Symbol:
Kras
Name:
Kirsten rat sarcoma viral oncogene homolog
RGD ID:
1550157
MGI Page
MGI
Description:
Enables GTPase activity and protein-membrane adaptor activity. Acts upstream of or within several processes, including Ras protein signal transduction; forebrain astrocyte development; and modulation of chemical synaptic transmission. Located in membrane. Is expressed in several structures, including alimentary system; brain; eye; genitourinary system; and limb. Used to study several diseases, including Noonan syndrome 3; arteriovenous malformations of the brain; gastrointestinal system cancer (multiple); pancreatic carcinoma (multiple); and reproductive organ cancer (multiple). Human ortholog(s) of this gene implicated in several diseases, including Noonan syndrome (multiple); cardiofaciocutaneous syndrome (multiple); gastrointestinal system cancer (multiple); hematologic cancer (multiple); and lung cancer (multiple). Orthologous to human KRAS (KRAS proto-oncogene, GTPase).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
AI929937; c-K-ras; c-Ki-ras; GTPase KRas; K-; K-ras; K-Ras 2; Ki; Ki-ras; Kirsten rat sarcoma oncogene 2, expressed; Kr; Kra; Kras-2; Kras2; MGC7141; p21 protein; p21B; ras; v-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
KRAS (KRAS proto-oncogene, GTPase)
HGNC
Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Kras (KRAS proto-oncogene, GTPase)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Kras (KRAS proto-oncogene, GTPase)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
KRAS (KRAS proto-oncogene, GTPase)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
KRAS (KRAS proto-oncogene, GTPase)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Kras (KRAS proto-oncogene, GTPase)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
KRAS (KRAS proto-oncogene, GTPase)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
KRAS (KRAS proto-oncogene, GTPase)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Kras (KRAS proto-oncogene, GTPase)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Kras (KRAS proto-oncogene, GTPase)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
KRAS (KRAS proto-oncogene, GTPase)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
kras (v-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Ras85D
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
let-60
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
krasl
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 6 145,162,425 - 145,197,631 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 6 145,162,425 - 145,195,965 (-) Ensembl GRCm39 Ensembl GRCm38 6 145,216,699 - 145,250,420 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 6 145,216,699 - 145,250,239 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 6 145,165,219 - 145,198,751 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 6 145,173,866 - 145,207,390 (-) NCBI MGSCv36 mm8 Celera 6 148,290,985 - 148,324,546 (-) NCBI Celera Cytogenetic Map 6 G3 NCBI cM Map 6 77.37 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Kras Mouse (S)-colchicine multiple interactions EXP 6480464 Colchicine inhibits the reaction [Carbon Tetrachloride results in increased expression of KRAS protein] CTD PMID:38348705 Kras Mouse (S)-naringenin multiple interactions ISO KRAS (Homo sapiens) 6480464 [naringenin metabolite co-treated with bisphenol A] results in increased expression of KRAS mRNA CTD PMID:36235125 Kras Mouse (trichloromethyl)benzene increases mutagenesis EXP 6480464 benzotrichloride results in increased mutagenesis of KRAS gene CTD PMID:8508514 Kras Mouse 1,1-dichloroethene increases expression EXP 6480464 vinylidene chloride results in increased expression of KRAS mRNA CTD PMID:26682919 Kras Mouse 1,2-dimethylhydrazine affects expression EXP 6480464 1 and 2-Dimethylhydrazine affects the expression of KRAS mRNA CTD PMID:22206623 Kras Mouse 1,2-dimethylhydrazine multiple interactions EXP 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of KRAS mRNA CTD PMID:22206623 Kras Mouse 1-nitropyrene increases mutagenesis EXP 6480464 1-nitropyrene results in increased mutagenesis of KRAS gene CTD PMID:10396879 more ... Kras Mouse 1-nitropyrene multiple interactions EXP 6480464 [1-nitropyrene co-treated with KC 400] results in increased mutagenesis of KRAS gene more ... CTD PMID:10396879 more ... Kras Mouse 17alpha-ethynylestradiol multiple interactions EXP 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of KRAS mRNA CTD PMID:17942748 Kras Mouse 17alpha-ethynylestradiol increases expression ISO Kras (Rattus norvegicus) 6480464 Ethinyl Estradiol results in increased expression of KRAS mRNA CTD PMID:29097150 Kras Mouse 17beta-estradiol decreases expression ISO KRAS (Homo sapiens) 6480464 Estradiol results in decreased expression of KRAS mRNA CTD PMID:16474171 Kras Mouse 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of KRAS mRNA CTD PMID:39298647 Kras Mouse 17beta-estradiol increases expression ISO KRAS (Homo sapiens) 6480464 Estradiol results in increased expression of KRAS mRNA CTD PMID:23094148 Kras Mouse 2,2-Bis(bromomethyl)propane-1,3-diol increases mutagenesis EXP 6480464 2 more ... CTD PMID:14713543 Kras Mouse 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO KRAS (Homo sapiens) 