycle 42) NCBI
Ortholog
Other homologs 2
Canis lupus familiaris (dog):
CDC42 (cell division cycle 42) HGNC
Inparanoid, NCBI
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Cdc42 (cell division cycle 42)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Cdc42 (cell division cycle 42)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
cdc42 (cell division cycle 42)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoInspector|SonicParanoid|ZFIN)
Saccharomyces cerevisiae (baker's yeast):
CDC42
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Cdc42
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
cdc-42
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
cdc42
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoInspector|PANTHER|SonicParanoid)
Xenopus laevis (African clawed frog):
cdc42.S
Alliance
DIOPT (Xenbase)
Xenopus laevis (African clawed frog):
cdc42.L
Alliance
DIOPT (Xenbase)
Related Pseudogenes:
CDC42P1
CDC42P2
CDC42P3
CDC42P4
CDC42P5
CDC42P6
CDC42P7
LOC101409255
LOC101409256
Allele / Splice:
See ClinVar data
Latest Assembly:
GRCh38 - Human Genome Assembly GRCh38
Position:
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 22,052,709 - 22,101,360 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 22,052,627 - 22,101,360 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 22,379,202 - 22,427,853 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 22,251,707 - 22,292,023 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 22,124,487 - 22,164,741 NCBI Celera 1 20,702,109 - 20,742,389 (+) NCBI Celera Cytogenetic Map 1 p36.12 NCBI HuRef 1 20,622,960 - 20,663,212 (+) NCBI HuRef CHM1_1 1 22,491,651 - 22,531,931 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 21,876,517 - 21,925,101 (+) NCBI T2T-CHM13v2.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
CDC42 Human (+)-catechin multiple interactions EXP 6480464 [Catechin co-treated with Grape Seed Proanthocyanidins] results in increased expression of CDC42 mRNA CTD PMID:24763279 CDC42 Human (-)-epigallocatechin 3-gallate decreases expression EXP 6480464 epigallocatechin gallate results in decreased expression of CDC42 protein CTD PMID:31195006 CDC42 Human (S)-nicotine multiple interactions ISO RGD:730977 6480464 [Nicotine co-treated with 1-Methyl-4-phenyl-1,2,3,6-tetrahydropyridine] results in decreased expression of CDC42 mRNA; Nicotine inhibits the reaction more ... CTD PMID:20230807 CDC42 Human 1,2-dimethylhydrazine decreases expression ISO RGD:730977 6480464 1,2-Dimethylhydrazine results in decreased expression of CDC42 mRNA CTD PMID:22206623 CDC42 Human 1,2-dimethylhydrazine multiple interactions ISO RGD:730977 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of CDC42 mRNA CTD PMID:22206623 CDC42 Human 1,4-dichlorobenzene increases expression ISO RGD:730977 6480464 4-dichlorobenzene results in increased expression of CDC42 mRNA CTD PMID:26975756 CDC42 Human 1,8-cineole multiple interactions ISO RGD:730977 6480464 Eucalyptol inhibits the reaction [Glucose results in increased expression of CDC42 protein]; Eucalyptol inhibits the more ... CTD PMID:31483951 CDC42 Human 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine increases expression ISO RGD:730977 6480464 1-Methyl-4-phenyl-1,2,3,6-tetrahydropyridine results in increased expression of CDC42 mRNA CTD PMID:20230807 CDC42 Human 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine multiple interactions ISO RGD:730977 6480464 [Nicotine co-treated with 1-Methyl-4-phenyl-1,2,3,6-tetrahydropyridine] results in decreased expression of CDC42 mRNA; Nicotine inhibits the reaction more ... CTD PMID:20230807 CDC42 Human 17alpha-ethynylestradiol multiple interactions ISO RGD:730977 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of CDC42 mRNA CTD PMID:17942748 CDC42 Human 17alpha-ethynylestradiol increases expression ISO RGD:730977 6480464 Ethinyl Estradiol results in increased expression of CDC42 mRNA CTD PMID:17555576|PMID:17942748 CDC42 Human 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:730977 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of CDC42 mRNA CTD PMID:17942748 CDC42 Human 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:71043 6480464 Tetrachlorodibenzodioxin affects the expression of CDC42 mRNA CTD PMID:34747641 CDC42 Human 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:730977 6480464 Tetrachlorodibenzodioxin affects the expression of CDC42 mRNA CTD PMID:21570461 CDC42 Human 2,4-dinitrotoluene affects expression ISO RGD:71043 6480464 2,4-dinitrotoluene affects the expression of CDC42 mRNA CTD PMID:21346803 CDC42 Human 2-amino-14,16-dimethyloctadecan-3-ol decreases expression EXP 6480464 2-amino-14,16-dimethyloctadecan-3-ol results in decreased expression of CDC42 protein CTD PMID:32044396 CDC42 Human 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO RGD:730977 6480464 [Dexamethasone co-treated with rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS1 protein] results in increased expression more ... CTD PMID:16054899 CDC42 Human 4,4'-sulfonyldiphenol increases expression ISO RGD:730977 6480464 bisphenol S results in increased expression of CDC42 mRNA CTD PMID:39298647 CDC42 Human 4,4'-sulfonyldiphenol multiple interactions ISO RGD:71043 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of more ... CTD PMID:36041667 CDC42 Human 4-hydroxyphenyl retinamide increases expression ISO RGD:730977 6480464 Fenretinide results in increased expression of CDC42 mRNA CTD PMID:28973697 CDC42 Human 6-propyl-2-thiouracil increases expression ISO RGD:71043 6480464 Propylthiouracil results in increased expression of CDC42 mRNA CTD PMID:30047161 CDC42 Human acetylsalicylic acid decreases expression EXP 6480464 Aspirin results in decreased expression of CDC42 mRNA CTD PMID:14976132 CDC42 Human acrylamide decreases expression ISO RGD:71043 6480464 Acrylamide results in decreased expression of CDC42 mRNA CTD PMID:28959563 CDC42 Human acteoside multiple interactions EXP 6480464 acteoside inhibits the reaction [HMGB1 protein results in increased expression of and results in increased more ... CTD PMID:36112883 CDC42 Human acteoside decreases expression EXP 6480464 acteoside results in decreased expression of CDC42 mRNA CTD PMID:36112883 CDC42 Human actinomycin D multiple interactions EXP 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of CDC42 protein CTD PMID:38460933 CDC42 Human aflatoxin B1 increases expression ISO RGD:730977 6480464 Aflatoxin B1 results in increased expression of CDC42 mRNA CTD PMID:19770486 CDC42 Human aflatoxin B1 increases methylation EXP 6480464 Aflatoxin B1 results in increased methylation of CDC42 gene; Aflatoxin B1 results in increased methylation more ... CTD PMID:27153756|PMID:30157460 CDC42 Human aldehydo-D-glucose increases expression ISO RGD:730977 6480464 Glucose results in increased expression of CDC42 mRNA; Glucose results in increased expression of CDC42 more ... CTD PMID:24659233|PMID:31483951 CDC42 Human aldehydo-D-glucose multiple interactions ISO RGD:730977 6480464 Eucalyptol inhibits the reaction [Glucose results in increased expression of CDC42 protein]; Resveratrol inhibits the more ... CTD PMID:24659233|PMID:31483951 CDC42 Human all-trans-retinoic acid decreases expression EXP 6480464 Tretinoin results in decreased expression of CDC42 mRNA CTD PMID:23724009 CDC42 Human all-trans-retinoic acid increases expression EXP 6480464 Tretinoin results in increased expression of CDC42 mRNA CTD PMID:33167477 CDC42 Human amitrole increases expression ISO RGD:71043 6480464 Amitrole results in increased expression of CDC42 mRNA CTD PMID:30047161 CDC42 Human ammonium chloride affects expression ISO RGD:71043 6480464 Ammonium Chloride affects the expression of CDC42 mRNA CTD PMID:16483693 CDC42 Human antirheumatic drug decreases expression EXP 6480464 Antirheumatic Agents results in decreased expression of CDC42 mRNA CTD PMID:24449571 CDC42 Human Aroclor 1254 decreases expression ISO RGD:730977 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of CDC42 mRNA; Chlorodiphenyl (54% Chlorine) results in more ... CTD PMID:23650126 CDC42 Human arsane affects expression EXP 6480464 Arsenic affects the expression of CDC42 mRNA CTD PMID:18414638 CDC42 Human arsane affects methylation EXP 6480464 Arsenic affects the methylation of CDC42 gene CTD PMID:25304211 CDC42 Human arsenic atom affects expression EXP 6480464 Arsenic affects the expression of CDC42 mRNA CTD PMID:18414638 CDC42 Human arsenic atom affects methylation EXP 6480464 Arsenic affects the methylation of CDC42 gene CTD PMID:25304211 CDC42 Human arsenite(3-) multiple interactions EXP 6480464 arsenite promotes the reaction [G3BP1 protein binds to CDC42 mRNA] CTD PMID:32406909 CDC42 Human arsenous acid increases expression EXP 6480464 Arsenic Trioxide results in increased expression of CDC42 mRNA CTD PMID:20458559 CDC42 Human atorvastatin calcium multiple interactions EXP 6480464 [Poly I-C co-treated with Atorvastatin] results in decreased expression of CDC42 mRNA CTD PMID:34696514 CDC42 Human atrazine increases expression EXP 6480464 Atrazine results in increased expression of CDC42 mRNA CTD PMID:22378314 CDC42 Human bazedoxifene increases expression EXP 6480464 bazedoxifene results in increased expression of CDC42 mRNA CTD PMID:19914376 CDC42 Human benzene increases expression EXP 6480464 Benzene results in increased expression of CDC42 mRNA CTD PMID:33064461 CDC42 Human benzo[a]pyrene increases expression ISO RGD:730977 6480464 Benzo(a)pyrene results in increased expression of CDC42 mRNA CTD PMID:20504355|PMID:22228805 CDC42 Human benzo[a]pyrene affects methylation EXP 6480464 Benzo(a)pyrene affects the methylation of CDC42 promoter CTD PMID:30157460 CDC42 Human benzo[a]pyrene decreases methylation EXP 6480464 Benzo(a)pyrene results in decreased methylation of CDC42 promoter CTD PMID:27901495 CDC42 Human benzo[a]pyrene diol epoxide I decreases expression EXP 6480464 7,8-Dihydro-7,8-dihydroxybenzo(a)pyrene 9,10-oxide results in decreased expression of CDC42 mRNA; 7,8-Dihydro-7,8-dihydroxybenzo(a)pyrene 9,10-oxide results in decreased expression more ... CTD PMID:20018196|PMID:30011042 CDC42 Human bis(2-ethylhexyl) phthalate decreases expression ISO RGD:730977 6480464 Diethylhexyl Phthalate results in decreased expression of CDC42 mRNA CTD PMID:33754040 CDC42 Human bisphenol A increases expression ISO RGD:71043 6480464 bisphenol A results in increased expression of CDC42 mRNA CTD PMID:33296240 CDC42 Human bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of CDC42 protein CTD PMID:37567409 CDC42 Human bisphenol A multiple interactions ISO RGD:71043 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of more ... CTD PMID:36041667 CDC42 Human bisphenol AF increases expression EXP 6480464 bisphenol AF results in increased expression of CDC42 protein CTD PMID:34186270 CDC42 Human Bisphenol B increases expression EXP 6480464 bisphenol B results in increased expression of CDC42 protein CTD PMID:34186270 CDC42 Human bisphenol F increases expression EXP 6480464 bisphenol F results in increased expression of CDC42 protein CTD PMID:34186270 CDC42 Human bisphenol F multiple interactions ISO RGD:71043 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of more ... CTD PMID:36041667 CDC42 Human bortezomib decreases expression EXP 6480464 Bortezomib results in decreased expression of CDC42 mRNA CTD PMID:20977926 CDC42 Human cadmium acetate affects expression ISO RGD:71043 6480464 cadmium acetate affects the expression of CDC42 mRNA CTD PMID:16249259 CDC42 Human cadmium atom increases oxidation ISO RGD:730977 6480464 Cadmium results in increased oxidation of CDC42 protein CTD PMID:24077948 CDC42 Human cadmium atom multiple interactions ISO RGD:730977 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased activity of and more ... CTD PMID:29939372 CDC42 Human cadmium dichloride increases expression ISO RGD:71043 6480464 Cadmium Chloride results in increased expression of CDC42 protein CTD PMID:15618353 CDC42 Human cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of CDC42 mRNA CTD PMID:33129824 CDC42 Human cadmium dichloride multiple interactions ISO RGD:730977 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased activity of and more ... CTD PMID:29939372 CDC42 Human calcium atom multiple interactions ISO RGD:730977 6480464 Calcium promotes the reaction [PAFAH1B1 protein binds to IQGAP1 protein binds to CDC42 protein] CTD PMID:16369480 CDC42 Human calcium(0) multiple interactions ISO RGD:730977 6480464 Calcium promotes the reaction [PAFAH1B1 protein binds to IQGAP1 protein binds to CDC42 protein] CTD PMID:16369480 CDC42 Human cannabidiol decreases expression EXP 6480464 Cannabidiol results in decreased expression of CDC42 protein CTD PMID:37625625 CDC42 Human carbon nanotube decreases expression EXP 6480464 Nanotubes, Carbon results in decreased expression of CDC42 mRNA CTD PMID:23634900 CDC42 Human carboplatin decreases expression ISO RGD:71043 6480464 Carboplatin results in decreased expression of CDC42 mRNA CTD PMID:18172885 CDC42 Human casticin decreases expression ISO RGD:730977 6480464 casticin results in decreased expression of CDC42 mRNA CTD PMID:28444820 CDC42 Human cefaloridine decreases expression ISO RGD:71043 6480464 Cephaloridine results in decreased expression of CDC42 mRNA CTD PMID:18172885 CDC42 Human CGP 52608 multiple interactions EXP 6480464 CGP 52608 promotes the reaction [RORA protein binds to CDC42 gene] CTD PMID:28238834 CDC42 Human chlorpyrifos increases expression ISO RGD:730977 6480464 Chlorpyrifos results in increased expression of CDC42 mRNA CTD PMID:37019170 CDC42 Human chrysene decreases expression ISO RGD:730977 6480464 chrysene results in decreased expression of CDC42 mRNA CTD PMID:26377693 CDC42 Human cisplatin multiple interactions EXP 6480464 [Cisplatin co-treated with Quercetin] results in increased expression of CDC42 mRNA; [Cisplatin results in decreased more ... CTD PMID:21858171|PMID:27514524|PMID:30871063 CDC42 Human cisplatin increases expression EXP 6480464 Cisplatin results in increased expression of CDC42 mRNA CTD PMID:25450742 CDC42 Human cisplatin decreases expression ISO RGD:71043 6480464 Cisplatin results in decreased expression of CDC42 mRNA; Cisplatin results in decreased expression of CDC42 more ... CTD PMID:18172885|PMID:23628706 CDC42 Human copper atom multiple interactions ISO RGD:730977 6480464 [ATP7A gene mutant form results in increased abundance of Copper] which results in increased expression more ... CTD PMID:15467011|PMID:16629173 CDC42 Human copper(0) multiple interactions ISO RGD:730977 6480464 [ATP7A gene mutant form results in increased abundance of Copper] which results in increased expression more ... CTD PMID:15467011|PMID:16629173 CDC42 Human crocidolite asbestos decreases expression ISO RGD:730977 6480464 Asbestos, Crocidolite results in decreased expression of CDC42 mRNA CTD PMID:29279043 CDC42 Human CU-O LINKAGE decreases expression EXP 6480464 cupric oxide results in decreased expression of CDC42 protein CTD PMID:25470785 CDC42 Human D-glucose increases expression ISO RGD:730977 6480464 Glucose results in increased expression of CDC42 mRNA; Glucose results in increased expression of CDC42 more ... CTD PMID:24659233|PMID:31483951 CDC42 Human D-glucose multiple interactions ISO RGD:730977 6480464 Eucalyptol inhibits the reaction [Glucose results in increased expression of CDC42 protein]; Resveratrol inhibits the more ... CTD PMID:24659233|PMID:31483951 CDC42 Human dexamethasone multiple interactions ISO RGD:730977 6480464 [Dexamethasone co-treated with rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS1 protein] results in increased expression more ... CTD PMID:16054899 CDC42 Human dexamethasone decreases expression ISO RGD:71043 6480464 Dexamethasone results in decreased expression of CDC42 mRNA CTD PMID:29111458 CDC42 Human diarsenic trioxide increases expression EXP 6480464 Arsenic Trioxide results in increased expression of CDC42 mRNA CTD PMID:20458559 CDC42 Human Dibutyl phosphate affects expression EXP 6480464 di-n-butylphosphoric acid affects the expression of CDC42 mRNA CTD PMID:37042841 CDC42 Human Dimethylphosphate increases activity ISO RGD:730977 6480464 dimethyl phosphate results in increased activity of CDC42 protein CTD PMID:37270087 CDC42 Human disodium selenite increases expression EXP 6480464 Sodium Selenite results in increased expression of CDC42 mRNA CTD PMID:18175754 CDC42 Human diuron decreases expression EXP 6480464 Diuron results in decreased expression of CDC42 mRNA CTD PMID:35967413 CDC42 Human ethanol decreases expression ISO RGD:71043 6480464 Ethanol results in decreased expression of CDC42 protein CTD PMID:20133374|PMID:20829428 CDC42 Human ethanol affects splicing ISO RGD:730977 6480464 Ethanol affects the splicing of CDC42 mRNA CTD PMID:30319688 CDC42 Human ethanol multiple interactions ISO RGD:71043 6480464 Ethanol results in decreased expression of [CDC42 protein binds to Guanosine Triphosphate] CTD PMID:20829428 CDC42 Human flusilazole affects expression ISO RGD:730977 6480464 flusilazole affects the expression of CDC42 mRNA CTD PMID:21195148 CDC42 Human folic acid multiple interactions ISO RGD:730977 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of CDC42 mRNA CTD PMID:22206623 CDC42 Human folic acid decreases expression ISO RGD:730977 6480464 Folic Acid results in decreased expression of CDC42 mRNA CTD PMID:25629700 CDC42 Human formaldehyde increases expression EXP 6480464 Formaldehyde results in increased expression of CDC42 mRNA CTD PMID:23649840 CDC42 Human fumonisin B1 increases expression ISO RGD:730977 6480464 fumonisin B1 results in increased expression of CDC42 mRNA CTD PMID:16221962 CDC42 Human gallic acid decreases expression EXP 6480464 Gallic Acid results in decreased expression of CDC42 protein CTD PMID:23153558 CDC42 Human gamma-hexachlorocyclohexane decreases expression ISO RGD:71043 6480464 Hexachlorocyclohexane results in decreased expression of CDC42 mRNA CTD PMID:17785943 CDC42 Human gentamycin increases expression ISO RGD:71043 6480464 Gentamicins results in increased expression of CDC42 mRNA CTD PMID:22061828 CDC42 Human glucose multiple interactions ISO RGD:730977 6480464 Eucalyptol inhibits the reaction [Glucose results in increased expression of CDC42 protein]; Resveratrol inhibits the more ... CTD PMID:24659233|PMID:31483951 CDC42 Human glucose increases expression ISO RGD:730977 6480464 Glucose results in increased expression of CDC42 mRNA; Glucose results in increased expression of CDC42 more ... CTD PMID:24659233|PMID:31483951 CDC42 Human glyphosate decreases expression ISO RGD:730977 6480464 Glyphosate results in decreased expression of CDC42 protein CTD PMID:37208198 CDC42 Human glyphosate decreases expression ISO RGD:71043 6480464 Glyphosate results in decreased expression of CDC42 mRNA CTD PMID:26302742 CDC42 Human GTP multiple interactions EXP 6480464 Resveratrol promotes the reaction [CDC42 protein binds to Guanosine Triphosphate]; Risedronic Acid results in increased more ... CTD PMID:15217905|PMID:16734383|PMID:28871336 CDC42 Human GTP multiple interactions ISO RGD:71043 6480464 Ethanol results in decreased expression of [CDC42 protein binds to Guanosine Triphosphate] CTD PMID:20829428 CDC42 Human GTP multiple interactions ISO RGD:730977 6480464 Risedronic Acid results in increased abundance of [Guanosine Triphosphate binds to CDC42 protein]; Zoledronic Acid more ... CTD PMID:16734383 CDC42 Human haloperidol increases expression ISO RGD:71043 6480464 Haloperidol results in increased expression of CDC42 mRNA CTD PMID:15860345 CDC42 Human hexaconazole affects expression ISO RGD:730977 6480464 hexaconazole affects the expression of CDC42 mRNA CTD PMID:21195148 CDC42 Human hydralazine multiple interactions EXP 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of CDC42 mRNA CTD PMID:17183730 CDC42 Human hypochlorous acid increases expression ISO RGD:730977 6480464 Hypochlorous Acid results in increased expression of CDC42 mRNA CTD PMID:19376150 CDC42 Human indometacin increases expression ISO RGD:71043 6480464 Indomethacin results in increased expression of CDC42 mRNA CTD PMID:18299717 CDC42 Human ivermectin decreases expression EXP 6480464 Ivermectin results in decreased expression of CDC42 protein CTD PMID:32959892 CDC42 Human kainic acid increases expression ISO RGD:71043 6480464 Kainic Acid results in increased expression of CDC42 mRNA CTD PMID:19700661 CDC42 Human lead(0) decreases expression EXP 6480464 Lead results in decreased expression of CDC42 mRNA CTD PMID:19921347 CDC42 Human lead(0) affects expression EXP 6480464 Lead affects the expression of CDC42 mRNA CTD PMID:28903495 CDC42 Human lovastatin increases expression EXP 6480464 Lovastatin results in increased expression of CDC42 protein CTD PMID:18766339 CDC42 Human lovastatin decreases expression ISO RGD:730977 6480464 Lovastatin results in decreased expression of CDC42 mRNA CTD PMID:20493250 CDC42 Human mercury dichloride decreases expression ISO RGD:71043 6480464 Mercuric Chloride results in decreased expression of CDC42 protein CTD PMID:22223485 CDC42 Human Mesaconitine increases expression ISO RGD:71043 6480464 mesaconitine results in increased expression of CDC42 protein CTD PMID:37182599 CDC42 Human metformin decreases expression EXP 6480464 Metformin results in decreased expression of CDC42 mRNA CTD PMID:32589349 CDC42 Human methimazole increases expression ISO RGD:71043 6480464 Methimazole results in increased expression of CDC42 mRNA CTD PMID:30047161 CDC42 Human methyl methanesulfonate increases expression EXP 6480464 Methyl Methanesulfonate results in increased expression of CDC42 mRNA CTD PMID:23649840 CDC42 Human methylmercury chloride decreases expression ISO RGD:71043 6480464 methylmercuric chloride results in decreased expression of CDC42 protein CTD PMID:22223485 CDC42 Human methylseleninic acid decreases expression EXP 6480464 methylselenic acid results in decreased expression of CDC42 mRNA CTD PMID:11830524 CDC42 Human microcystin-LR increases expression ISO RGD:730977 6480464 cyanoginosin LR results in increased expression of CDC42 mRNA CTD PMID:17654400 CDC42 Human mono(2-ethylhexyl) phthalate increases expression EXP 6480464 mono-(2-ethylhexyl)phthalate results in increased expression of CDC42 mRNA CTD PMID:38685446 CDC42 Human N-methyl-4-phenylpyridinium decreases expression EXP 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of CDC42 mRNA CTD PMID:24810058 CDC42 Human N-nitrosodimethylamine multiple interactions ISO RGD:71043 6480464 [GJB1 protein affects the susceptibility to [Dietary Fats co-treated with Dimethylnitrosamine]] which affects the expression more ... CTD PMID:32833043 CDC42 Human niclosamide decreases expression EXP 6480464 Niclosamide results in decreased expression of CDC42 mRNA CTD PMID:29251334 CDC42 Human niclosamide decreases phosphorylation EXP 6480464 Niclosamide results in decreased phosphorylation of CDC42 protein CTD PMID:29251334 CDC42 Human nicotine multiple interactions ISO RGD:730977 6480464 [Nicotine co-treated with 1-Methyl-4-phenyl-1,2,3,6-tetrahydropyridine] results in decreased expression of CDC42 mRNA; Nicotine inhibits the reaction more ... CTD PMID:20230807 CDC42 Human nitrates multiple interactions ISO RGD:730977 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of CDC42 more ... CTD PMID:35964746 CDC42 Human NSC 23766 multiple interactions EXP 6480464 NSC 23766 inhibits the reaction [Zinc Oxide results in increased activity of and results in more ... CTD PMID:22166487 CDC42 Human Nutlin-3 multiple interactions EXP 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of CDC42 protein CTD PMID:38460933 CDC42 Human palmatine affects binding EXP 6480464 palmatine binds to CDC42 protein CTD PMID:35997646 CDC42 Human paracetamol affects expression ISO RGD:730977 6480464 Acetaminophen affects the expression of CDC42 mRNA CTD PMID:17562736 CDC42 Human paracetamol decreases expression ISO RGD:71043 6480464 Acetaminophen results in decreased expression of CDC42 mRNA CTD PMID:33387578 CDC42 Human paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of CDC42 mRNA CTD PMID:26690555 CDC42 Human pentachlorophenol increases expression ISO RGD:730977 6480464 Pentachlorophenol results in increased expression of CDC42 mRNA CTD PMID:23892564 CDC42 Human phenobarbital increases expression ISO RGD:730977 6480464 Phenobarbital results in increased expression of CDC42 mRNA CTD PMID:19363144 CDC42 Human phenobarbital increases expression ISO RGD:71043 6480464 Phenobarbital results in increased expression of CDC42 mRNA CTD PMID:30047161 CDC42 Human pioglitazone decreases expression EXP 6480464 