Gna11 (G protein subunit alpha 11)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Gna11 (G protein subunit alpha 11) Rattus norvegicus

Analyze

Symbol:

Gna11

Name:

G protein subunit alpha 11

RGD ID:

619749

Description:

Enables alkylglycerophosphoethanolamine phosphodiesterase activity. Predicted to be involved in several processes, including G protein-coupled receptor signaling pathway; multicellular organism aging; and positive regulation of insulin secretion. Predicted to act upstream of or within several processes, including cellular response to pH; regulation of melanocyte differentiation; and skeletal system development. Located in cytosol and plasma membrane. Part of heterotrimeric G-protein complex. Human ortholog(s) of this gene implicated in autosomal dominant hypocalcemia 2 and familial hypocalciuric hypercalcemia 2. Orthologous to human GNA11 (G protein subunit alpha 11); PARTICIPATES IN acetylcholine signaling pathway via muscarinic acetylcholine receptors engaging G alphaq protein family; angiotensin II signaling pathway via AT1 receptor; eicosanoid signaling pathway; INTERACTS WITH 17beta-estradiol; 2,3,7,8-Tetrachlorodibenzofuran; 3,4-methylenedioxymethamphetamine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

g alpha-11; G-protein subunit alpha-11; guanine nucleotide binding protein, alpha 11; guanine nucleotide regulatory protein G alpha 11; guanine nucleotide-binding protein alpha 11 subunit; guanine nucleotide-binding protein subunit alpha-11; heterotrimeric guanine nucleotide-binding protein 1k; Hg1k

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	7	8,163,752 - 8,177,636 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	8,162,750 - 8,179,812 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	11,049,827 - 11,063,675 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	7	12,925,490 - 12,939,339 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	7	10,792,631 - 10,806,445 (+)	NCBI	Rnor_WKY
Rnor_6.0	7	11,033,400 - 11,047,284 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	11,033,317 - 11,047,437 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	11,200,712 - 11,214,475 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	9,636,748 - 9,662,492 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	9,636,747 - 9,662,492 (+)	NCBI
Celera	7	6,354,654 - 6,368,340 (+)	NCBI		Celera
Cytogenetic Map	7	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autosomal dominant hypocalcemia 2 (ISO)

CLOVES syndrome (ISO)

congenital heart disease (ISO)

Craniofacial Abnormalities (ISO)

familial hypocalciuric hypercalcemia 2 (ISO)

familial multiple nevi flammei (ISO)

genetic disease (ISO)

melanoma (ISO)

Neurodevelopmental Disorders (ISO)

skin melanoma (ISO)

uveal melanoma (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17beta-estradiol (EXP)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

3,4-methylenedioxymethamphetamine (EXP,ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

acetamide (EXP)

aflatoxin B1 (ISO)

aldehydo-D-glucose (EXP)

antirheumatic drug (ISO)

apocynin (EXP)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

butan-1-ol (ISO)

carbachol (EXP)

cisplatin (ISO)

D-glucose (EXP)

dextran sulfate (ISO)

diarsenic trioxide (ISO)

diazinon (EXP)

doxorubicin (ISO)

ethanol (EXP,ISO)

folic acid (ISO)

fulvestrant (ISO)

glucose (EXP)

ivermectin (ISO)

methotrexate (ISO)

methyl methanesulfonate (ISO)

N-ethyl-N-nitrosourea (ISO)

Nor-9-carboxy-delta9-THC (ISO)

paracetamol (EXP)

progesterone (ISO)

sodium arsenite (EXP,ISO)

streptozocin (EXP)

tert-butyl hydroperoxide (ISO)

titanium dioxide (ISO)

trametinib (ISO)

trichloroethene (ISO)

urethane (ISO)

valproic acid (EXP,ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

action potential (IBA,IEA,ISO)

adenylate cyclase-modulating G protein-coupled receptor signaling pathway (IBA)

cellular response to pH (IEA,ISO)

cranial skeletal system development (IEA,ISO)

developmental pigmentation (IEA,ISO)

endothelin receptor signaling pathway (IEA,ISO)