6480464 Cycloheximide inhibits the reaction [Tetrachlorodibenzodioxin results in increased expression of KRAS mRNA] CTD PMID:11007951 Kras Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Kras (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of KRAS mRNA CTD PMID:33387578 Kras Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Kras (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in increased expression of KRAS mRNA CTD PMID:32109520 Kras Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of KRAS mRNA CTD PMID:21570461 Kras Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO KRAS (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of KRAS mRNA CTD PMID:11007951 more ... Kras Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO KRAS (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the expression of KRAS mRNA CTD PMID:22298810 Kras Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of KRAS mRNA CTD PMID:14708085 Kras Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of KRAS mRNA CTD PMID:19465110 Kras Mouse 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of KRAS mRNA more ... CTD PMID:11884234 more ... Kras Mouse 2,4-dinitrotoluene affects expression ISO Kras (Rattus norvegicus) 6480464 2 and 4-dinitrotoluene affects the expression of KRAS mRNA CTD PMID:21346803 Kras Mouse 2,6-di-tert-butyl-4-methylphenol increases mutagenesis EXP 6480464 Butylated Hydroxytoluene results in increased mutagenesis of KRAS gene CTD PMID:20101149 Kras Mouse 2,6-dimethoxyphenol multiple interactions ISO KRAS (Homo sapiens) 6480464 [Sodium Chloride co-treated with pyrogallol 1 and 3-dimethyl ether] results in increased expression of and affects the localization of KRAS protein CTD PMID:38598786 Kras Mouse 2-trans,6-trans-farnesyl diphosphate multiple interactions ISO Kras (Rattus norvegicus) 6480464 [FNTA protein binds to FNTB protein] binds to [farnesyl pyrophosphate analog co-treated with KRAS protein] CTD PMID:10673434 Kras Mouse 3-methyl-3H-imidazo[4,5-f]quinolin-2-amine increases mutagenesis ISO Kras (Rattus norvegicus) 6480464 2-amino-3-methylimidazo(4 and 5-f)quinoline results in increased mutagenesis of KRAS gene CTD PMID:8844820 Kras Mouse 3-methylcholanthrene multiple interactions EXP 6480464 Methylcholanthrene promotes the reaction [GATA6 protein binds to KRAS exon] and Methylcholanthrene promotes the reaction [NFYA protein binds to KRAS exon] CTD PMID:16271038 Kras Mouse 3-methylcholanthrene increases mutagenesis EXP 6480464 Methylcholanthrene results in increased mutagenesis of KRAS gene CTD PMID:11195466 and PMID:20101149 Kras Mouse 4,4'-sulfonyldiphenol increases expression EXP 6480464 bisphenol S results in increased expression of KRAS mRNA CTD PMID:39298647 Kras Mouse 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one increases mutagenesis ISO Kras (Rattus norvegicus) 6480464 4-(N-methyl-N-nitrosamino)-1-(3-pyridyl)-1-butanone results in increased mutagenesis of KRAS gene CTD PMID:18271921 Kras Mouse 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one multiple interactions EXP 6480464 [Lipopolysaccharides co-treated with 4-(N-methyl-N-nitrosamino)-1-(3-pyridyl)-1-butanone] results in increased mutagenesis of KRAS gene CTD PMID:21868532 Kras Mouse 4-nitrophenol decreases expression EXP 6480464 4-nitrophenol results in decreased expression of KRAS mRNA CTD PMID:34673133 Kras Mouse 4-vinylcyclohexene dioxide affects expression EXP 6480464 4-vinyl-1-cyclohexene dioxide affects the expression of KRAS mRNA CTD PMID:20829426 Kras Mouse 5-aza-2'-deoxycytidine multiple interactions ISO KRAS (Homo sapiens) 6480464 Decitabine inhibits the reaction [arsenite results in increased expression of KRAS protein] CTD PMID:24704393 Kras Mouse 5-fluorouracil decreases expression ISO KRAS (Homo sapiens) 6480464 Fluorouracil results in decreased expression of KRAS protein CTD PMID:15585135 and PMID:16803524 Kras Mouse 5-fluorouracil increases expression ISO KRAS (Homo sapiens) 6480464 Fluorouracil results in increased expression of KRAS mRNA mutant form CTD PMID:38423379 Kras Mouse 5-Methylchrysene increases mutagenesis EXP 6480464 5-methylchrysene results in increased mutagenesis of KRAS gene CTD PMID:8571376 and PMID:9659573 Kras Mouse acrolein decreases expression ISO KRAS (Homo sapiens) 6480464 Acrolein results in decreased expression of KRAS protein CTD PMID:24812010 Kras Mouse actinomycin D multiple interactions ISO KRAS (Homo sapiens) 6480464 Dactinomycin inhibits the reaction [[KRAS protein mutant form affects the susceptibility to vemurafenib] which results in increased expression of TNFRSF10B mRNA] CTD PMID:27222248 Kras Mouse afimoxifene affects response to substance ISO KRAS (Homo sapiens) 6480464 KRAS gene affects the susceptibility to afimoxifene CTD PMID:21482774 Kras Mouse ammonium chloride affects expression ISO Kras (Rattus norvegicus) 6480464 Ammonium Chloride affects the expression of KRAS mRNA CTD PMID:16483693 Kras Mouse amphetamine increases expression ISO Kras (Rattus norvegicus) 6480464 Amphetamine results in increased expression of KRAS mRNA CTD PMID:30779732 Kras Mouse antirheumatic drug decreases expression ISO KRAS (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of KRAS mRNA CTD PMID:24449571 Kras Mouse Antrocin decreases expression ISO