Pioglitazone results in decreased expression of CDC42 mRNA CTD PMID:32589349 CDC42 Human piroxicam multiple interactions EXP 6480464 [Piroxicam co-treated with Cisplatin] results in increased expression of CDC42 mRNA CTD PMID:21858171 CDC42 Human poly(I:C) multiple interactions EXP 6480464 [Poly I-C co-treated with Atorvastatin] results in decreased expression of CDC42 mRNA CTD PMID:34696514 CDC42 Human propiconazole increases expression ISO RGD:71043 6480464 propiconazole results in increased expression of CDC42 mRNA CTD PMID:30047161 CDC42 Human Propiverine affects binding ISO RGD:71043 6480464 propiverine binds to CDC42 protein CTD PMID:29273565 CDC42 Human quercetin multiple interactions EXP 6480464 [Cisplatin co-treated with Quercetin] results in increased expression of CDC42 mRNA CTD PMID:27514524 CDC42 Human resveratrol multiple interactions ISO RGD:730977 6480464 [resveratrol co-treated with beta-1,3-glucan] results in increased expression of CDC42 mRNA; resveratrol inhibits the reaction more ... CTD PMID:17690738|PMID:24659233 CDC42 Human resveratrol multiple interactions EXP 6480464 Resveratrol promotes the reaction [CDC42 protein binds to Guanosine Triphosphate]; Resveratrol results in increased activity more ... CTD PMID:15217905 CDC42 Human Risedronate sodium multiple interactions EXP 6480464 Risedronic Acid results in increased abundance of [Guanosine Triphosphate binds to CDC42 protein] CTD PMID:16734383 CDC42 Human Risedronate sodium multiple interactions ISO RGD:730977 6480464 Risedronic Acid results in increased abundance of [Guanosine Triphosphate binds to CDC42 protein] CTD PMID:16734383 CDC42 Human rotenone decreases expression ISO RGD:71043 6480464 Rotenone results in decreased expression of CDC42 protein CTD PMID:22223485 CDC42 Human rotenone increases expression EXP 6480464 Rotenone results in increased expression of CDC42 mRNA CTD PMID:33512557 CDC42 Human rotenone decreases activity ISO RGD:71043 6480464 Rotenone results in decreased activity of CDC42 protein CTD PMID:18480073 CDC42 Human SB 431542 increases expression EXP 6480464 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide results in increased expression of CDC42 protein CTD PMID:25670856 CDC42 Human SB 431542 multiple interactions EXP 6480464 [LDN 193189 co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in increased expression of CDC42 more ... CTD PMID:37664457 CDC42 Human scoparone decreases expression EXP 6480464 scoparone results in decreased expression of CDC42 mRNA CTD PMID:37449671 CDC42 Human simvastatin decreases activity ISO RGD:730977 6480464 Simvastatin results in decreased activity of CDC42 protein CTD PMID:17169357 CDC42 Human sodium arsenite decreases expression ISO RGD:71043 6480464 sodium arsenite results in decreased expression of CDC42 protein CTD PMID:19072884 CDC42 Human sodium arsenite increases expression ISO RGD:730977 6480464 sodium arsenite results in increased expression of CDC42 mRNA CTD PMID:38579892 CDC42 Human sodium dichromate increases expression ISO RGD:71043 6480464 sodium bichromate results in increased expression of CDC42 mRNA CTD PMID:12325037 CDC42 Human sulfadimethoxine increases expression ISO RGD:71043 6480464 Sulfadimethoxine results in increased expression of CDC42 mRNA CTD PMID:30047161 CDC42 Human tamoxifen affects expression ISO RGD:730977 6480464 Tamoxifen affects the expression of CDC42 mRNA CTD PMID:17555576 CDC42 Human tert-butyl hydroperoxide increases expression EXP 6480464 tert-Butylhydroperoxide results in increased expression of CDC42 mRNA CTD PMID:15336504 CDC42 Human testosterone increases expression ISO RGD:730977 6480464 Testosterone results in increased expression of CDC42 mRNA CTD PMID:19693291 CDC42 Human thioacetamide increases expression ISO RGD:71043 6480464 Thioacetamide results in increased expression of CDC42 mRNA CTD PMID:34492290 CDC42 Human titanium dioxide decreases expression ISO RGD:730977 6480464 titanium dioxide results in decreased expression of CDC42 mRNA CTD PMID:23557971 CDC42 Human titanium dioxide decreases methylation EXP 6480464 titanium dioxide results in decreased methylation of CDC42 gene CTD PMID:34973136 CDC42 Human titanium dioxide increases methylation ISO RGD:730977 6480464 titanium dioxide results in increased methylation of CDC42 gene CTD PMID:35295148 CDC42 Human toosendanin decreases expression EXP 6480464 toosendanin results in decreased expression of CDC42 protein CTD PMID:23111283 CDC42 Human tremolite asbestos decreases expression EXP 6480464 tremolite results in decreased expression of CDC42 protein CTD PMID:22578742 CDC42 Human triadimefon affects expression ISO RGD:730977 6480464 triadimefon affects the expression of CDC42 mRNA CTD PMID:21195148 CDC42 Human trichloroethene decreases expression ISO RGD:71043 6480464 Trichloroethylene results in decreased expression of CDC42 mRNA CTD PMID:33387578 CDC42 Human Triptolide decreases expression ISO RGD:71043 6480464 triptolide results in decreased expression of CDC42 mRNA; triptolide results in decreased expression of CDC42 more ... CTD PMID:27554044 CDC42 Human valproic acid multiple interactions EXP 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of CDC42 mRNA CTD PMID:17183730 CDC42 Human valproic acid decreases expression EXP 6480464 Valproic Acid results in decreased expression of CDC42 mRNA CTD PMID:23179753 CDC42 Human warfarin decreases expression ISO RGD:730977 6480464 Warfarin results in decreased expression of CDC42 mRNA CTD PMID:20493250 CDC42 Human zinc oxide multiple interactions EXP 6480464 [RAC1 protein binds to CDC42 protein] affects the reaction [Zinc Oxide results in increased expression more ... CTD PMID:22166487 CDC42 Human zoledronic acid multiple interactions ISO RGD:730977 6480464 zoledronic acid results in increased abundance of [Guanosine Triphosphate binds to CDC42 protein] CTD PMID:16734383 CDC42 Human zoledronic acid multiple interactions EXP 6480464 zoledronic acid results in increased expression of [CDC42 protein binds to Guanosine Triphosphate]; zoledronic acid more ... CTD PMID:28871336
Molecular Function
Only show annotations with direct experimental evidence (0 objects hidden)
CDC42 Human apolipoprotein A-I receptor binding enables IPI UniProtKB:O95477 150520179 PMID:16443932 BHF-UCL PMID:16443932 CDC42 Human G protein activity enables IEA EC:3.6.5.2 150520179 UniProt GO_REF:0000003 CDC42 Human GBD domain binding enables IPI UniProtKB:P42768 150520179 PMID:10724160, PMID:8625410 CAFA PMID:10724160|PMID:8625410 CDC42 Human GTP binding ISO RGD:71043 9068941 RGD PMID:17161586|REF_RGD_ID:2298583 CDC42 Human GTP binding enables IBA CGD:CAL0000192612|CGD:CAL0000192659|CGD:CAL0000196388|FB:FBgn0039140|MGI:108446|MGI:97845|PANTHER:PTN000632671|RGD:619755|RGD:619921|RGD:71043|SGD:S000001380|TAIR:locus:2131606|TAIR:locus:2204380|UniProtKB:P15153|UniProtKB:P31021|UniProtKB:P60953|UniProtKB:P61586|UniProtKB:P63000|UniProtKB:Q15669|UniProtKB:Q24816|UniProtKB:Q9H4E5|UniProtKB:Q9SSX0|WB:WBGene00000390|WB:WBGene00000424|WB:WBGene00004287|WB:WBGene00004357 150520179 GO_Central GO_REF:0000033 CDC42 Human GTP binding enables IEA UniRule:UR001427752 150520179 UniProt GO_REF:0000104 CDC42 Human GTP binding enables IEA InterPro:IPR001806|InterPro:IPR003578|InterPro:IPR005225 150520179 InterPro GO_REF:0000002 CDC42 Human GTP binding enables IDA 150520179 PMID:15601624, PMID:23620790, PMID:8625410 CAFA PMID:15601624|PMID:23620790|PMID:8625410 CDC42 Human GTP binding enables IEA UniProtKB-KW:KW-0342 150520179 UniProt GO_REF:0000043 CDC42 Human GTP-dependent protein binding enables IEA UniProtKB:P60766|ensembl:ENSMUSP00000054634 150520179 Ensembl GO_REF:0000107 CDC42 Human GTPase activity enables IEA RHEA:19669 150520179 RHEA GO_REF:0000116 CDC42 Human GTPase activity enables IBA CGD:CAL0000184710|CGD:CAL0000197260|FB:FBgn0010333|FB:FBgn0010341|FB:FBgn0014011|FB:FBgn0014020|MGI:106211|MGI:1096342|MGI:1916831|MGI:97845|MGI:97846|PANTHER:PTN000632671|PomBase:SPAC110.03|PomBase:SPAC16.01|PomBase:SPAC16A10.04|PomBase:SPAC1F7.04|PomBase:SPAC23C4.08|RGD:619755|RGD:619921|SGD:S000000046|SGD:S000001380|SGD:S000001763|SGD:S000004219|SGD:S000005034|SGD:S000005124|SGD:S000006369|TAIR:locus:2099232|TAIR:locus:2131606|UniProtKB:P17081|UniProtKB:P60763|UniProtKB:P60953|UniProtKB:P61586|UniProtKB:P63000|UniProtKB:P84095|UniProtKB:Q58E25|UniProtKB:Q9H4E5|WB:WBGene00000390|WB:WBGene00000424|WB:WBGene00003239|WB:WBGene00004287|WB:WBGene00004357 150520179 GO_Central GO_REF:0000033 CDC42 Human GTPase activity enables IEA UniProtKB:P60766|ensembl:ENSMUSP00000054634 150520179 Ensembl GO_REF:0000107 CDC42 Human GTPase activity enables IDA 150520179 PMID:19787194, PMID:27917469 MGI PMID:19787194|PMID:27917469 CDC42 Human GTPase activity enables IEA UniRule:UR001427752 150520179 UniProt GO_REF:0000104 CDC42 Human GTPase activity enables TAS 150520179 PMID:11035016 UniProt PMID:11035016 CDC42 Human GTPase activity enables IEA InterPro:IPR001806|InterPro:IPR037874 150520179 InterPro GO_REF:0000002 CDC42 Human hydrolase activity enables IEA UniProtKB-KW:KW-0378 150520179 UniProt GO_REF:0000043 CDC42 Human identical protein binding enables IPI UniProtKB:P60953 150520179 PMID:9748241 IntAct PMID:9748241 CDC42 Human mitogen-activated protein kinase kinase kinase binding ISO RGD:1359261 9068941 RGD PMID:17161586|REF_RGD_ID:2298583 CDC42 Human nucleotide binding enables IEA UniProtKB-KW:KW-0547 150520179 UniProt GO_REF:0000043 CDC42 Human protein binding enables IPI UniProtKB:O14613|UniProtKB:Q00587 150520179 PMID:21988832 IntAct PMID:21988832 CDC42 Human protein binding enables IPI UniProtKB:Q5VV41 150520179 PMID:21139582 BHF-UCL PMID:21139582 CDC42 Human protein binding enables IPI UniProtKB:O96013|UniProtKB:Q13177|UniProtKB:Q9NQU5|UniProtKB:Q9P286 150520179 PMID:32707033 IntAct PMID:32707033 CDC42 Human protein binding enables IPI UniProtKB:Q5S007 150520179 PMID:21048939, PMID:21454543 IntAct PMID:21048939|PMID:21454543 CDC42 Human protein binding enables IPI UniProtKB:P56945|UniProtKB:Q6P5Z4 150520179 PMID:10587647 UniProt PMID:10587647 CDC42 Human protein binding enables IPI UniProtKB:Q15811 150520179 PMID:12006984 IntAct PMID:12006984 CDC42 Human protein binding enables IPI UniProtKB:Q9VEX9 150520179 PMID:9082982 IntAct PMID:9082982 CDC42 Human protein binding enables IPI UniProtKB:Q14155 150520179 PMID:16983070, PMID:25150978 IntAct PMID:16983070|PMID:25150978 CDC42 Human protein binding enables IPI UniProtKB:P52565 150520179 PMID:21900206 IntAct PMID:21900206 CDC42 Human protein binding enables IPI UniProtKB:Q16584 150520179 PMID:20890305, PMID:25241761 IntAct PMID:20890305|PMID:25241761 CDC42 Human protein binding enables IPI UniProtKB:P42768 150520179 PMID:15361624, PMID:22252508, PMID:25502805, PMID:31515488, PMID:9660763 IntAct PMID:15361624|PMID:22252508|PMID:25502805|PMID:31515488|PMID:9660763 CDC42 Human protein binding enables IPI UniProtKB:Q9NRR3 150520179 PMID:10816584 UniProt PMID:10816584 CDC42 Human protein binding enables IPI UniProtKB:Q61036 150520179 PMID:23022564, PMID:7493928 IntAct PMID:23022564|PMID:7493928 CDC42 Human protein binding enables IPI UniProtKB:Q9P258 150520179 PMID:25074804 UniProt PMID:25074804 CDC42 Human protein binding enables IPI UniProtKB:Q13153|UniProtKB:Q9JK83 150520179 PMID:12606577 IntAct PMID:12606577 CDC42 Human protein binding enables IPI UniProtKB:P46940 150520179 PMID:12745076, PMID:18809683, PMID:21876773, PMID:26242911, PMID:26496610 IntAct PMID:12745076|PMID:18809683|PMID:21876773|PMID:26242911|PMID:26496610 CDC42 Human protein binding enables IPI UniProtKB:A0A0H3NA16 150520179 PMID:21566117 IntAct PMID:21566117 CDC42 Human protein binding enables IPI UniProtKB:O96013 150520179 PMID:22653441 IntAct PMID:22653441 CDC42 Human protein binding enables IPI UniProtKB:Q5VT25 150520179 PMID:15194684, PMID:9418861 IntAct PMID:15194684|PMID:9418861 CDC42 Human protein binding enables IPI UniProtKB:O30916|UniProtKB:P74873|UniProtKB:Q7CQD4 150520179 PMID:21435037 AgBase PMID:21435037 CDC42 Human protein binding enables IPI UniProtKB:P25054 150520179 PMID:17145773 IntAct PMID:17145773 CDC42 Human protein binding enables IPI UniProtKB:Q9GSG9 150520179 PMID:15728724, PMID:16968699 dictyBase PMID:15728724|PMID:16968699 CDC42 Human protein binding enables IPI UniProtKB:P21333 150520179 PMID:10051605 BHF-UCL PMID:10051605 CDC42 Human protein binding enables