G protein-coupled receptor signaling pathway (IEA,ISO)

glutamate receptor signaling pathway (ISO)

heart development (IEA,ISO)

ion channel modulating, G protein-coupled receptor signaling pathway (IEA,ISO)

ligand-gated ion channel signaling pathway (IEA,ISO)

phospholipase C-activating dopamine receptor signaling pathway (IBA,IEA,ISO)

phospholipase C-activating G protein-coupled acetylcholine receptor signaling pathway (IEA,ISO)

phospholipase C-activating G protein-coupled receptor signaling pathway (ISO)

positive regulation of insulin secretion (IEA,ISO)

regulation of blood pressure (IEA,ISO)

regulation of melanocyte differentiation (IEA,ISO)

skeletal system development (IEA,ISO)

Cellular Component

cytoplasm (IEA)

cytoplasm (ISO)

cytosol (IDA)

heterotrimeric G-protein complex (IBA,IDA)

plasma membrane (IDA)

plasma membrane (IEA,ISO)

synapse (IEA)

Molecular Function

alkylglycerophosphoethanolamine phosphodiesterase activity (IDA)

G protein activity (IEA,ISO)

G protein-coupled receptor binding (IBA,IEA)

G-protein beta/gamma-subunit complex binding (IBA,IEA)

GTP binding (IEA)

GTPase activity (IBA,IEA)

guanyl nucleotide binding (TAS)

metal ion binding (IEA)

phospholipase activator activity (IEA,ISO)

protein binding (ISO)

protein-containing complex binding (IPI)

Molecular Pathway Annotations Click to see Annotation Detail View

acetylcholine signaling pathway via muscarinic acetylcholine receptors engaging G alphaq protein family (ISO)

angiotensin II signaling pathway via AT1 receptor (ISO)

calcium/calcium-mediated signaling pathway (IEA)

Chagas disease pathway (IEA)

eicosanoid signaling pathway (ISO)

endothelin signaling pathway (ISO)

Entamoebiasis pathway (IEA)

G protein mediated signaling pathway via Galphaq family (ISO)

gonadotropin-releasing hormone signaling pathway (IEA)

long term depression (IEA)

oxytocin signaling pathway (ISO)

sphingosine 1-phosphate signaling pathway (ISO)

vasopressin signaling pathway (ISO)

vasopressin signaling pathway via receptor type 1 (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	The heterotrimeric G protein subunits Galpha(q) and Gbeta(1) have lysophospholipase D activity.	Aoyama C, etal., Biochem J. 2011 Dec 1;440(2):241-50. doi: 10.1042/BJ20110545.
2.	Sex differences in corticotropin-releasing factor receptor signaling and trafficking: potential role in female vulnerability to stress-related psychopathology.	Bangasser DA, etal., Mol Psychiatry. 2010 Sep;15(9):877, 896-904. Epub 2010 Jun 15.
3.	A region-specific increase in Galphaq and Galpha11 proteins in brains of rats during cocaine withdrawal.	Carrasco GA, etal., J Pharmacol Exp Ther. 2003 Dec;307(3):1012-9. Epub 2003 Oct 8.
4.	Short-term cocaine treatment causes neuroadaptive changes in Galphaq and Galpha11 proteins in rats undergoing withdrawal.	Carrasco GA, etal., J Pharmacol Exp Ther. 2004 Oct;311(1):349-55. Epub 2004 Jun 2.
5.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
7.	Molecular properties of muscarinic acetylcholine receptors.	Haga T Proc Jpn Acad Ser B Phys Biol Sci. 2013;89(6):226-56.
8.	Science review: Vasopressin and the cardiovascular system part 1--receptor physiology.	Holmes CL, etal., Crit Care. 2003 Dec;7(6):427-34. Epub 2003 Jun 26.
9.	Pleiotropic AT1 receptor signaling pathways mediating physiological and pathogenic actions of angiotensin II.	Hunyady L and Catt KJ, Mol Endocrinol. 2006 May;20(5):953-70. Epub 2005 Sep 1.
10.	An immunocapture/scintillation proximity analysis of G alpha q/11 activation by native serotonin (5-HT)2A receptors in rat cortex: blockade by clozapine and mirtazapine.	Mannoury La Cour C, etal., Synapse. 2009 Feb;63(2):95-105.
11.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
12.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
13.	Embryonic cardiomyocyte hypoplasia and craniofacial defects in G alpha q/G alpha 11-mutant mice.	Offermanns S, etal., EMBO J 1998 Aug 3;17(15):4304-12.
14.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
15.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
16.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
17.	Chronic ethanol feeding impairs endothelin-1-stimulated glucose uptake via decreased G alpha 11 expression in rat adipocytes.	Rachdaoui N, etal., Am J Physiol Endocrinol Metab 2003 Aug;285(2):E303-10.
18.	Norepinephrine exocytosis stimulated by alpha-latrotoxin requires both external and stored Ca2+ and is mediated by latrophilin, G proteins and phospholipase C.	Rahman MA, etal., Philos Trans R Soc Lond B Biol Sci. 1999 Feb 28;354(1381):379-86.
19.	GOA pipeline	RGD automated data pipeline
20.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
21.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
22.	Regulation of phosphoinositide-specific phospholipase C.	Rhee SG Annu Rev Biochem. 2001;70:281-312.