KRAS (Homo sapiens) 6480464 antrocin analog results in decreased expression of KRAS protein CTD PMID:36565974 Kras Mouse aristolochic acid A increases mutagenesis ISO Kras (Rattus norvegicus) 6480464 aristolochic acid I results in increased mutagenesis of KRAS gene CTD PMID:21642617 Kras Mouse aristolochic acid A decreases expression ISO KRAS (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of KRAS mRNA CTD PMID:33212167 Kras Mouse Aroclor 1254 decreases expression EXP 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of KRAS mRNA and Chlorodiphenyl (54% Chlorine) results in decreased expression of KRAS protein CTD PMID:23650126 Kras Mouse Aroclor 1254 affects localization EXP 6480464 Chlorodiphenyl (54% Chlorine) affects the localization of KRAS protein CTD PMID:9525281 Kras Mouse ARS-1620 affects binding ISO KRAS (Homo sapiens) 6480464 ARS-1620 binds to KRAS protein mutant form CTD PMID:31666701 Kras Mouse arsane multiple interactions ISO KRAS (Homo sapiens) 6480464 KRAS affects the reaction [Arsenic results in increased phosphorylation of MAPK1 protein] more ... CTD PMID:25273566 Kras Mouse arsane increases mutagenesis ISO KRAS (Homo sapiens) 6480464 Arsenic results in increased mutagenesis of KRAS gene CTD PMID:32344290 Kras Mouse arsane affects response to substance ISO KRAS (Homo sapiens) 6480464 KRAS affects the susceptibility to Arsenic CTD PMID:25273566 Kras Mouse arsenic atom multiple interactions ISO KRAS (Homo sapiens) 6480464 KRAS affects the reaction [Arsenic results in increased phosphorylation of MAPK1 protein] more ... CTD PMID:25273566 Kras Mouse arsenic atom increases mutagenesis ISO KRAS (Homo sapiens) 6480464 Arsenic results in increased mutagenesis of KRAS gene CTD PMID:32344290 Kras Mouse arsenic atom affects response to substance ISO KRAS (Homo sapiens) 6480464 KRAS affects the susceptibility to Arsenic CTD PMID:25273566 Kras Mouse arsenite(3-) multiple interactions ISO KRAS (Homo sapiens) 6480464 decitabine inhibits the reaction [arsenite results in increased expression of KRAS protein] and MIRLET7C mRNA inhibits the reaction [arsenite results in increased expression of KRAS protein] CTD PMID:24704393 Kras Mouse arsenite(3-) increases mutagenesis ISO KRAS (Homo sapiens) 6480464 arsenite results in increased mutagenesis of KRAS gene mutant form CTD PMID:31009485 Kras Mouse arsenite(3-) increases expression ISO KRAS (Homo sapiens) 6480464 arsenite results in increased expression of KRAS protein CTD PMID:24704393 Kras Mouse asbestos increases mutagenesis ISO KRAS (Homo sapiens) 6480464 Asbestos results in increased mutagenesis of KRAS gene CTD PMID:12725029 Kras Mouse Azoxymethane multiple interactions ISO Kras (Rattus norvegicus) 6480464 Ursodeoxycholic Acid inhibits the reaction [Azoxymethane results in increased mutagenesis of KRAS gene] CTD PMID:12839936 Kras Mouse Azoxymethane increases mutagenesis ISO Kras (Rattus norvegicus) 6480464 Azoxymethane results in increased mutagenesis of KRAS gene CTD PMID:12839936 and PMID:21370285 Kras Mouse Azoxymethane multiple interactions EXP 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of KRAS mRNA CTD PMID:29950665 Kras Mouse Benz[j]aceanthrylene increases mutagenesis EXP 6480464 benz(j)aceanthrylene results in increased mutagenesis of KRAS gene CTD PMID:9659573 Kras Mouse benzene increases response to substance EXP 6480464 KRAS gene polymorphism results in increased susceptibility to Benzene CTD PMID:12807761 Kras Mouse benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of KRAS mRNA CTD PMID:22228805 Kras Mouse benzo[a]pyrene affects methylation ISO KRAS (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of KRAS promoter CTD PMID:27901495 Kras Mouse benzo[a]pyrene increases mutagenesis EXP 6480464 Benzo(a)pyrene results in increased mutagenesis of KRAS gene CTD PMID:19658153 more ... Kras Mouse benzo[a]pyrene diol epoxide I increases expression ISO KRAS (Homo sapiens) 6480464 7 more ... CTD PMID:18567617 Kras Mouse benzo[a]pyrene diol epoxide I decreases expression ISO KRAS (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 and PMID:20018196 Kras Mouse benzo[b]fluoranthene increases mutagenesis EXP 6480464 benzo(b)fluoranthene results in increased mutagenesis of KRAS gene CTD PMID:8571376 and PMID:9659573 Kras Mouse bisphenol A decreases expression ISO KRAS (Homo sapiens) 6480464 bisphenol A results in decreased expression of KRAS mRNA CTD PMID:16474171 Kras Mouse bisphenol A increases expression ISO KRAS (Homo sapiens) 6480464 bisphenol A results in increased expression of KRAS mRNA CTD PMID:36982678 Kras Mouse bisphenol A multiple interactions ISO KRAS (Homo sapiens) 6480464 [bisphenol A co-treated with Quercetin metabolite] results in increased expression of KRAS mRNA more ... CTD PMID:36235125 and PMID:36982678 Kras Mouse bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of KRAS mRNA CTD PMID:33221593 Kras Mouse bisphenol A increases expression ISO Kras (Rattus norvegicus) 6480464 bisphenol A results in increased expression of KRAS mRNA CTD PMID:29097150 Kras Mouse bisphenol A increases methylation ISO Kras (Rattus norvegicus) 6480464 bisphenol A results in increased methylation of KRAS gene CTD PMID:28505145 Kras Mouse bisphenol A affects expression ISO Kras (Rattus norvegicus) 6480464 