IPI UniProtKB:O08816|UniProtKB:P42768 150520179 PMID:9422512 IntAct PMID:9422512 CDC42 Human protein binding enables IPI UniProtKB:Q07912 150520179 PMID:10360579 IntAct PMID:10360579 CDC42 Human protein binding enables IPI UniProtKB:Q9UQB8-4 150520179 PMID:19171758, PMID:24076653, PMID:24584464 IntAct PMID:19171758|PMID:24076653|PMID:24584464 CDC42 Human protein binding enables IPI UniProtKB:Q8TCU6 150520179 PMID:27150042 IntAct PMID:27150042 CDC42 Human protein binding enables IPI UniProtKB:Q00587 150520179 PMID:16189514 IntAct PMID:16189514 CDC42 Human protein binding enables IPI UniProtKB:O96013|UniProtKB:Q92963 150520179 PMID:29734338 IntAct PMID:29734338 CDC42 Human protein binding enables IPI UniProtKB:O75914|UniProtKB:Q07912|UniProtKB:Q9UQB8 150520179 PMID:11157984 IntAct PMID:11157984 CDC42 Human protein binding enables IPI UniProtKB:Q5T0N5 150520179 PMID:19798448 UniProt PMID:19798448 CDC42 Human protein binding enables IPI UniProtKB:O30916 150520179 PMID:21435037 IntAct PMID:21435037 CDC42 Human protein binding enables IPI UniProtKB:P52566 150520179 PMID:7512369 UniProt PMID:7512369 CDC42 Human protein binding enables IPI UniProtKB:O14613|UniProtKB:Q6NZY7 150520179 PMID:11035016 UniProt PMID:11035016 CDC42 Human protein binding enables IPI UniProtKB:P46940|UniProtKB:P52565|UniProtKB:Q00587|UniProtKB:Q9NQU5 150520179 PMID:31980649 IntAct PMID:31980649 CDC42 Human protein binding enables IPI UniProtKB:Q07960 150520179 PMID:9262406, PMID:9846874 IntAct PMID:9262406|PMID:9846874 CDC42 Human protein binding enables IPI UniProtKB:O14613|UniProtKB:Q00587-2|UniProtKB:Q13177|UniProtKB:Q8WUI4-6|UniProtKB:Q9BYG5|UniProtKB:Q9P286 150520179 PMID:32296183 IntAct PMID:32296183 CDC42 Human protein binding enables IPI UniProtKB:O14713 150520179 PMID:11807099 UniProt PMID:11807099 CDC42 Human protein binding enables IPI UniProtKB:O00401 150520179 PMID:16293614 IntAct PMID:16293614 CDC42 Human protein binding enables IPI UniProtKB:O14613|UniProtKB:Q00587|UniProtKB:Q13177|UniProtKB:Q9BYG5 150520179 PMID:25416956 IntAct PMID:25416956 CDC42 Human protein binding enables IPI UniProtKB:P41743|UniProtKB:Q9BYG4|UniProtKB:Q9BYG5|UniProtKB:Q9NPB6 150520179 PMID:11260256 IntAct PMID:11260256 CDC42 Human protein binding enables IPI UniProtKB:Q64096 150520179 PMID:11889037, PMID:17704816 IntAct PMID:11889037|PMID:17704816 CDC42 Human protein binding enables IPI UniProtKB:O95477 150520179 PMID:16443932 IntAct PMID:16443932 CDC42 Human protein binding enables IPI UniProtKB:Q8NF50 150520179 PMID:28028151 UniProt PMID:28028151 CDC42 Human protein binding ISO RGD:1354371 9068941 RGD PMID:20472934|REF_RGD_ID:7242691 CDC42 Human protein binding enables IPI UniProtKB:Q13153 150520179 PMID:12879077, PMID:19596003, PMID:21029865, PMID:21167153, PMID:23175184, PMID:23455922 IntAct PMID:12879077|PMID:19596003|PMID:21029865|PMID:21167153|PMID:23175184|PMID:23455922 CDC42 Human protein binding enables IPI UniProtKB:P25054|UniProtKB:Q9UQB8 150520179 PMID:21311754 IntAct PMID:21311754 CDC42 Human protein binding enables IPI UniProtKB:Q9R8E4 150520179 PMID:19620963 IntAct PMID:19620963 CDC42 Human protein binding enables IPI UniProtKB:P46940|UniProtKB:Q00587|UniProtKB:Q5VT25 150520179 PMID:35271311 IntAct PMID:35271311 CDC42 Human protein binding enables IPI UniProtKB:Q9NRR8 150520179 PMID:28514442, PMID:33961781 IntAct PMID:28514442|PMID:33961781 CDC42 Human protein binding enables IPI UniProtKB:O52623 150520179 PMID:12093730 IntAct PMID:12093730 CDC42 Human protein binding enables IPI UniProtKB:Q9JK83|UniProtKB:Q9NPB6 150520179 PMID:10934474 IntAct PMID:10934474 CDC42 Human protein binding enables IPI UniProtKB:O00401|UniProtKB:O14613|UniProtKB:O96013|UniProtKB:P42768|UniProtKB:P52565|UniProtKB:Q00587|UniProtKB:Q13153|UniProtKB:Q13177|UniProtKB:Q5VT25|UniProtKB:Q9BYG5|UniProtKB:Q9NQU5|UniProtKB:Q9NRR8|UniProtKB:Q9P286|UniProtKB:Q9UQB8 150520179 PMID:20936779 IntAct PMID:20936779 CDC42 Human protein binding enables IPI UniProtKB:P41743|UniProtKB:Q96L34|UniProtKB:Q9BYG4|UniProtKB:Q9BYG5|UniProtKB:Q9NPB6 150520179 PMID:14676191 IntAct PMID:14676191 CDC42 Human protein kinase binding enables IPI UniProtKB:Q9HC98 150520179 PMID:20873783 UniProt PMID:20873783 CDC42 Human protein kinase binding enables IBA FB:FBgn0010341|MGI:106211|PANTHER:PTN008604840|RGD:71043|UniProtKB:P60953 150520179 GO_Central GO_REF:0000033 CDC42 Human protein kinase binding enables IDA 150520179 PMID:19039103 BHF-UCL PMID:19039103 CDC42 Human protein kinase binding enables IEA UniProtKB:P60766|ensembl:ENSMUSP00000054634 150520179 Ensembl GO_REF:0000107 CDC42 Human protein kinase binding enables IPI UniProtKB:Q5S007 150520179 PMID:21048939 BHF-UCL PMID:21048939 CDC42 Human protein kinase binding enables IPI UniProtKB:Q13177 150520179 PMID:8625410 CAFA PMID:8625410 CDC42 Human thioesterase binding enables IPI UniProtKB:P35125 150520179 PMID:12612085 UniProt PMID:12612085 CDC42 Human ubiquitin protein ligase activity enables IDA 150520179 PMID:21435037 AgBase PMID:21435037
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(+)-catechin (EXP) (-)-epigallocatechin 3-gallate (EXP) (S)-nicotine (ISO) 1,2-dimethylhydrazine (ISO) 1,4-dichlorobenzene (ISO) 1,8-cineole (ISO) 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (ISO) 17alpha-ethynylestradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4-dinitrotoluene (ISO) 2-amino-14,16-dimethyloctadecan-3-ol (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (ISO) acetylsalicylic acid (EXP) acrylamide (ISO) acteoside (EXP) actinomycin D (EXP) aflatoxin B1 (EXP,ISO) aldehydo-D-glucose (ISO) all-trans-retinoic acid (EXP) amitrole (ISO) ammonium chloride (ISO) antirheumatic drug (EXP) Aroclor 1254 (ISO) arsane (EXP) arsenic atom (EXP) arsenite(3-) (EXP) arsenous acid (EXP) atorvastatin calcium (EXP) atrazine (EXP) bazedoxifene (EXP) benzene (EXP) benzo[a]pyrene (EXP,ISO) benzo[a]pyrene diol epoxide I (EXP) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (EXP) Bisphenol B (EXP) bisphenol F (EXP,ISO) bortezomib (EXP) cadmium acetate (ISO) cadmium atom (ISO) cadmium dichloride (EXP,ISO) calcium atom (ISO) calcium(0) (ISO) cannabidiol (EXP) carbon nanotube (EXP) carboplatin (ISO) casticin (ISO) cefaloridine (ISO) CGP 52608 (EXP) chlorpyrifos (ISO) chrysene (ISO) cisplatin (EXP,ISO) copper atom (ISO) copper(0) (ISO) crocidolite asbestos (ISO) CU-O LINKAGE (EXP) D-glucose (ISO) dexamethasone (ISO) diarsenic trioxide (EXP) Dibutyl phosphate (EXP) Dimethylphosphate (ISO) disodium selenite (EXP) diuron (EXP) ethanol (ISO) flusilazole (ISO) folic acid (ISO) formaldehyde (EXP) fumonisin B1 (ISO) gallic acid (EXP) gamma-hexachlorocyclohexane (ISO) gentamycin (ISO) glucose (ISO) glyphosate (ISO) GTP (EXP,ISO) haloperidol (ISO) hexaconazole (ISO) hydralazine (EXP) hypochlorous acid (ISO) indometacin (ISO) ivermectin (EXP) kainic acid (ISO) lead(0) (EXP) lovastatin (EXP,ISO) mercury dichloride (ISO) Mesaconitine (ISO) metformin (EXP) methimazole (ISO) methyl methanesulfonate (EXP) methylmercury chloride (ISO) methylseleninic acid (EXP) microcystin-LR (ISO) mono(2-ethylhexyl) phthalate (EXP) N-methyl-4-phenylpyridinium (EXP) N-nitrosodimethylamine (ISO) niclosamide (EXP) nicotine (ISO) nitrates (ISO) NSC 23766 (EXP) Nutlin-3 (EXP) palmatine (EXP) paracetamol (EXP,ISO) pentachlorophenol (ISO) phenobarbital (ISO) pioglitazone (EXP) piroxicam (EXP) poly(I:C) (EXP) propiconazole (ISO) Propiverine (ISO) quercetin (EXP) resveratrol (EXP,ISO) Risedronate sodium (EXP,ISO) rotenone (EXP,ISO) SB 431542 (EXP) scoparone (EXP) simvastatin (ISO) sodium arsenite (ISO) sodium dichromate (ISO) sulfadimethoxine (ISO) tamoxifen (ISO) tert-butyl hydroperoxide (EXP) testosterone (ISO) thioacetamide (ISO) titanium dioxide (EXP,ISO) toosendanin (EXP) tremolite asbestos (EXP) triadimefon (ISO) trichloroethene (ISO) Triptolide (ISO) valproic acid (EXP) warfarin (ISO) zinc oxide (EXP) zoledronic acid (EXP,ISO)
Biological Process
actin cytoskeleton organization (IDA) actin filament branching (ISO) actin filament organization (IBA,IMP,ISO) adherens junction organization (IEA) anatomical structure morphogenesis (IEA) cardiac conduction system development (IEA) cardiac neural crest cell migration involved in outflow tract morphogenesis (IEA) cell differentiation (IEA) cell junction assembly (IMP) cellular response to type II interferon (IEA) dendritic cell migration (IEA) dendritic spine morphogenesis (IEA,ISS) embryonic heart tube development (IEA) endocytosis (IBA,IEA) endothelin receptor signaling pathway involved in heart process (IEA) establishment of cell polarity (IBA) establishment of epithelial cell apical/basal polarity (IMP) establishment of Golgi localization (ISS) establishment of localization in cell (IEA) establishment or maintenance of apical/basal cell polarity (IEA) establishment or maintenance of cell polarity (TAS) filopodium assembly (IEA) Golgi organization (ISS) heart contraction (IEA) heart process (IEA) integrin-mediated signaling pathway (IMP) macrophage differentiation (TAS) negative regulation of protein-containing complex assembly (IPI) nervous system development (IEA) neuron fate determination (IEA) neuropilin signaling pathway (IMP) nuclear migration (IEA) nucleus localization (IEA) organelle transport along microtubule (ISS) phagocytosis, engulfment (IMP) positive regulation of catalytic activity (ISO) positive regulation of cell growth (IMP) positive regulation of cell migration (IMP) positive regulation of cellular component organization (IEA) positive regulation of cytokinesis (IMP) positive regulation of DNA replication (ISO) positive regulation of epithelial cell proliferation involved in lung morphogenesis (IEA) positive regulation of filopodium assembly (IEA,IMP,ISS) positive regulation of intracellular protein transport (ISO) positive regulation of JNK cascade (ISO) positive regulation of lamellipodium assembly (IMP) positive regulation of MAPK cascade (IEA) positive regulation of neuron apoptotic process (ISO) positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction (IEA) positive regulation of pinocytosis (IEA,ISS) positive regulation of pseudopodium assembly (IDA) positive regulation of stress fiber assembly (IMP) positive regulation of substrate adhesion-dependent cell spreading (IDA) positive regulation of synapse structural plasticity (ISO) protein localization (IEA) protein phosphorylation (ISO) regulation of actin cytoskeleton organization (IMP) regulation of attachment of spindle microtubules to kinetochore (IMP) regulation of filopodium assembly (IBA,IDA) regulation of lamellipodium assembly (IGI) regulation of mitotic nuclear division (IEA) regulation of modification of postsynaptic structure (ISO) regulation of postsynapse organization (IEA) regulation of stress fiber assembly (IGI) signal transduction (IBA) small GTPase-mediated signal transduction (IEA) sprouting angiogenesis (ISO) submandibular salivary gland formation (ISO) substantia nigra development (HEP) Wnt signaling pathway, planar cell polarity pathway (NAS)
Cellular Component
apical part of cell (IEA) cell leading edge (IEA) cell periphery (IEA) cell projection (IEA) cell-cell junction (IEA) centrosome (IDA,IEA) cytoplasm (IDA,IEA) cytoplasmic ribonucleoprotein granule (IDA) cytoskeleton (IEA) cytosol (IEA,TAS) dendrite (IEA) endoplasmic reticulum membrane (TAS) extracellular exosome (HDA) filopodium (IDA) focal adhesion (HDA) glutamatergic synapse (IEA) Golgi membrane (ISO,ISS) Golgi transport complex (IMP) leading edge membrane (IEA) membrane (HDA,IDA,IEA,IMP) midbody (IDA,IEA) mitotic spindle (IDA) neuron projection (IDA) neuronal cell body (IDA) phagocytic vesicle (IEA) plasma membrane (IBA,IDA,IEA,TAS) postsynapse (IEA) protein-containing complex (IDA) Schaffer collateral - CA1 synapse (ISO) secretory granule (ISO) spindle (IEA) spindle midzone (IDA) storage vacuole (IEA)
Molecular Function
apolipoprotein A-I receptor binding (IPI) G protein activity (IEA) GBD domain binding (IPI) GTP binding (IBA,IDA,IEA,ISO) GTP-dependent protein binding (IEA) GTPase activity (IBA,IDA,IEA,TAS) hydrolase activity (IEA) identical protein binding (IPI) mitogen-activated protein kinase kinase kinase binding (ISO) nucleotide binding (IEA) protein binding (IPI,ISO) protein kinase binding (IBA,IDA,IEA,IPI) thioesterase binding (IPI) ubiquitin protein ligase activity (IDA)
1.