Additional References at PubMed

PMID:10818132	PMID:11438569	PMID:15322542	PMID:15574748	PMID:15716410	PMID:16365309	PMID:17110338	PMID:17194762	PMID:17897319	PMID:18703424	PMID:18820027	PMID:19056867
PMID:19199708	PMID:20036247	PMID:20393598	PMID:21464134	PMID:21649864	PMID:22733973	PMID:23376485	PMID:23533145	PMID:23696743

Genomics

Comparative Map Data

Gna11
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	7	8,163,752 - 8,177,636 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	8,162,750 - 8,179,812 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	11,049,827 - 11,063,675 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	7	12,925,490 - 12,939,339 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	7	10,792,631 - 10,806,445 (+)	NCBI	Rnor_WKY
Rnor_6.0	7	11,033,400 - 11,047,284 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	11,033,317 - 11,047,437 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	11,200,712 - 11,214,475 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	9,636,748 - 9,662,492 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	9,636,747 - 9,662,492 (+)	NCBI
Celera	7	6,354,654 - 6,368,340 (+)	NCBI		Celera
Cytogenetic Map	7	q11	NCBI

GNA11
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	3,094,362 - 3,123,999 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	19	3,094,362 - 3,123,999 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	3,094,360 - 3,123,997 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	3,045,408 - 3,072,468 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	19	3,045,529 - 3,072,452	NCBI
Celera	19	3,028,658 - 3,055,719 (+)	NCBI		Celera
Cytogenetic Map	19	p13.3	NCBI
HuRef	19	2,861,199 - 2,888,094 (+)	NCBI		HuRef
CHM1_1	19	3,110,108 - 3,121,429 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	19	3,068,114 - 3,097,735 (+)	NCBI		T2T-CHM13v2.0

Gna11
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	10	81,364,558 - 81,380,996 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	10	81,364,558 - 81,381,024 (-)	Ensembl		GRCm39 Ensembl
GRCm38	10	81,528,724 - 81,545,162 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	10	81,528,724 - 81,545,190 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	10	80,991,477 - 81,007,791 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	10	80,931,861 - 80,948,175 (-)	NCBI		MGSCv36	mm8
Celera	10	82,551,913 - 82,568,227 (-)	NCBI		Celera
Cytogenetic Map	10	C1	NCBI
cM Map	10	39.72	NCBI

Gna11
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955495	5,285,380 - 5,302,631 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955495	5,286,891 - 5,302,631 (-)	NCBI	ChiLan1.0	ChiLan1.0

GNA11
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	19	3,074,484 - 3,102,124 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	3,074,483 - 3,102,124 (+)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	19	2,120,398 - 2,149,161 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

GNA11
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Dog10K_Boxer_Tasha	20	55,871,216 - 55,890,787 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	20	56,806,259 - 56,825,830 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	20	56,806,259 - 56,825,830 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	20	55,861,412 - 55,880,956 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	20	56,345,542 - 56,365,145 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	20	56,544,290 - 56,563,840 (-)	NCBI		UU_Cfam_GSD_1.0

Gna11
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	216,045,637 - 216,064,006 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936588	1,770,771 - 1,789,170 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936588	1,770,777 - 1,789,143 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GNA11
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	75,437,201 - 75,457,092 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	75,439,405 - 75,456,855 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	76,071,093 - 76,088,406 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3
Pig Cytomap	2	q21-q24	NCBI

GNA11
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	2,858,880 - 2,887,694 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	2,858,937 - 2,887,704 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666081	5,694,672 - 5,723,312 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Gna11
(Heterocephalus glaber - naked mole-rat)