bisphenol A affects the expression of KRAS mRNA CTD PMID:25181051 Kras Mouse bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of KRAS mRNA CTD PMID:26063408 Kras Mouse bisphenol A increases mutagenesis ISO KRAS (Homo sapiens) 6480464 bisphenol A results in increased mutagenesis of KRAS gene CTD PMID:11342245 Kras Mouse bleomycin A2 multiple interactions EXP 6480464 [Bleomycin co-treated with 1-nitropyrene] results in increased mutagenesis of KRAS gene CTD PMID:12616606 Kras Mouse buta-1,3-diene increases mutagenesis EXP 6480464 1 and 3-butadiene results in increased mutagenesis of KRAS gene CTD PMID:11397402 Kras Mouse cadmium atom increases expression ISO KRAS (Homo sapiens) 6480464 Cadmium results in increased expression of KRAS mRNA and Cadmium results in increased expression of KRAS protein CTD PMID:20049202 Kras Mouse cadmium atom decreases expression ISO KRAS (Homo sapiens) 6480464 Cadmium results in decreased expression of KRAS mRNA CTD PMID:21120746 Kras Mouse cadmium dichloride decreases expression ISO Kras (Rattus norvegicus) 6480464 Cadmium Chloride results in decreased expression of KRAS mRNA CTD PMID:33453195 Kras Mouse cadmium dichloride multiple interactions ISO KRAS (Homo sapiens) 6480464 KRAS protein inhibits the reaction [Cadmium Chloride results in decreased expression of MIR155 mRNA] more ... CTD PMID:27510461 Kras Mouse cadmium dichloride increases expression ISO KRAS (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of KRAS mRNA and Cadmium Chloride results in increased expression of KRAS protein CTD PMID:23811327 more ... Kras Mouse cannabidiol decreases expression ISO Kras (Rattus norvegicus) 6480464 Cannabidiol results in decreased expression of KRAS mRNA CTD PMID:32553926 Kras Mouse cannabidiol multiple interactions ISO KRAS (Homo sapiens) 6480464 [Oxygen co-treated with Ozone co-treated with Cannabidiol] results in decreased expression of KRAS mRNA CTD PMID:32992648 Kras Mouse carbamazepine affects expression ISO KRAS (Homo sapiens) 6480464 Carbamazepine affects the expression of KRAS mRNA CTD PMID:24752500 Kras Mouse carbon nanotube increases mutagenesis EXP 6480464 Nanotubes and Carbon results in increased mutagenesis of KRAS gene CTD PMID:24213921 Kras Mouse ceruletide multiple interactions EXP 6480464 (+)-JQ1 compound inhibits the reaction [[KRAS protein mutant form co-treated with Ceruletide] results in increased expression of BRD4 protein] more ... CTD PMID:26390243 Kras Mouse CGP 52608 multiple interactions ISO KRAS (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to KRAS gene] CTD PMID:28238834 Kras Mouse chloroethene multiple interactions ISO KRAS (Homo sapiens) 6480464 CYP2E1 gene polymorphism promotes the reaction [Vinyl Chloride affects the mutagenesis of KRAS gene] more ... CTD PMID:12705718 more ... Kras Mouse chloroethene increases mutagenesis ISO KRAS (Homo sapiens) 6480464 Vinyl Chloride results in increased mutagenesis of KRAS gene CTD PMID:10629081 more ... Kras Mouse chloroethene increases response to substance EXP 6480464 KRAS gene polymorphism results in increased susceptibility to Vinyl Chloride CTD PMID:12807761 Kras Mouse chloroprene increases mutagenesis EXP 6480464 Chloroprene results in increased mutagenesis of KRAS gene CTD PMID:10223196 and PMID:11397402 Kras Mouse chlorpyrifos decreases expression ISO Kras (Rattus norvegicus) 6480464 Chlorpyrifos results in decreased expression of KRAS mRNA CTD PMID:18668222 Kras Mouse chymostatin multiple interactions ISO KRAS (Homo sapiens) 6480464 chymostatin inhibits the reaction [KRAS protein mutant form results in increased expression of AGT protein] more ... CTD PMID:33380422 Kras Mouse cisplatin multiple interactions ISO KRAS (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of KRAS mRNA CTD PMID:27392435 Kras Mouse cisplatin decreases expression ISO KRAS (Homo sapiens) 6480464 Cisplatin results in decreased expression of KRAS mRNA CTD PMID:27392435 Kras Mouse clofibrate increases expression EXP 6480464 Clofibrate results in increased expression of KRAS mRNA CTD PMID:23811191 Kras Mouse cobalt atom increases mutagenesis EXP 6480464 Cobalt results in increased mutagenesis of KRAS gene CTD PMID:34468815 Kras Mouse cobalt atom increases mutagenesis ISO Kras (Rattus norvegicus) 6480464 Cobalt results in increased mutagenesis of KRAS gene CTD PMID:34468815 Kras Mouse cobimetinib increases response to substance ISO KRAS (Homo sapiens) 6480464 KRAS protein mutant form results in increased susceptibility to cobimetinib CTD PMID:22084396 Kras Mouse cobimetinib multiple interactions ISO KRAS (Homo sapiens) 6480464 2-(1H-indazol-4-yl)-6-(4-methanesulfonylpiperazin-1-ylmethyl)-4-morpholin-4-ylthieno(3 more ... CTD PMID:22084396 Kras Mouse copper atom increases expression ISO Kras (Rattus norvegicus) 6480464 Copper deficiency results in increased expression of KRAS mRNA and Copper results in increased expression of KRAS mRNA CTD PMID:17418555 and PMID:22465980 Kras Mouse copper atom multiple interactions ISO KRAS (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in increased expression of KRAS mRNA CTD PMID:30911355 Kras Mouse copper(0) increases expression ISO Kras (Rattus norvegicus) 6480464 Copper deficiency results in increased expression of KRAS mRNA and Copper results