Genes regulating molecular and cellular functions in noninfectious nonallergic rhinitis.
Cardell LO, etal., Allergy. 2009 Sep;64(9):1301-8. Epub 2009 Apr 27.
2.
Mechanisms and functions of p38 MAPK signalling.
Cuadrado A and Nebreda AR, Biochem J. 2010 Aug 1;429(3):403-17. doi: 10.1042/BJ20100323.
3.
RhoA, RhoB, RhoC, Rac1, Cdc42, and Tc10 mRNA levels in spinal cord, sensory ganglia, and corticospinal tract neurons and long-lasting specific changes following spinal cord injury.
Erschbamer MK, etal., J Comp Neurol. 2005 Apr 4;484(2):224-33.
4.
MEK kinases are regulated by EGF and selectively interact with Rac/Cdc42.
Fanger GR, etal., EMBO J. 1997 Aug 15;16(16):4961-72.
5.
Geranylgeranyltransferase type I (GGTase-I) deficiency hyperactivates macrophages and induces erosive arthritis in mice.
Khan OM, etal., J Clin Invest. 2011 Feb;121(2):628-39. doi: 10.1172/JCI43758. Epub 2011 Jan 25.
6.
An immune escape screen reveals Cdc42 as regulator of cancer susceptibility to lymphocyte-mediated tumor suppression.
Marques CA, etal., Blood. 2008 Feb 1;111(3):1413-9. Epub 2007 Oct 30.
7.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
8.
A discriminating messenger RNA signature for bipolar disorder formed by an aberrant expression of inflammatory genes in monocytes.
Padmos RC, etal., Arch Gen Psychiatry. 2008 Apr;65(4):395-407.
9.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
10.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
11.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
12.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
13.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
14.
Kainic acid-induced F-344 rat model of mesial temporal lobe epilepsy: gene expression and canonical pathways.
Sharma AK, etal., Toxicol Pathol. 2009 Oct;37(6):776-89. Epub 2009 Aug 21.
15.
Signaling from the small GTP-binding proteins Rac1 and Cdc42 to the c-Jun N-terminal kinase/stress-activated protein kinase pathway. A role for mixed lineage kinase 3/protein-tyrosine kinase 1, a novel member of the mixed lineage kinase family.
Teramoto H, etal., J Biol Chem. 1996 Nov 1;271(44):27225-8.
16.
Mechanisms of biphasic insulin-granule exocytosis - roles of the cytoskeleton, small GTPases and SNARE proteins.
Wang Z and Thurmond DC, J Cell Sci. 2009 Apr 1;122(Pt 7):893-903.
17.
High Expression of Cell Division Cycle 42 Promotes Pancreatic Cancer Growth and Predicts Poor Outcome of Pancreatic Cancer Patients.
Yang D, etal., Dig Dis Sci. 2017 Apr;62(4):958-967. doi: 10.1007/s10620-017-4451-z. Epub 2017 Feb 8.
18.
Down-regulation Cdc42 attenuates neuronal apoptosis through inhibiting MLK3/JNK3 cascade during ischemic reperfusion in rat hippocampus.
Zhao J, etal., Cell Signal. 2007 Apr;19(4):831-43. Epub 2006 Dec 8.
19.
Activation of oncogenic pathways in degenerating neurons in Alzheimer disease.
Zhu X, etal., Int J Dev Neurosci. 2000 Jul-Aug;18(4-5):433-7.
CDC42 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 22,052,709 - 22,101,360 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 22,052,627 - 22,101,360 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 22,379,202 - 22,427,853 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 22,251,707 - 22,292,023 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 22,124,487 - 22,164,741 NCBI Celera 1 20,702,109 - 20,742,389 (+) NCBI Celera Cytogenetic Map 1 p36.12 NCBI HuRef 1 20,622,960 - 20,663,212 (+) NCBI HuRef CHM1_1 1 22,491,651 - 22,531,931 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 21,876,517 - 21,925,101 (+) NCBI T2T-CHM13v2.0
Cdc42 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 137,047,011 - 137,085,007 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 137,047,007 - 137,085,031 (-) Ensembl GRCm39 Ensembl GRCm38 4 137,319,696 - 137,357,759 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 137,319,696 - 137,357,720 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 136,875,611 - 136,913,652 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 136,591,779 - 136,608,205 (-) NCBI MGSCv36 mm8 Celera 4 135,540,002 - 135,577,854 (-) NCBI Celera Cytogenetic Map 4 D3 NCBI cM Map 4 69.83 NCBI
Cdc42 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 154,838,478 - 154,876,629 (-) NCBI GRCr8 mRatBN7.2 5 149,555,069 - 149,593,239 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 149,553,724 - 149,593,111 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 152,253,400 - 152,289,928 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 154,027,699 - 154,064,227 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 154,009,694 - 154,046,226 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 155,690,267 - 155,728,385 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 155,691,390 - 155,728,300 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 159,446,154 - 159,485,163 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 156,106,123 - 156,143,040 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 156,116,164 - 156,153,079 (-) NCBI Celera 5 147,953,334 - 147,989,998 (-) NCBI Celera Cytogenetic Map 5 q36 NCBI
Cdc42 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955452 2,255,117 - 2,299,042 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955452 2,255,940 - 2,299,042 (+) NCBI ChiLan1.0 ChiLan1.0
CDC42 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 204,846,790 - 204,887,042 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 203,958,664 - 203,998,887 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 21,245,970 - 21,286,210 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 22,188,722 - 22,228,351 (+) NCBI panpan1.1 PanPan1.1 panPan2
LOC403934 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 2 77,153,276 - 77,169,947 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 2 77,153,095 - 77,199,211 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 ROS_Cfam_1.0 4 4,445,564 - 4,446,293 (+) NCBI ROS_Cfam_1.0 UMICH_Zoey_3.1 4 4,457,005 - 4,457,734 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 4 4,574,515 - 4,575,244 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 4 4,796,130 - 4,796,859 (+) NCBI UU_Cfam_GSD_1.0
Cdc42
CDC42 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 80,035,123 - 80,089,233 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 80,035,034 - 80,089,243 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 74,057,184 - 74,116,824 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
CDC42 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 110,568,004 - 110,608,318 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 110,569,352 - 110,582,562 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666033 5,689,907 - 5,730,175 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Cdc42
.
Confirmed Target Of
MIR195 hsa-miR-195-5p Mirtarbase external_info Luciferase reporter assay Functional MTI 22802111 MIR29C hsa-miR-29c-3p Mirtarbase external_info Luciferase reporter assay//Western blot Functional MTI 19079265 MIR29A hsa-miR-29a-3p Mirtarbase external_info Luciferase reporter assay//Western blot Functional MTI 19079265 MIR29C hsa-miR-29c-3p Mirecords external_info NA NA 19079265 MIR608 hsa-miR-608 Mirtarbase external_info Immunohistochemistry//Luciferase reporter assay//W Functional MTI 21149267 MIR330 hsa-miR-330-3p Mirtarbase external_info Immunohistochemistry//Luciferase reporter assay//W Functional MTI 21149267 MIR330 hsa-miR-330-3p Mirtarbase external_info Luciferase reporter assay//qRT-PCR//Western blot Functional MTI 23337504 MIR330 hsa-miR-330-5p OncomiRDB external_info NA NA 23337504 MIR216A hsa-miR-216a-5p Mirtarbase external_info Immunohistochemistry//Luciferase reporter assay//W Functional MTI 21149267 MIR137 hsa-miR-137 Mirtarbase external_info Luciferase reporter assay//Western blot//Reporter Functional MTI 20473940 MIR137 hsa-miR-137 OncomiRDB external_info NA NA 23178712 MIR137 hsa-miR-137 OncomiRDB external_info NA NA 20473940
Predicted Target Of
Count of predictions: 1751 Count of miRNA genes: 738 Interacting mature miRNAs: 819 Transcripts: ENST00000315554, ENST00000344548, ENST00000400259, ENST00000411827, ENST00000421089, ENST00000498236 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