Naked Mole-rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624828	6,077,851 - 6,093,750 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624828	6,078,485 - 6,093,744 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Gna11
37 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	123
Count of miRNA genes:	96
Interacting mature miRNAs:	102
Transcripts:	ENSRNOT00000007498
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2298550	Neuinf6	Neuroinflammation QTL 6	3.3		nervous system integrity trait (VT:0010566)	spinal cord RT1-B protein level (CMO:0002132)	7	1	27829089	Rat
7411566	Bw136	Body weight QTL 136	10.4	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	7	1	31962314	Rat
9590142	Scort5	Serum corticosterone level QTL 5	24.4	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	7	1	31962314	Rat
724560	Plsm3	Polydactyly-luxate syndrome (PLS) morphotypes QTL 3		0.0003	tibia length (VT:0004357)	tibia length (CMO:0000450)	7	1	34000259	Rat
2317047	Wbc4	White blood cell count QTL 4		0.01	leukocyte quantity (VT:0000217)	white blood cell count (CMO:0000027)	7	1	35342956	Rat
61410	Bw19	Body weight QTL 19	6.2	0.001	body mass (VT:0001259)	body weight (CMO:0000012)	7	1	44782185	Rat
631503	Bp102	Blood pressure QTL 102	1.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	1	44822433	Rat
1300176	Hrtrt10	Heart rate QTL 10	3.19		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	7	664270	26029351	Rat
634336	Anxrr17	Anxiety related response QTL 17	3.66		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	924703	115097879	Rat
10755438	Coatc9	Coat color QTL 9		0	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	7	3529280	48529280	Rat
9590102	Sffal5	Serum free fatty acids level QTL 5	8.62	0.001	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	7	5329019	50329019	Rat
10755440	Coatc10	Coat color QTL 10		0	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	7	7496499	52496499	Rat
10059592	Kidm45	Kidney mass QTL 45	3.95	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	7	7573985	52573985	Rat

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	36	45	34	11	34	1	4	74	35	37	11	1
Low		7	12	7	8	7	7	7			4		7
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_031033	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC127191	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF239674	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474029	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000177	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	L37293	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	OU667098	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000007498 ⟹ ENSRNOP00000007498

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	8,163,406 - 8,179,812 (+)	Ensembl
Rnor_6.0 Ensembl	7	11,033,317 - 11,047,437 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000111043 ⟹ ENSRNOP00000081654

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	8,162,750 - 8,179,812 (+)	Ensembl

RefSeq Acc Id:

NM_031033 ⟹ NP_112295

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	7	8,163,752 - 8,177,636 (+)	NCBI
Rnor_6.0	7	11,033,400 - 11,047,284 (+)	NCBI
Rnor_5.0	7	11,200,712 - 11,214,475 (+)	NCBI
RGSC_v3.4	7	9,636,748 - 9,662,492 (+)	RGD
Celera	7	6,354,654 - 6,368,340 (+)	RGD

Sequence:

show sequence

ATGACTCTGGAGTCCATGATAGCGTGTTGCCTGAGCGACGAGGTGAAGGAGTCGAAGCGCATCA
ACGCGGAGATCGAGAAACAGCTGCGGCGAGACAAGCGCGACGCCCGGCGCGAGCTCAAGCTGCT
GCTTCTCGGCACTGGCGAGAGCGGGAAGAGCACCTTCATCAAGCAGATGCGCATCATCCATGGC
GCCGGCTACTCGGAGGAGGACAAACGCGGCTTCACAAAGCTGGTGTACCAGAACATCTTCACCG
CCATGCAGGCTGTGGTGCGCGCTATGGACACGCTCAAGATCCGCTACAAGTATGAGCAGAACAA
GGCCAATGCACTCCTGATCCGGGAGGTTGATGTGGAGAAGGTCACGACTTTTGAGCATCAGTAT
GTGAACGCCATCAAGACACTGTGGAGTGACCCTGGTGTCCAGGAGTGCTACGATCGCAGGCGAG
AGTTCCAGCTCTCTGACTCGGCTAAGTACTACTTGACGGACGTGGACCGCATCGCTACAGTAGG
CTACCTGCCCACCCAGCAGGATGTGCTGCGGGTACGTGTGCCCACAACTGGCATCATCGAGTAC
CCGTTTGACCTGGAGAACATCATCTTCAGGATGGTGGATGTGGGCGGGCAGAGGTCAGAGCGCA
GGAAGTGGATCCATTGCTTTGAGAATGTCACGTCCATCATGTTCTTGGTGGCATTAAGCGAGTA
TGACCAGGTCCTGGTGGAGTCGGACAACGAGAACCGCATGGAGGAGAGCAAGGCCCTGTTCCGC
ACAATCATCACCTACCCCTGGTTCCAGCACTCGTCTGTGATCCTCTTCCTCAACAAGAAGGACC
TTCTGGAAGACAAGATCCTGCACTCACACTTGGTCGACTACTTCCCCGAGTTCGATGGGCCACA
GAGGGACGCACAGGCCGCCCGCGAGTTCATCCTGAAGATGTTTGTGGATCTGAACCCCGACAGC
GACAAGATCATCTACTCGCACTTCACCTGCGCCACGGACACCGAAAACATCCGCTTCGTGTTTG
CTGCCGTGAAGGACACCATCCTGCAGCTGAACCTGAAGGAGTACAACCTGGTCTGA