in increased expression of KRAS mRNA CTD PMID:17418555 and PMID:22465980 Kras Mouse copper(0) multiple interactions ISO KRAS (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in increased expression of KRAS mRNA CTD PMID:30911355 Kras Mouse coumestrol decreases expression ISO KRAS (Homo sapiens) 6480464 Coumestrol results in decreased expression of KRAS mRNA CTD PMID:19167446 Kras Mouse crizotinib decreases response to substance ISO KRAS (Homo sapiens) 6480464 KRAS protein mutant form results in decreased susceptibility to crizotinib CTD PMID:22235099 Kras Mouse cumene multiple interactions EXP 6480464 [cumene co-treated with KRAS gene mutant form] results in decreased expression of CCN1 mRNA more ... CTD PMID:18648096 Kras Mouse Cuprizon decreases expression ISO Kras (Rattus norvegicus) 6480464 Cuprizone results in decreased expression of KRAS mRNA CTD PMID:26577399 Kras Mouse curcumin decreases expression ISO KRAS (Homo sapiens) 6480464 Curcumin analog results in decreased expression of KRAS mRNA and Curcumin results in decreased expression of KRAS mRNA CTD PMID:17041101 Kras Mouse curcumin multiple interactions EXP 6480464 Curcumin affects the reaction [KRAS protein affects the localization of TRP53 protein] and Curcumin inhibits the reaction [KRAS protein results in decreased expression of XPO1 protein] CTD PMID:21519798 Kras Mouse cycloheximide multiple interactions ISO KRAS (Homo sapiens) 6480464 Cycloheximide inhibits the reaction [Tetrachlorodibenzodioxin results in increased expression of KRAS mRNA] CTD PMID:11007951 Kras Mouse Cyclopenta[cd]pyrene increases mutagenesis EXP 6480464 cyclopenta(c and d)pyrene results in increased mutagenesis of KRAS gene CTD PMID:9659573 Kras Mouse dabrafenib multiple interactions ISO KRAS (Homo sapiens) 6480464 [KRAS protein affects the susceptibility to dabrafenib] which affects the expression of TNFRSF10B protein more ... CTD PMID:27222248 Kras Mouse dabrafenib affects response to substance ISO KRAS (Homo sapiens) 6480464 KRAS protein affects the susceptibility to dabrafenib CTD PMID:27222248 Kras Mouse dextran sulfate decreases expression EXP 6480464 Dextran Sulfate results in decreased expression of KRAS protein CTD PMID:32272095 Kras Mouse dextran sulfate multiple interactions EXP 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of KRAS mRNA and Erianin inhibits the reaction [Dextran Sulfate results in decreased expression of KRAS protein] CTD PMID:29950665 and PMID:32272095 Kras Mouse dibenzo[a,l]pyrene increases mutagenesis EXP 6480464 dibenzo(a and l)pyrene results in increased mutagenesis of KRAS gene CTD PMID:9659573 Kras Mouse Dibutyl phosphate affects expression ISO KRAS (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of KRAS mRNA CTD PMID:37042841 Kras Mouse dichlorine multiple interactions ISO Kras (Rattus norvegicus) 6480464 [Ozone co-treated with Chlorine] results in decreased expression of KRAS mRNA CTD PMID:18636392 Kras Mouse diclofenac affects expression ISO KRAS (Homo sapiens) 6480464 Diclofenac affects the expression of KRAS mRNA CTD PMID:24752500 Kras Mouse dioxygen multiple interactions ISO KRAS (Homo sapiens) 6480464 [Oxygen co-treated with Ozone co-treated with Cannabidiol] results in decreased expression of KRAS mRNA and [Oxygen co-treated with Ozone] results in decreased expression of KRAS mRNA CTD PMID:32992648 Kras Mouse dorsomorphin multiple interactions ISO KRAS (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Kras Mouse doxorubicin decreases expression ISO KRAS (Homo sapiens) 6480464 Doxorubicin results in decreased expression of KRAS mRNA CTD PMID:29803840 Kras Mouse doxorubicin increases expression ISO KRAS (Homo sapiens) 6480464 Doxorubicin results in increased expression of KRAS mRNA mutant form and Doxorubicin results in increased expression of KRAS protein mutant form CTD PMID:38423379 Kras Mouse emamectin benzoate decreases expression ISO KRAS (Homo sapiens) 6480464 emamectin benzoate results in decreased expression of KRAS mRNA CTD PMID:38901726 Kras Mouse erlotinib hydrochloride increases response to substance ISO KRAS (Homo sapiens) 6480464 KRAS protein results in increased susceptibility to Erlotinib Hydrochloride CTD PMID:20705357 Kras Mouse ethanol affects splicing EXP 6480464 Ethanol affects the splicing of KRAS mRNA CTD PMID:30319688 Kras Mouse farnesyl diphosphate multiple interactions ISO Kras (Rattus norvegicus) 6480464 [FNTA protein binds to FNTB protein] binds to [farnesyl pyrophosphate analog co-treated with KRAS protein] CTD PMID:10673434 Kras Mouse flutamide increases expression ISO Kras (Rattus norvegicus) 6480464 Flutamide results in increased expression of KRAS mRNA CTD PMID:24136188 Kras Mouse folic acid increases expression EXP 6480464 Folic Acid results in increased expression of KRAS mRNA CTD PMID:2566606 Kras Mouse folic acid multiple interactions EXP 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of KRAS mRNA CTD PMID:22206623 Kras Mouse folic acid decreases expression EXP 6480464 Folic Acid results in decreased expression of KRAS mRNA CTD PMID:25629700 Kras Mouse furfural multiple interactions ISO KRAS (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of and affects the localization of KRAS protein CTD PMID:38598786 Kras Mouse GDP multiple