1298451 OSTEAR17_H Osteoarthritis QTL 17 (human) 2.4 0.0004 Joint/bone inflammation osteoarthritis 11 1 25188105 Human 597175194 GWAS1271268_H cervical cancer QTL GWAS1271268 (human) 3e-08 cervical cancer 1 22088917 22088918 Human 597175196 GWAS1271270_H dysplasia of cervix QTL GWAS1271270 (human) 0.000008 dysplasia of cervix 1 22088917 22088918 Human 597212381 GWAS1308455_H uterine fibroid QTL GWAS1308455 (human) 2e-24 uterine fibroid 1 22096228 22096229 Human 597361939 GWAS1458013_H daytime rest measurement QTL GWAS1458013 (human) 0.000003 sleep behavior trait (VT:0001501) 1 22068758 22068759 Human 597149087 GWAS1245161_H female infertility, endometriosis QTL GWAS1245161 (human) 0.0000002 female infertility, endometriosis 1 22096228 22096229 Human 1298463 BP9_H Blood pressure QTL 9 (human) 3.9 Blood pressure hypertension susceptibility 1 1 25188105 Human 597136666 GWAS1232740_H neuroimaging measurement QTL GWAS1232740 (human) 4e-09 neuroimaging measurement 1 22084684 22084685 Human 597149080 GWAS1245154_H endometriosis QTL GWAS1245154 (human) 5e-11 endometriosis 1 22096228 22096229 Human 1576329 MYI9_H Myocardial infarction susceptibility QTL 9 (human) 12 Myocardial infarction susceptibility early-onset 1 7585503 33585503 Human 597050304 GWAS1146378_H uterine fibroid QTL GWAS1146378 (human) 5e-12 uterine fibroid 1 22096228 22096229 Human 597229327 GWAS1325401_H heel bone mineral density QTL GWAS1325401 (human) 2e-22 heel bone mineral density bone mineral density (CMO:0001226) 1 22058485 22058486 Human 1576325 MYI1_H Myocardial infarction susceptibility QTL 1 (human) 11.68 1e-12 Myocardial infarction susceptibility early-onset 1 7585503 33585503 Human 597050102 GWAS1146176_H uterine fibroid QTL GWAS1146176 (human) 0.0000003 uterine fibroid 1 22096228 22096229 Human 597096436 GWAS1192510_H uterine fibroid QTL GWAS1192510 (human) 5e-14 uterine fibroid 1 22096228 22096229 Human 407088672 GWAS737648_H citrate measurement QTL GWAS737648 (human) 0.000005 citrate measurement 1 22088917 22088918 Human 597502904 GWAS1598978_H BMI-adjusted hip circumference QTL GWAS1598978 (human) 2e-11 BMI-adjusted hip circumference hip circumference (CMO:0000014) 1 22064084 22064085 Human 597149563 GWAS1245637_H endometriosis QTL GWAS1245637 (human) 5e-44 endometriosis 1 22096228 22096229 Human 1643380 BW316_H Body weight QTL 316 (human) 2.62 0.0002 Body weight BMI 1 7585503 33585503 Human 596964641 GWAS1084160_H alkaline phosphatase measurement QTL GWAS1084160 (human) 4e-14 alkaline phosphatase measurement 1 22058088 22058089 Human 597293295 GWAS1389369_H alkaline phosphatase measurement QTL GWAS1389369 (human) 4e-14 alkaline phosphatase measurement blood alkaline phosphatase activity level (CMO:0000576) 1 22058088 22058089 Human 597421415 GWAS1517489_H alkaline phosphatase measurement QTL GWAS1517489 (human) 2e-13 alkaline phosphatase measurement blood alkaline phosphatase activity level (CMO:0000576) 1 22076614 22076615 Human 597175204 GWAS1271278_H cervical cancer QTL GWAS1271278 (human) 4e-08 cervical cancer 1 22088917 22088918 Human 597056235 GWAS1152309_H intelligence QTL GWAS1152309 (human) 2e-09 intelligence 1 22099149 22099150 Human 597202534 GWAS1298608_H lean body mass QTL GWAS1298608 (human) 3e-12 body lean mass (VT:0010483) total body lean mass (CMO:0003950) 1 22070706 22070707 Human
A009S40
Human Assembly Chr Position (strand) Source JBrowse GRCh37 1 22,415,171 - 22,415,289 UniSTS GRCh37 Build 36 1 22,287,758 - 22,287,876 RGD NCBI36 Celera 1 20,738,124 - 20,738,242 RGD Cytogenetic Map 1 p36.1 UniSTS HuRef 1 20,658,946 - 20,659,064 UniSTS GeneMap99-GB4 RH Map 1 77.56 UniSTS
SHGC-57553
Human Assembly Chr Position (strand) Source JBrowse GRCh37 1 22,390,591 - 22,390,680 UniSTS GRCh37 Build 36 1 22,263,178 - 22,263,267 RGD NCBI36 Celera 1 20,713,545 - 20,713,634 RGD Cytogenetic Map 1 p36.1 UniSTS HuRef 1 20,634,376 - 20,634,465 UniSTS TNG Radiation Hybrid Map 1 9659.0 UniSTS
G34846
Human Assembly Chr Position (strand) Source JBrowse GRCh37 1 22,416,626 - 22,416,774 UniSTS GRCh37 Build 36 1 22,289,213 - 22,289,361 RGD NCBI36 Celera 1 20,739,579 - 20,739,727 RGD Cytogenetic Map 1 p36.1 UniSTS HuRef 1 20,660,401 - 20,660,549 UniSTS
G15855
Human Assembly Chr Position (strand) Source JBrowse GRCh37 1 22,418,312 - 22,418,525 UniSTS GRCh37 Build 36 1 22,290,899 - 22,291,112 RGD NCBI36 Celera 1 20,741,265 - 20,741,478 RGD Cytogenetic Map 1 p36.1 UniSTS HuRef 1 20,662,088 - 20,662,301 UniSTS
WI-18965
Human Assembly Chr Position (strand) Source JBrowse GRCh37 1 22,416,614 - 22,416,893 UniSTS GRCh37 Build 36 1 22,289,201 - 22,289,480 RGD NCBI36 Celera 1 20,739,567 - 20,739,846 RGD Cytogenetic Map 1 p36.1 UniSTS HuRef 1 20,660,389 - 20,660,668 UniSTS GeneMap99-GB4 RH Map 1 77.56 UniSTS Whitehead-RH Map 1 72.4 UniSTS
UniSTS:224478
Human Assembly Chr Position (strand) Source JBrowse GRCh37 1 22,416,606 - 22,416,764 UniSTS GRCh37 Build 36 1 22,289,193 - 22,289,351 RGD NCBI36 Celera 1 20,739,559 - 20,739,717 RGD HuRef 1 20,660,381 - 20,660,539 UniSTS
CDC42_1530
Human Assembly Chr Position (strand) Source JBrowse GRCh37 7 55,945,899 - 55,947,030 UniSTS GRCh37 GRCh37 1 22,418,049 - 22,418,924 UniSTS GRCh37 Build 36 1 22,290,636 - 22,291,511 RGD NCBI36 Celera 7 66,999,682 - 67,000,813 UniSTS Celera 1 20,741,002 - 20,741,877 RGD HuRef 1 20,661,824 - 20,662,700 UniSTS HuRef 7 55,760,580 - 55,761,711 UniSTS CRA_TCAGchr7v2 7 55,950,146 - 55,951,277 UniSTS
G22163
Human Assembly Chr Position (strand) Source JBrowse GRCh37 1 22,419,120 - 22,419,338 UniSTS GRCh37 Build 36 1 22,291,707 - 22,291,925 RGD NCBI36 Celera 1 20,742,073 - 20,742,291 RGD Cytogenetic Map 1 p36.1 UniSTS HuRef 1 20,662,896 - 20,663,114 UniSTS
RH69132
Human Assembly Chr Position (strand) Source JBrowse GRCh37 1 22,416,606 - 22,416,814 UniSTS GRCh37 Build 36 1 22,289,193 - 22,289,401 RGD NCBI36 Celera 1 20,739,559 - 20,739,767 RGD Cytogenetic Map 1 p36.1 UniSTS HuRef 1 20,660,381 - 20,660,589 UniSTS GeneMap99-GB4 RH Map 1 77.56 UniSTS
SHGC-74349
Human Assembly Chr Position (strand) Source JBrowse GRCh37 1 22,417,019 - 22,417,202 UniSTS GRCh37 Build 36 1 22,289,606 - 22,289,789 RGD NCBI36 Celera 1 20,739,972 - 20,740,155 RGD Cytogenetic Map 1 p36.1 UniSTS HuRef 1 20,660,794 - 20,660,977 UniSTS TNG Radiation Hybrid Map 1 9676.0 UniSTS GeneMap99-GB4 RH Map 1 77.56 UniSTS Whitehead-RH Map 1 72.3 UniSTS
D11S2921
Human Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 16 q22.1 UniSTS Cytogenetic Map 1 p36.1 UniSTS Cytogenetic Map 3 p24.2 UniSTS Cytogenetic Map 1 q23.3 UniSTS Cytogenetic Map 9 q34.3 UniSTS Cytogenetic Map 1 p36.31 UniSTS Cytogenetic Map 3 p25.3 UniSTS Cytogenetic Map 11 p15.4 UniSTS Cytogenetic Map 7 p14.1 UniSTS Cytogenetic Map 2 q22.3 UniSTS Cytogenetic Map 9 q22.33 UniSTS Cytogenetic Map 15 q13.2 UniSTS Cytogenetic Map 16 q24.3 UniSTS Cytogenetic Map 5 q31 UniSTS Cytogenetic Map 19 q13.11 UniSTS Cytogenetic Map 17 p11.2 UniSTS Cytogenetic Map 19 q13.3 UniSTS Cytogenetic Map 22 q13.33 UniSTS Cytogenetic Map 14 q13.2 UniSTS Cytogenetic Map 2 p25.1 UniSTS Cytogenetic Map 10 q24.33 UniSTS Cytogenetic Map 5 q23.3-q31.1 UniSTS Cytogenetic Map 8 p21.3 UniSTS Cytogenetic Map 22 q13.1 UniSTS Cytogenetic Map 1 p32.3 UniSTS Cytogenetic Map 17 q11 UniSTS Cytogenetic Map 1 q24 UniSTS Cytogenetic Map 11 q14 UniSTS Cytogenetic Map 17 q25 UniSTS Cytogenetic Map X q13.1 UniSTS Cytogenetic Map 2 q11.2 UniSTS Cytogenetic Map 9 p13.3 UniSTS Cytogenetic Map 19 p13.2 UniSTS Cytogenetic Map 2 q32.3 UniSTS Cytogenetic Map 17 q21.31 UniSTS Cytogenetic Map 19 q13.12 UniSTS Cytogenetic Map 4 q32.1 UniSTS Cytogenetic Map 7 q34 UniSTS Cytogenetic Map 13 q12 UniSTS Cytogenetic Map 12 p13.31 UniSTS Cytogenetic Map 3 p21.1 UniSTS Cytogenetic Map 3 q12.3 UniSTS Cytogenetic Map 14 q24.3 UniSTS Cytogenetic Map 6 q22 UniSTS Cytogenetic Map 22 q13.2 UniSTS Cytogenetic Map 19 q13.42 UniSTS Cytogenetic Map 17 q12 UniSTS Cytogenetic Map 20 q11 UniSTS Cytogenetic Map 8 q22.1 UniSTS Cytogenetic Map 5 q23.3 UniSTS Cytogenetic Map 20 q11.22 UniSTS Cytogenetic Map 1 p36.11 UniSTS Cytogenetic Map 19 q13.43 UniSTS Cytogenetic Map 17 q21 UniSTS Cytogenetic Map 11 q25 UniSTS Cytogenetic Map 3 p21.3 UniSTS Cytogenetic Map 1 q32.3 UniSTS Cytogenetic Map 2 q37.3 UniSTS Cytogenetic Map 12 q21.33 UniSTS Cytogenetic Map 7 p22.3 UniSTS Cytogenetic Map 4 p16.3 UniSTS Cytogenetic Map 17 p13.3 UniSTS Cytogenetic Map 1 p35.1 UniSTS Cytogenetic Map X p11.4-p11.3 UniSTS Cytogenetic Map 17 q11.2 UniSTS Cytogenetic Map 1 p36.33 UniSTS Cytogenetic Map 19 p13.3 UniSTS Cytogenetic Map 1 q24.1 UniSTS Cytogenetic Map 14 q11.2 UniSTS Cytogenetic Map 16 p11.2 UniSTS Cytogenetic Map 11 q24.2 UniSTS Cytogenetic Map 10 p15.1 UniSTS Cytogenetic Map 18 p11.31 UniSTS Cytogenetic Map 12 p13.32 UniSTS Cytogenetic Map 19 p13.11 UniSTS Cytogenetic Map 11 q13.5 UniSTS Cytogenetic Map 1 p22 UniSTS Cytogenetic Map 2 q14 UniSTS Cytogenetic Map 16 q24 UniSTS Cytogenetic Map 16 p13.3 UniSTS Cytogenetic Map 7 p22 UniSTS Cytogenetic Map 14 q32.33 UniSTS Cytogenetic Map 8 p11.21 UniSTS Cytogenetic Map 8 q24.11 UniSTS Cytogenetic Map 4 q12 UniSTS Cytogenetic Map 9 q22.31 UniSTS Cytogenetic Map 17 p13.2 UniSTS Cytogenetic Map 11 p15.5 UniSTS Cytogenetic Map 2 p11.2 UniSTS Cytogenetic Map 7 q11.23 UniSTS Cytogenetic Map 5 q31.1 UniSTS Cytogenetic Map 2 q33-q34 UniSTS Cytogenetic Map 17 q22.2 UniSTS Cytogenetic Map 8 q24.13 UniSTS Cytogenetic Map 22 q11.2 UniSTS Cytogenetic Map 6 p22.1 UniSTS Cytogenetic Map Y p11.2 UniSTS Cytogenetic Map 19 q13.2 UniSTS Cytogenetic Map 18 p11.21 UniSTS Cytogenetic Map 10 q22 UniSTS Cytogenetic Map 5 q35.3 UniSTS Cytogenetic Map 10 q23.1 UniSTS Cytogenetic Map 2 q37 UniSTS Cytogenetic Map 18 pter-p11.3 UniSTS Cytogenetic Map 8 q22.3 UniSTS Cytogenetic Map 6 p21.33 UniSTS Cytogenetic Map 7 q22.1 UniSTS Cytogenetic Map 2 q21.3 UniSTS Cytogenetic Map 2 q21.1 UniSTS Cytogenetic Map 8 p21.2 UniSTS Cytogenetic Map X q22.1 UniSTS Cytogenetic Map 10 q22.2 UniSTS Cytogenetic Map 1 p34.2 UniSTS Cytogenetic Map 19 q13.41 UniSTS Cytogenetic Map 14 q32.12 UniSTS Cytogenetic Map 3 q21.3 UniSTS Cytogenetic Map 4 q34.1 UniSTS Cytogenetic Map 10 p13 UniSTS Cytogenetic Map 17 q25.3 UniSTS Cytogenetic Map 3 q13.31 UniSTS Cytogenetic Map 7 q21.12 UniSTS Cytogenetic Map 15 q22.2 UniSTS Cytogenetic Map 8 p23.1 UniSTS Cytogenetic Map 5 q32 UniSTS Cytogenetic Map 20 q13.12 UniSTS Cytogenetic Map 12 q23.2 UniSTS Cytogenetic Map 6 p22 UniSTS Cytogenetic Map 11 q12.3 UniSTS Cytogenetic Map 11 p13 UniSTS Cytogenetic Map 1 q21.3 UniSTS Cytogenetic Map 16 p13.13 UniSTS Cytogenetic Map 1 p34 UniSTS Cytogenetic Map 1 p36.21 UniSTS Cytogenetic Map 12 q13 UniSTS Cytogenetic Map 19 q13.31 UniSTS Cytogenetic Map 19 q13.4 UniSTS Cytogenetic Map 4 p14 UniSTS Cytogenetic Map 1 q44 UniSTS Cytogenetic Map 19 p13.1-p12 UniSTS