hide sequence

Protein Sequences


Protein RefSeqs	NP_112295	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA53112	(Get FASTA)	NCBI Sequence Viewer
	AAF81690	(Get FASTA)	NCBI Sequence Viewer
	CAG9553616	(Get FASTA)	NCBI Sequence Viewer
	EDL89141	(Get FASTA)	NCBI Sequence Viewer
	Q9JID2	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:

NP_112295 ⟸ NM_031033

- UniProtKB:

G3V6Q6 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MTLESMIACCLSDEVKESKRINAEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHG
AGYSEEDKRGFTKLVYQNIFTAMQAVVRAMDTLKIRYKYEQNKANALLIREVDVEKVTTFEHQY
VNAIKTLWSDPGVQECYDRRREFQLSDSAKYYLTDVDRIATVGYLPTQQDVLRVRVPTTGIIEY
PFDLENIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFR
TIITYPWFQHSSVILFLNKKDLLEDKILHSHLVDYFPEFDGPQRDAQAAREFILKMFVDLNPDS
DKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV

hide sequence

RefSeq Acc Id:

ENSRNOP00000007498 ⟸ ENSRNOT00000007498

RefSeq Acc Id:

ENSRNOP00000081654 ⟸ ENSRNOT00000111043

Protein Domains

G-alpha

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9JID2-F1-model_v2	AlphaFold	Q9JID2	1-359	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13694968

Promoter ID:

EPDNEW_R5493

Type:

initiation region

Name:

Gna11_1

Description:

G protein subunit alpha 11

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	7	11,033,230 - 11,033,290	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:619749	AgrOrtholog
BioCyc Gene	G2FUF-35039	BioCyc
Ensembl Genes	ENSRNOG00000005446	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000007498	ENTREZGENE
	ENSRNOP00000007498.3	UniProtKB/TrEMBL
	ENSRNOP00000081654.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000007498	ENTREZGENE
	ENSRNOT00000007498.5	UniProtKB/TrEMBL
	ENSRNOT00000111043.1	UniProtKB/TrEMBL
Gene3D-CATH	1.10.400.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	3.40.50.300	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	Gprotein_alpha_Q	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Gprotein_alpha_su	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GproteinA_insert	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	P-loop_NTPase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:81662	UniProtKB/Swiss-Prot
NCBI Gene	81662	ENTREZGENE
PANTHER	GUANINE NUCLEOTIDE-BINDING PROTEIN SUBUNIT ALPHA-11	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR10218	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	G-alpha	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Gna11	PhenoGen
PRINTS	GPROTEINA	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GPROTEINAQ	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	G_ALPHA	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SMART	G_alpha	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF47895	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SSF52540	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I6G6A0_RAT	UniProtKB/TrEMBL
	G3V6Q6	ENTREZGENE, UniProtKB/TrEMBL
	GNA11_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2017-03-07	Gna11	G protein subunit alpha 11	Gna11	guanine nucleotide binding protein, alpha 11	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-20	Gna11	guanine nucleotide binding protein, alpha 11		guanine nucleotide-binding protein alpha 11 subunit	Name updated	1299863	APPROVED
2002-08-07	Gna11	guanine nucleotide-binding protein alpha 11 subunit			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_protein	expression decreased by chronic ethanol feeding	708317

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)