interactions ISO KRAS (Homo sapiens) 6480464 KRAS protein mutant form inhibits the reaction [SOS1 protein inhibits the reaction [Guanosine Diphosphate binds to KRAS protein]] and SOS1 protein inhibits the reaction [Guanosine Diphosphate binds to KRAS protein] CTD PMID:28154176 Kras Mouse GDP affects binding ISO KRAS (Homo sapiens) 6480464 Guanosine Diphosphate binds to KRAS protein and Guanosine Diphosphate binds to KRAS protein mutant form CTD PMID:28154176 Kras Mouse gefitinib affects response to substance ISO KRAS (Homo sapiens) 6480464 KRAS protein mutant form affects the susceptibility to gefitinib CTD PMID:17270025 Kras Mouse gefitinib decreases response to substance ISO KRAS (Homo sapiens) 6480464 KRAS protein results in decreased susceptibility to gefitinib CTD PMID:28739874 Kras Mouse gefitinib multiple interactions ISO KRAS (Homo sapiens) 6480464 KRAS protein affects the reaction [EGFR protein affects the susceptibility to gefitinib] CTD PMID:28739874 Kras Mouse genistein decreases expression ISO KRAS (Homo sapiens) 6480464 Genistein results in decreased expression of KRAS mRNA CTD PMID:15256057 and PMID:16474171 Kras Mouse gentamycin increases expression ISO Kras (Rattus norvegicus) 6480464 Gentamicins results in increased expression of KRAS mRNA CTD PMID:22061828 Kras Mouse geraniol multiple interactions ISO Kras (Rattus norvegicus) 6480464 geraniol inhibits the reaction [Methylnitronitrosoguanidine results in increased expression of KRAS mRNA] CTD PMID:28428697 Kras Mouse GTP affects binding ISO KRAS (Homo sapiens) 6480464 Guanosine Triphosphate binds to KRAS protein and Guanosine Triphosphate binds to KRAS protein mutant form CTD PMID:28154176 Kras Mouse GTP increases hydrolysis ISO KRAS (Homo sapiens) 6480464 KRAS protein mutant form results in increased hydrolysis of Guanosine Triphosphate and KRAS protein results in increased hydrolysis of Guanosine Triphosphate CTD PMID:28154176 Kras Mouse GTP multiple interactions ISO KRAS (Homo sapiens) 6480464 KRAS protein mutant form inhibits the reaction [RASA1 protein promotes the reaction [KRAS protein results in increased hydrolysis of Guanosine Triphosphate]] and RASA1 protein promotes the reaction [KRAS protein results in increased hydrolysis of Guanosine Triphosphate] CTD PMID:28154176 Kras Mouse guanosine multiple interactions ISO KRAS (Homo sapiens) 6480464 Guanosine inhibits the reaction [tiazofurin results in decreased expression of KRAS] CTD PMID:9381980 Kras Mouse haloperidol increases expression ISO Kras (Rattus norvegicus) 6480464 Haloperidol results in increased expression of KRAS mRNA CTD PMID:15860345 Kras Mouse hydrogen peroxide multiple interactions EXP 158013773 melatonin inhibits the reaction [hydrogen peroxide increases expression of Kras protein in C-kit+ cardiac progenitor cells] RGD Kras Mouse hydrogen peroxide increases expression EXP 158013773 hydrogen peroxide increases expression of Kras protein in C-kit+ cardiac progenitor cells RGD Kras Mouse hydroquinone multiple interactions ISO KRAS (Homo sapiens) 6480464 [PARP1 protein affects the susceptibility to hydroquinone] which affects the expression of KRAS protein CTD PMID:28444915 Kras Mouse hydroquinone increases expression ISO KRAS (Homo sapiens) 6480464 hydroquinone results in increased expression of KRAS protein CTD PMID:27515134 Kras Mouse hydroquinone affects expression ISO KRAS (Homo sapiens) 6480464 hydroquinone affects the expression of KRAS mRNA CTD PMID:27515134 Kras Mouse hydroxyurea decreases expression EXP 6480464 Hydroxyurea results in decreased expression of KRAS mRNA CTD PMID:12929121 Kras Mouse ionomycin multiple interactions ISO KRAS (Homo sapiens) 6480464 Methohexital inhibits the reaction [[Tetradecanoylphorbol Acetate co-treated with Ionomycin] results in increased activity of KRAS protein] more ... CTD PMID:15263067 Kras Mouse irbesartan multiple interactions EXP 6480464 Irbesartan inhibits the reaction [KRAS protein mutant form results in increased expression of CDKN2A protein] CTD PMID:33380422 Kras Mouse irbesartan multiple interactions ISO KRAS (Homo sapiens) 6480464 Irbesartan inhibits the reaction [KRAS protein mutant form results in increased expression of CDKN1A protein] CTD PMID:33380422 Kras Mouse isoprenaline increases expression EXP 6480464 Isoproterenol results in increased expression of KRAS mRNA CTD PMID:21335049 Kras Mouse isoprene increases mutagenesis EXP 6480464 isoprene results in increased mutagenesis of KRAS gene CTD PMID:11397402 and PMID:9111215 Kras Mouse isotretinoin decreases expression ISO KRAS (Homo sapiens) 6480464 Isotretinoin results in decreased expression of KRAS mRNA CTD PMID:20436886 Kras Mouse ivermectin decreases expression ISO KRAS (Homo sapiens) 6480464 Ivermectin results in decreased expression of KRAS protein CTD PMID:32959892 Kras Mouse kainic acid increases expression ISO Kras (Rattus norvegicus) 6480464 Kainic Acid results in increased expression of KRAS mRNA CTD PMID:19700661 Kras Mouse L-744832 multiple interactions ISO KRAS (Homo sapiens) 6480464 [GGTI 2147 co-treated with L 744832] results in decreased prenylation of KRAS protein CTD PMID:16156861 Kras Mouse lapatinib multiple interactions ISO KRAS (Homo sapiens) 6480464 KRAS protein affects the reaction [EGFR protein affects the