Cytogenetic Map 7 q22 UniSTS Cytogenetic Map 8 q24 UniSTS Cytogenetic Map 18 p11.31-p11.21 UniSTS Cytogenetic Map 21 q22.3 UniSTS Cytogenetic Map 7 p21.2 UniSTS Cytogenetic Map 12 q23-q24.1 UniSTS Cytogenetic Map 15 q15.1 UniSTS Cytogenetic Map 10 q11.23 UniSTS Cytogenetic Map 5 q14.1 UniSTS Cytogenetic Map 5 p15.33 UniSTS Cytogenetic Map 1 q21 UniSTS Cytogenetic Map 22 q11.21 UniSTS Cytogenetic Map 8 q24.3 UniSTS Cytogenetic Map 1 q42.1 UniSTS Cytogenetic Map 12 p13 UniSTS Cytogenetic Map 15 q21 UniSTS Cytogenetic Map 6 p21.3 UniSTS Cytogenetic Map 8 p11.22 UniSTS Cytogenetic Map 2 q12.3 UniSTS Cytogenetic Map 19 q13.3-q13.4 UniSTS Cytogenetic Map 15 q11.2 UniSTS Cytogenetic Map 5 q35 UniSTS Cytogenetic Map 8 p23-p22 UniSTS Cytogenetic Map 12 p11 UniSTS Cytogenetic Map 17 q21-q22 UniSTS Cytogenetic Map 12 q13.12 UniSTS Cytogenetic Map 2 q36.1 UniSTS Cytogenetic Map 11 p13-p12 UniSTS Cytogenetic Map X p22.33 UniSTS Cytogenetic Map Y p11.3 UniSTS Cytogenetic Map 2 q12.1 UniSTS Cytogenetic Map 3 p21.31 UniSTS Cytogenetic Map 3 q26.32 UniSTS Cytogenetic Map 7 q11.21 UniSTS Cytogenetic Map 10 q11.22 UniSTS Cytogenetic Map 17 p12 UniSTS Cytogenetic Map 3 p25.1 UniSTS Cytogenetic Map 14 q32 UniSTS Cytogenetic Map 5 q12-q13 UniSTS Cytogenetic Map 6 p23 UniSTS Cytogenetic Map 20 p12.3-p11.21 UniSTS Cytogenetic Map 17 q11.2-q12 UniSTS Cytogenetic Map 11 q23.3 UniSTS Cytogenetic Map 12 q13.3 UniSTS Cytogenetic Map 10 q23-q24 UniSTS Cytogenetic Map 14 q21.3 UniSTS Cytogenetic Map 11 q13 UniSTS Cytogenetic Map 12 q13-q14 UniSTS Cytogenetic Map 6 q14.1 UniSTS Cytogenetic Map 3 q26.33 UniSTS Cytogenetic Map X p22.2 UniSTS Cytogenetic Map 1 p31 UniSTS Cytogenetic Map 15 q15-q21.1 UniSTS Cytogenetic Map 9 q32 UniSTS Cytogenetic Map 17 p13 UniSTS Cytogenetic Map 7 q21-q22 UniSTS Cytogenetic Map 16 q24.1 UniSTS Cytogenetic Map 2 q33.3 UniSTS Cytogenetic Map 11 q22.1 UniSTS Cytogenetic Map 1 p13.3 UniSTS Cytogenetic Map 20 p13 UniSTS Cytogenetic Map 6 p21.1 UniSTS Cytogenetic Map 7 q36.3 UniSTS Cytogenetic Map 5 q12.3 UniSTS Cytogenetic Map 2 q33.2 UniSTS Cytogenetic Map 12 q22 UniSTS Cytogenetic Map 21 p11.1 UniSTS Cytogenetic Map 14 q23.2 UniSTS Cytogenetic Map 6 p22.3-p22.1 UniSTS Cytogenetic Map 7 p11.2 UniSTS Cytogenetic Map 6 q15 UniSTS Cytogenetic Map X q25-q26.3 UniSTS Cytogenetic Map 10 q22.3 UniSTS Cytogenetic Map 12 q24.31-q24.32 UniSTS Cytogenetic Map 16 p12.3 UniSTS Cytogenetic Map 9 q33.2 UniSTS Cytogenetic Map 15 q23 UniSTS Cytogenetic Map 12 p12.2-p11.2 UniSTS Cytogenetic Map 2 q14.3 UniSTS Cytogenetic Map X p11 UniSTS Cytogenetic Map 19 q13 UniSTS Cytogenetic Map 17 q22 UniSTS Cytogenetic Map 3 q21 UniSTS Cytogenetic Map 20 q13.2 UniSTS Cytogenetic Map 10 q26 UniSTS Cytogenetic Map 6 q22.31 UniSTS Cytogenetic Map 3 q27.1 UniSTS Cytogenetic Map 7 p13 UniSTS Cytogenetic Map 22 q13 UniSTS Cytogenetic Map 11 q13.1 UniSTS Cytogenetic Map 18 p11.32 UniSTS Cytogenetic Map 12 q15 UniSTS Cytogenetic Map X q22.3 UniSTS Cytogenetic Map 2 p25.3 UniSTS Cytogenetic Map 16 q21 UniSTS Cytogenetic Map 11 q23.1 UniSTS Cytogenetic Map 3 q13.13 UniSTS Cytogenetic Map 12 q24.31 UniSTS Cytogenetic Map 3 q27.3 UniSTS Cytogenetic Map 4 p13 UniSTS Cytogenetic Map 16 p12.1 UniSTS Cytogenetic Map 14 q32.11 UniSTS Cytogenetic Map 7 p14.3 UniSTS Cytogenetic Map 16 q12.1 UniSTS Cytogenetic Map 15 q25.2 UniSTS Cytogenetic Map 9 q21.13 UniSTS Cytogenetic Map 2 p23.3 UniSTS Cytogenetic Map 3 q29 UniSTS Cytogenetic Map 15 q22.31 UniSTS Cytogenetic Map 16 q22.2 UniSTS Cytogenetic Map 19 p13.12 UniSTS Cytogenetic Map 20 q13.1 UniSTS Cytogenetic Map 3 p14.3 UniSTS Cytogenetic Map 10 q23.33 UniSTS Cytogenetic Map 12 p12 UniSTS Cytogenetic Map 9 p24.1-p23 UniSTS Cytogenetic Map 15 q22 UniSTS Cytogenetic Map 6 p25 UniSTS Cytogenetic Map X q12-q13 UniSTS Cytogenetic Map 2 p16.1 UniSTS Cytogenetic Map 14 q23 UniSTS Cytogenetic Map 2 q31.1 UniSTS Cytogenetic Map 17 q23.3 UniSTS Cytogenetic Map 1 q42.1-q43 UniSTS Cytogenetic Map 7 q31.1-q31.3 UniSTS Cytogenetic Map 20 q11.21 UniSTS Cytogenetic Map 20 q12-q13.12 UniSTS Cytogenetic Map 1 q24-q25.3 UniSTS Cytogenetic Map 20 p12.1 UniSTS Cytogenetic Map 14 q32.31 UniSTS Cytogenetic Map 1 p13.2 UniSTS Cytogenetic Map 2 p13.3 UniSTS Cytogenetic Map 6 q25.1-q26 UniSTS Cytogenetic Map 12 q13.11-q14.3 UniSTS Cytogenetic Map 7 p11 UniSTS Cytogenetic Map 12 p11.22 UniSTS Cytogenetic Map 17 q23.1 UniSTS Cytogenetic Map 1 p36.13 UniSTS Cytogenetic Map 9 q34.11 UniSTS Cytogenetic Map 2 p15 UniSTS Cytogenetic Map 9 p11 UniSTS Cytogenetic Map 6 p24.3 UniSTS Cytogenetic Map 9 p24.1 UniSTS Cytogenetic Map 12 p13.2 UniSTS Cytogenetic Map 6 p22.2 UniSTS Cytogenetic Map 12 q24.2-q24.31 UniSTS Cytogenetic Map 22 q12.2 UniSTS Cytogenetic Map 11 p11.11 UniSTS Cytogenetic Map 11 q22-q23 UniSTS Cytogenetic Map 11 q14.1 UniSTS Cytogenetic Map 1 q32.1 UniSTS Cytogenetic Map 15 q22-q23 UniSTS Cytogenetic Map 9 p21 UniSTS Cytogenetic Map 15 q13.1 UniSTS Cytogenetic Map 15 q22-qter UniSTS Cytogenetic Map 10 q25 UniSTS Cytogenetic Map 6 p22.3 UniSTS Cytogenetic Map 6 p25.2 UniSTS Cytogenetic Map 5 p15.1 UniSTS Cytogenetic Map 2 p21 UniSTS Cytogenetic Map 22 q13.31 UniSTS Cytogenetic Map 21 q22.2 UniSTS Cytogenetic Map 19 q13.33 UniSTS Cytogenetic Map 14 q24.1 UniSTS Cytogenetic Map 13 q34 UniSTS Cytogenetic Map 18 q11.2 UniSTS Cytogenetic Map 6 q25.1 UniSTS Cytogenetic Map 20 q11.23 UniSTS Cytogenetic Map 1 q21.1 UniSTS Cytogenetic Map 17 q24.3 UniSTS Cytogenetic Map 16 q11.2 UniSTS Cytogenetic Map 16 p12.2 UniSTS Cytogenetic Map 11 q24 UniSTS Cytogenetic Map 2 q23.3 UniSTS Cytogenetic Map 1 p31.1 UniSTS Cytogenetic Map 18 q23 UniSTS Cytogenetic Map 11 q13.4 UniSTS Cytogenetic Map 7 p21.1 UniSTS Cytogenetic Map 2 q37.1 UniSTS Cytogenetic Map 8 p11.2 UniSTS Cytogenetic Map 9 q33.3 UniSTS Cytogenetic Map 4 q22.1 UniSTS Cytogenetic Map 2 q21.2 UniSTS Cytogenetic Map 15 q13.3 UniSTS Cytogenetic Map 7 p15.3 UniSTS Cytogenetic Map 3 p22.2 UniSTS Cytogenetic Map 11 q13.2 UniSTS Cytogenetic Map 19 p13.2-cen UniSTS Cytogenetic Map 19 p13.3-p13.2 UniSTS Cytogenetic Map 13 q32.3 UniSTS Cytogenetic Map 9 q33 UniSTS Cytogenetic Map 1 p36-p35 UniSTS Cytogenetic Map 19 q13.1 UniSTS Cytogenetic Map X q25 UniSTS Cytogenetic Map 12 q23 UniSTS Cytogenetic Map 21 q22.13 UniSTS Cytogenetic Map 2 q24.2 UniSTS Cytogenetic Map 7 q31.1-q31.2 UniSTS Cytogenetic Map 22 q11.23 UniSTS Cytogenetic Map X q24 UniSTS Cytogenetic Map 4 q25-q27 UniSTS Cytogenetic Map 3 q25.33 UniSTS Cytogenetic Map X q26.2 UniSTS Cytogenetic Map 8 q13.2 UniSTS Cytogenetic Map 8 q13.1 UniSTS Cytogenetic Map 8 q22.2 UniSTS Cytogenetic Map 6 q21 UniSTS Cytogenetic Map 5 q23.1 UniSTS Cytogenetic Map 4 q13.3 UniSTS Cytogenetic Map 3 p26.1 UniSTS Cytogenetic Map 1 q21.2 UniSTS Cytogenetic Map 17 p13.1 UniSTS Cytogenetic Map 3 p22-p21.3 UniSTS Cytogenetic Map 12 q UniSTS Cytogenetic Map X q21.3 UniSTS Cytogenetic Map 12 q12 UniSTS Cytogenetic Map 20 p11 UniSTS Cytogenetic Map 6 p12.3 UniSTS Cytogenetic Map 5 p13.1-p12 UniSTS Cytogenetic Map 1 p36.22 UniSTS Cytogenetic Map 9 q34 UniSTS Cytogenetic Map 7 q21.13 UniSTS Cytogenetic Map 20 q13.33 UniSTS Cytogenetic Map 3 p21.1-p14.3 UniSTS Cytogenetic Map 2 q33.1 UniSTS Cytogenetic Map 7 q36.1 UniSTS Cytogenetic Map 10 q24.31 UniSTS Cytogenetic Map 2 p25.1-p24.1 UniSTS Cytogenetic Map 3 q23 UniSTS Cytogenetic Map 13 q12.11 UniSTS Cytogenetic Map 12 q14.3 UniSTS Cytogenetic Map 13 q14.13 UniSTS Cytogenetic Map 11 p15 UniSTS Cytogenetic Map 6 q14.3-q16.1 UniSTS Cytogenetic Map 16 p13.2 UniSTS Cytogenetic Map 16 q22.3 UniSTS Cytogenetic Map 1 p32-p31 UniSTS Cytogenetic Map 12 q13.13 UniSTS Cytogenetic Map 8 p11 UniSTS Cytogenetic Map 6 q25 UniSTS Cytogenetic Map 8 p11.23 UniSTS Cytogenetic Map 9 p24.3 UniSTS Cytogenetic Map 7 q35 UniSTS Cytogenetic Map 11 q22.3 UniSTS Cytogenetic Map 16 p12 UniSTS Cytogenetic Map 6 q14.3 UniSTS Cytogenetic Map 7 q36 UniSTS Cytogenetic Map 1 q22 UniSTS Cytogenetic Map 10 p15.3 UniSTS Cytogenetic Map 8 p12 UniSTS Cytogenetic Map 13 q12.2 UniSTS Cytogenetic Map 7 p22.1 UniSTS Cytogenetic Map 6 p21.2 UniSTS Cytogenetic Map 18 q21.1 UniSTS Cytogenetic Map 10 p11.21 UniSTS Cytogenetic Map 10 p14 UniSTS Cytogenetic Map 3 p26 UniSTS Cytogenetic Map 9 q22.3 UniSTS Cytogenetic Map 17 q21.1-q21.3 UniSTS Cytogenetic Map 6 q11.1 UniSTS Cytogenetic Map 5 q13.2 UniSTS Cytogenetic Map 3 q21.1 UniSTS Cytogenetic Map 1 q32 UniSTS Cytogenetic Map 22 q13.1-q13.2 UniSTS Cytogenetic Map 19 p12 UniSTS Cytogenetic Map 9 q32-q33.3 UniSTS Cytogenetic Map 8 q21.2 UniSTS Cytogenetic Map 18 q12.1 UniSTS Cytogenetic Map 12 p13.2-p12.3 UniSTS Cytogenetic Map 1 p36.3-p36.2 UniSTS Cytogenetic Map 5 q11.2 UniSTS Cytogenetic Map 1 q25.2 UniSTS Cytogenetic Map 3 q13.2 UniSTS Cytogenetic Map 8 p22 UniSTS Cytogenetic Map 1 q25.1 UniSTS Cytogenetic Map 18 q21.32 UniSTS Cytogenetic Map 17 q21.2 UniSTS Cytogenetic Map 15 q26.2 UniSTS Cytogenetic Map 14 q22.1 UniSTS Cytogenetic Map 5 p15.2 UniSTS Cytogenetic Map 12 q23.1 UniSTS Cytogenetic Map 10 q24.2 UniSTS Cytogenetic Map 15 q15.3 UniSTS Cytogenetic Map 1 p22.2 UniSTS Cytogenetic Map 7 q32 UniSTS Cytogenetic Map 5 p13 UniSTS Cytogenetic Map 16 q23.2 UniSTS Cytogenetic Map 10 q24-q25 UniSTS Cytogenetic Map 7 p11.1 UniSTS Cytogenetic Map 14 q11.2-q21 UniSTS Cytogenetic Map 14 q12 UniSTS Cytogenetic Map 12 q24.13 UniSTS Cytogenetic Map 10 q21-q22 UniSTS Cytogenetic Map 4 q22 UniSTS Cytogenetic Map 9 q22.2 UniSTS Cytogenetic Map 10 q23.31 UniSTS Cytogenetic Map 2 p13.1 UniSTS Cytogenetic Map 2 p24.1 UniSTS Cytogenetic Map 19 p13 UniSTS Cytogenetic Map 7 p13-p11.1 UniSTS Cytogenetic Map 7 q21.1-q22 UniSTS Cytogenetic Map 1 p36.3 UniSTS Cytogenetic Map 15 q26.1 UniSTS Cytogenetic Map 2 q32.1 UniSTS Cytogenetic Map 5 p14.3 UniSTS Cytogenetic Map X p22.13 UniSTS Cytogenetic Map 13 q14.2 UniSTS Cytogenetic Map 15 q UniSTS Cytogenetic Map 7 q UniSTS Cytogenetic Map 17 q25.1 UniSTS Cytogenetic Map 10 q23 UniSTS Cytogenetic Map 5 p12 UniSTS Cytogenetic Map 11 p11.2 UniSTS Cytogenetic Map 10 q11.21 UniSTS Cytogenetic Map 20 q13.13 UniSTS Cytogenetic Map 13 q22.1 UniSTS Cytogenetic Map 15 q21.2 UniSTS Cytogenetic Map X q28 UniSTS Cytogenetic Map 9 p13.1 UniSTS Cytogenetic Map 9 q34.13 UniSTS