susceptibility to lapatinib] CTD PMID:28739874 Kras Mouse lapatinib decreases response to substance ISO KRAS (Homo sapiens) 6480464 KRAS protein results in decreased susceptibility to lapatinib CTD PMID:28739874 Kras Mouse lead diacetate increases expression EXP 6480464 lead acetate results in increased expression of KRAS mRNA CTD PMID:25270620 Kras Mouse lead diacetate multiple interactions ISO KRAS (Homo sapiens) 6480464 [lead acetate co-treated with zinc protoporphyrin] results in decreased expression of KRAS mRNA CTD PMID:22839698 Kras Mouse lead diacetate decreases expression EXP 6480464 lead acetate results in decreased expression of KRAS mRNA CTD PMID:21829687 Kras Mouse lead(0) increases expression EXP 6480464 Lead results in increased expression of KRAS protein CTD PMID:19727529 Kras Mouse lipopolysaccharide multiple interactions EXP 6480464 [Lipopolysaccharides co-treated with 4-(N-methyl-N-nitrosamino)-1-(3-pyridyl)-1-butanone] results in increased mutagenesis of KRAS gene CTD PMID:21868532 Kras Mouse lipopolysaccharide increases expression ISO KRAS (Homo sapiens) 6480464 Lipopolysaccharides results in increased expression of KRAS mRNA CTD PMID:35953652 Kras Mouse losartan multiple interactions ISO KRAS (Homo sapiens) 6480464 Losartan inhibits the reaction [KRAS protein mutant form results in increased expression of CDKN1A protein] and Losartan inhibits the reaction [KRAS protein mutant form results in increased expression of CDKN2A protein] CTD PMID:33380422 Kras Mouse lovastatin decreases prenylation ISO KRAS (Homo sapiens) 6480464 Lovastatin results in decreased prenylation of KRAS protein CTD PMID:16156861 Kras Mouse lovastatin increases expression EXP 6480464 Lovastatin results in increased expression of KRAS protein CTD PMID:12907238 Kras Mouse lovastatin affects localization EXP 6480464 Lovastatin affects the localization of KRAS protein CTD PMID:12106604 Kras Mouse lovastatin increases activity EXP 6480464 Lovastatin results in increased activity of KRAS protein CTD PMID:17005160 Kras Mouse luzindole multiple interactions EXP 158013773 luzindole inhibits the reaction [melatonin inhibits the reaction [hydrogen peroxide increases expression of Kras protein in C-kit+ cardiac progenitor cells]] RGD Kras Mouse manumycin A multiple interactions ISO KRAS (Homo sapiens) 6480464 Acetylcysteine inhibits the reaction [manumycin results in decreased activity of KRAS protein] CTD PMID:19409983 Kras Mouse manumycin A decreases activity ISO KRAS (Homo sapiens) 6480464 manumycin results in decreased activity of KRAS protein CTD PMID:19409983 Kras Mouse MeIQx increases mutagenesis ISO Kras (Rattus norvegicus) 6480464 2-amino-3 more ... CTD PMID:18271921 Kras Mouse mercury dibromide decreases expression ISO KRAS (Homo sapiens) 6480464 mercuric bromide results in decreased expression of KRAS mRNA CTD PMID:26272509 Kras Mouse mercury dibromide multiple interactions ISO KRAS (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of KRAS mRNA CTD PMID:27188386 Kras Mouse metformin multiple interactions ISO KRAS (Homo sapiens) 6480464 [Paclitaxel co-treated with Metformin] results in decreased expression of KRAS mRNA CTD PMID:29309887 Kras Mouse methohexital multiple interactions ISO KRAS (Homo sapiens) 6480464 Methohexital inhibits the reaction [[Tetradecanoylphorbol Acetate co-treated with Ionomycin] results in increased activity of KRAS protein] CTD PMID:15263067 Kras Mouse methotrexate increases response to substance ISO KRAS (Homo sapiens) 6480464 KRAS gene mutant form results in increased susceptibility to Methotrexate CTD PMID:24688052 Kras Mouse methotrexate decreases expression ISO KRAS (Homo sapiens) 6480464 Methotrexate results in decreased expression of KRAS mRNA more ... CTD PMID:24688052 Kras Mouse metyrapone multiple interactions ISO Kras (Rattus norvegicus) 6480464 [[Air Pollutants results in increased abundance of Ozone] which co-treated with Metyrapone] results in increased expression of KRAS mRNA CTD PMID:37088303 Kras Mouse monosodium L-glutamate decreases expression ISO Kras (Rattus norvegicus) 6480464 Sodium Glutamate results in decreased expression of KRAS mRNA CTD PMID:20928830 Kras Mouse Morindone decreases expression ISO KRAS (Homo sapiens) 6480464 morindone results in decreased expression of KRAS mRNA mutant form CTD PMID:38423379 Kras Mouse Morindone increases expression ISO KRAS (Homo sapiens) 6480464 morindone results in increased expression of KRAS protein mutant form CTD PMID:38423379 Kras Mouse Morindone multiple interactions ISO KRAS (Homo sapiens) 6480464 [KRAS protein mutant form affects the susceptibility to morindone] which affects the expression of BRAF protein and [KRAS protein mutant form affects the susceptibility to morindone] which affects the expression of PIK3CA protein mutant form CTD PMID:38423379 Kras Mouse Morindone affects response to substance ISO KRAS (Homo sapiens) 6480464 KRAS protein mutant form affects the susceptibility to morindone CTD PMID:38423379 Kras Mouse N,N-bis(2-hydroxypropyl)nitrosamine increases mutagenesis ISO Kras (Rattus norvegicus) 6480464 diisopropanolnitrosamine results in increased mutagenesis of KRAS gene CTD PMID:18271921 Kras Mouse N-acetyl-L-cysteine multiple interactions ISO KRAS (Homo sapiens) 6480464 Acetylcysteine