G32824
Human Assembly Chr Position (strand) Source JBrowse GRCh37 1 22,415,171 - 22,415,289 UniSTS GRCh37 Celera 1 20,738,124 - 20,738,242 UniSTS Cytogenetic Map 1 p36.1 UniSTS HuRef 1 20,658,946 - 20,659,064 UniSTS
GDB:636131
Human Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 1 p36.1 UniSTS
SHGC-12429
Human Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 1 p36.1 UniSTS Whitehead-YAC Contig Map 20 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
entire extraembryonic component
1204
2439
2788
2253
4974
1726
2351
6
624
1951
465
2270
7306
6472
53
3734
1
852
1744
1617
175
1
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENST00000315554 ⟹ ENSP00000314458
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 22,052,709 - 22,090,807 (+) Ensembl
Ensembl Acc Id:
ENST00000344548 ⟹ ENSP00000341072
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 22,052,627 - 22,092,946 (+) Ensembl
Ensembl Acc Id:
ENST00000400259 ⟹ ENSP00000383118
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 22,052,627 - 22,092,923 (+) Ensembl
Ensembl Acc Id:
ENST00000411827 ⟹ ENSP00000398327
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 22,052,661 - 22,092,943 (+) Ensembl
Ensembl Acc Id:
ENST00000498236 ⟹ ENSP00000496911
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 22,052,707 - 22,090,010 (+) Ensembl
Ensembl Acc Id:
ENST00000648594 ⟹ ENSP00000497733
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 22,025,511 - 22,101,360 (+) Ensembl
Ensembl Acc Id:
ENST00000651171 ⟹ ENSP00000499132
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 22,052,710 - 22,086,725 (+) Ensembl
Ensembl Acc Id:
ENST00000652582 ⟹ ENSP00000498275
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 22,052,712 - 22,086,715 (+) Ensembl
Ensembl Acc Id:
ENST00000656825 ⟹ ENSP00000499457
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 22,052,709 - 22,101,360 (+) Ensembl
Ensembl Acc Id:
ENST00000662562 ⟹ ENSP00000499612
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 22,053,486 - 22,092,917 (+) Ensembl
Ensembl Acc Id:
ENST00000667384 ⟹ ENSP00000499473
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 22,052,651 - 22,092,273 (+) Ensembl
Ensembl Acc Id:
ENST00000695796 ⟹ ENSP00000512176
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 22,052,865 - 22,092,942 (+) Ensembl
Ensembl Acc Id:
ENST00000695797 ⟹ ENSP00000512177
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 22,053,023 - 22,092,942 (+) Ensembl
Ensembl Acc Id:
ENST00000695798 ⟹ ENSP00000512178
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 22,055,030 - 22,092,942 (+) Ensembl
Ensembl Acc Id:
ENST00000695799 ⟹ ENSP00000512179
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 22,062,125 - 22,092,942 (+) Ensembl
Ensembl Acc Id:
ENST00000695800 ⟹ ENSP00000512180
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 22,065,321 - 22,092,942 (+) Ensembl
Ensembl Acc Id:
ENST00000695801 ⟹ ENSP00000512181
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 22,072,455 - 22,092,942 (+) Ensembl
Ensembl Acc Id:
ENST00000695802 ⟹ ENSP00000512182
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 22,076,334 - 22,092,942 (+) Ensembl
Ensembl Acc Id:
ENST00000695857 ⟹ ENSP00000512222
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 22,052,671 - 22,091,559 (+) Ensembl
Ensembl Acc Id:
ENST00000695858 ⟹ ENSP00000512223
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 22,052,671 - 22,092,946 (+) Ensembl
Ensembl Acc Id:
ENST00000695859 ⟹ ENSP00000512224
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 22,052,679 - 22,092,273 (+) Ensembl
Ensembl Acc Id:
ENST00000695860 ⟹ ENSP00000512225
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 22,052,760 - 22,091,559 (+) Ensembl
Ensembl Acc Id:
ENST00000695861 ⟹ ENSP00000512226
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 22,077,804 - 22,091,559 (+) Ensembl
Ensembl Acc Id:
ENST00000695862 ⟹ ENSP00000512227
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 22,078,438 - 22,092,917 (+) Ensembl
Ensembl Acc Id:
ENST00000695863 ⟹ ENSP00000512228
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 22,078,470 - 22,087,263 (+) Ensembl
RefSeq Acc Id:
NM_001039802 ⟹ NP_001034891
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 1 22,052,709 - 22,101,360 (+) NCBI GRCh37 1 22,379,120 - 22,419,439 (+) NCBI Build 36 1 22,251,707 - 22,292,023 (+) NCBI Archive HuRef 1 20,622,960 - 20,663,212 (+) ENTREZGENE CHM1_1 1 22,491,651 - 22,531,931 (+) NCBI T2T-CHM13v2.0 1 21,876,517 - 21,925,101 (+) NCBI
Sequence:
GCAGTGCTGCCAACGCCCCGGTGGAGAAGCTGAGACGGAGTCTCACTGTGTTGCCCAGGCTGGAGTGCAGTGGCGCCATCTTGGCTCACTGCAGTGCGCCTCTGCCCCCCGAGTTCAAGCGATTCTCC
hide sequence
RefSeq Acc Id:
NM_001791 ⟹ NP_001782
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 1 22,052,709 - 22,101,360 (+) NCBI GRCh37 1 22,379,120 - 22,419,439 (+) NCBI Build 36 1 22,251,707 - 22,292,023 (+) NCBI Archive HuRef 1 20,622,960 - 20,663,212 (+) ENTREZGENE CHM1_1 1 22,491,651 - 22,531,931 (+) NCBI T2T-CHM13v2.0 1 21,876,517 - 21,925,101 (+) NCBI
Sequence:
GCAGTGCTGCCAACGCCCCGGTGGAGAAGCTGAGGTCATCATCAGATTTGAAATATTTAAAGTG
hide sequence
RefSeq Acc Id:
NM_044472 ⟹ NP_426359
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 1 22,052,709 - 22,090,807 (+) NCBI GRCh37 1 22,379,120 - 22,419,439 (+) NCBI Build 36 1 22,251,707 - 22,289,883 (+) NCBI Archive HuRef 1 20,622,960 - 20,663,212 (+) ENTREZGENE CHM1_1 1 22,491,651 - 22,529,791 (+) NCBI T2T-CHM13v2.0 1 21,876,517 - 21,914,555 (+) NCBI
Sequence:
GCAGTGCTGCCAACGCCCCGGTGGAGAAGCTGAGGTCATCATCAGATTTGAAATATTTAAAGTGGATACAAAACTATTTCAGCAATGCAGACAATTAAGTGTGTTGTTGTGGGCGATGGTGCTGTTGG
hide sequence
RefSeq Acc Id:
NP_001034891 ⟸ NM_001039802
- Peptide Label:
isoform 1 precursor
- UniProtKB:
Q7L8R5 (UniProtKB/Swiss-Prot), P25763 (UniProtKB/Swiss-Prot), P21181 (UniProtKB/Swiss-Prot), Q9UDI2 (UniProtKB/Swiss-Prot), P60953 (UniProtKB/Swiss-Prot), A0A590UJK8 (UniProtKB/TrEMBL)
- Sequence:
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEK
hide sequence
RefSeq Acc Id:
NP_001782 ⟸ NM_001791
- Peptide Label:
isoform 1 precursor
- UniProtKB:
Q7L8R5 (UniProtKB/Swiss-Prot), P25763 (UniProtKB/Swiss-Prot), P21181 (UniProtKB/Swiss-Prot), Q9UDI2 (UniProtKB/Swiss-Prot), P60953 (UniProtKB/Swiss-Prot), A0A590UJK8 (UniProtKB/TrEMBL)
- Sequence:
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDY
hide sequence
RefSeq Acc Id:
NP_426359 ⟸ NM_044472
- Peptide Label:
isoform 2
- UniProtKB:
A0A590UJK8 (UniProtKB/TrEMBL)
- Sequence:
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEK
hide sequence
Ensembl Acc Id:
ENSP00000497733 ⟸ ENST00000648594
Ensembl Acc Id:
ENSP00000398327 ⟸ ENST00000411827
Ensembl Acc Id:
ENSP00000499612 ⟸ ENST00000662562
Ensembl Acc Id:
ENSP00000383118 ⟸ ENST00000400259
Ensembl Acc Id:
ENSP00000499132 ⟸ ENST00000651171
Ensembl Acc Id:
ENSP00000498275 ⟸ ENST00000652582
Ensembl Acc Id:
ENSP00000499473 ⟸ ENST00000667384
Ensembl Acc Id:
ENSP00000496911 ⟸ ENST00000498236
Ensembl Acc Id:
ENSP00000499457 ⟸ ENST00000656825
Ensembl Acc Id:
ENSP00000314458 ⟸ ENST00000315554
Ensembl Acc Id:
ENSP00000341072 ⟸ ENST00000344548
Ensembl Acc Id:
ENSP00000512225 ⟸ ENST00000695860
Ensembl Acc Id:
ENSP00000512176 ⟸ ENST00000695796
Ensembl Acc Id:
ENSP00000512228 ⟸ ENST00000695863
Ensembl Acc Id:
ENSP00000512178 ⟸ ENST00000695798
Ensembl Acc Id:
ENSP00000512227 ⟸ ENST00000695862
Ensembl Acc Id:
ENSP00000512224 ⟸ ENST00000695859
Ensembl Acc Id:
ENSP00000512222 ⟸ ENST00000695857
Ensembl Acc Id:
ENSP00000512181 ⟸ ENST00000695801
Ensembl Acc Id:
ENSP00000512226 ⟸ ENST00000695861
Ensembl Acc Id:
ENSP00000512223 ⟸ ENST00000695858
Ensembl Acc Id:
ENSP00000512179 ⟸ ENST00000695799
Ensembl Acc Id:
ENSP00000512177 ⟸ ENST00000695797
Ensembl Acc Id:
ENSP00000512180 ⟸ ENST00000695800
Ensembl Acc Id:
ENSP00000512182 ⟸ ENST00000695802
RGD ID: 6854434 Promoter ID: EPDNEW_H382 Type: initiation region Name: CDC42_1 Description: cell division cycle 42 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 1 22,052,709 - 22,052,769 EPDNEW
RGD ID: 6784899 Promoter ID: HG_KWN:1255 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: CD4+TCell, K562, Lymphoblastoid, NB4 Transcripts: ENST00000344548, NM_001791, OTTHUMT00000008075, OTTHUMT00000008076, UC009VQG.1, UC009VQH.1 Position: Human Assembly Chr Position (strand) Source Build 36 1 22,251,534 - 22,252,034 (+) MPROMDB
RGD ID: 6784897 Promoter ID: HG_KWN:1256 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: CD4+TCell, CD4+TCell_12Hour, CD4+TCell_2Hour, HeLa_S3, Jurkat, K562, Lymphoblastoid, NB4 Transcripts: OTTHUMT00000008077 Position: Human Assembly Chr Position (strand) Source Build 36 1 22,251,651 - 22,252,677 (+) MPROMDB
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2013-01-22
CDC42
cell division cycle 42
CDC42
cell division cycle 42 (GTP binding protein, 25kDa)
Symbol and/or name change
5135510 APPROVED