inhibits the reaction [manumycin results in decreased activity of KRAS protein] CTD PMID:19409983 Kras Mouse N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal increases expression ISO KRAS (Homo sapiens) 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in increased expression of KRAS mRNA CTD PMID:31806706 Kras Mouse N-ethyl-N-nitrosourea multiple interactions EXP 6480464 Ethylnitrosourea promotes the reaction [GATA6 protein binds to KRAS exon] and Ethylnitrosourea promotes the reaction [NFYA protein binds to KRAS exon] CTD PMID:16271038 Kras Mouse N-ethyl-N-nitrosourea increases mutagenesis EXP 6480464 Ethylnitrosourea results in increased mutagenesis of KRAS gene CTD PMID:15790496 Kras Mouse N-methyl-N'-nitro-N-nitrosoguanidine increases expression ISO Kras (Rattus norvegicus) 6480464 Methylnitronitrosoguanidine results in increased expression of KRAS mRNA CTD PMID:28428697 Kras Mouse N-methyl-N'-nitro-N-nitrosoguanidine multiple interactions ISO Kras (Rattus norvegicus) 6480464 geraniol inhibits the reaction [Methylnitronitrosoguanidine results in increased expression of KRAS mRNA] CTD PMID:28428697 Kras Mouse N-methyl-N-nitrosourea decreases response to substance ISO Kras (Rattus norvegicus) 6480464 KRAS protein results in decreased susceptibility to Methylnitrosourea CTD PMID:11973638 Kras Mouse N-methyl-N-nitrosourea increases mutagenesis EXP 6480464 Methylnitrosourea results in increased mutagenesis of KRAS gene CTD PMID:12483526 and PMID:18062963 Kras Mouse N-nitrosodiethylamine increases expression ISO Kras (Rattus norvegicus) 6480464 Diethylnitrosamine results in increased expression of KRAS mRNA CTD PMID:7910516 Kras Mouse N-nitrosodiethylamine increases expression EXP 6480464 Diethylnitrosamine results in increased expression of KRAS mRNA CTD PMID:26464624 Kras Mouse N-nitrosodimethylamine affects localization EXP 6480464 Dimethylnitrosamine affects the localization of KRAS protein CTD PMID:11884234 Kras Mouse N-nitrosodimethylamine multiple interactions EXP 6480464 Dimethylnitrosamine results in decreased expression of and affects the localization of KRAS protein more ... CTD PMID:11884234 and PMID:19555203 Kras Mouse nicotinic acid affects localization EXP 6480464 Niacin affects the localization of KRAS protein CTD PMID:12106604 Kras Mouse nitrates multiple interactions EXP 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of KRAS mRNA CTD PMID:35964746 Kras Mouse ochratoxin A decreases expression ISO KRAS (Homo sapiens) 6480464 ochratoxin A results in decreased expression of KRAS mRNA CTD PMID:30559759 Kras Mouse oncrasin-1 increases response to substance ISO KRAS (Homo sapiens) 6480464 KRAS protein mutant form results in increased susceptibility to oncrasin-1 CTD PMID:21443218 Kras Mouse oxirane increases mutagenesis EXP 6480464 Ethylene Oxide results in increased mutagenesis of KRAS gene CTD PMID:24029818 Kras Mouse oxybenzone increases expression ISO KRAS (Homo sapiens) 6480464 oxybenzone results in increased expression of KRAS mRNA CTD PMID:36581016 Kras Mouse ozone multiple interactions ISO Kras (Rattus norvegicus) 6480464 [[Air Pollutants results in increased abundance of Ozone] which co-treated with Metyrapone] results in increased expression of KRAS mRNA more ... CTD PMID:18636392 and PMID:37088303 Kras Mouse ozone multiple interactions ISO KRAS (Homo sapiens) 6480464 [Oxygen co-treated with Ozone co-treated with Cannabidiol] results in decreased expression of KRAS mRNA and [Oxygen co-treated with Ozone] results in decreased expression of KRAS mRNA CTD PMID:32992648 Kras Mouse ozone increases expression ISO Kras (Rattus norvegicus) 6480464 Ozone results in increased expression of KRAS mRNA CTD PMID:16330353 Kras Mouse p-chloromercuribenzoic acid decreases expression ISO KRAS (Homo sapiens) 6480464 p-Chloromercuribenzoic Acid results in decreased expression of KRAS mRNA CTD PMID:26272509 Kras Mouse p-chloromercuribenzoic acid multiple interactions ISO KRAS (Homo sapiens) 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of KRAS mRNA CTD PMID:27188386 Kras Mouse paclitaxel multiple interactions ISO KRAS (Homo sapiens) 6480464 [Paclitaxel co-treated with Metformin] results in decreased expression of KRAS mRNA CTD PMID:29309887 Kras Mouse paracetamol affects expression EXP 6480464 Acetaminophen affects the expression of KRAS mRNA CTD PMID:17562736 Kras Mouse PD 0325901 multiple interactions ISO KRAS (Homo sapiens) 6480464 KRAS protein affects the reaction [mirdametinib inhibits the reaction [NVP-BKM120 results in increased phosphorylation of MAPK1 protein]] more ... CTD PMID:24576621 Kras Mouse PD 0325901 multiple interactions EXP 6480464 [mirdametinib affects the susceptibility to KRAS protein] affects the reaction [NVP-BKM120 results in decreased expression of MKI67 protein] CTD PMID:24576621 Kras Mouse pemetrexed increases response to substance ISO KRAS (Homo sapiens) 6480464 KRAS gene mutant form results in increased susceptibility to Pemetrexed CTD PMID:24688052 Kras Mouse pemetrexed decreases expression ISO KRAS (Homo sapiens) 6480464 Pemetrexed results in decreased expression of KRAS mRNA more ... CTD PMID:24688052 Kras Mouse pentobarbital multiple interactions ISO KRAS (Homo sapiens) 6480464 Pentobarbital inhibits the reaction [[Tetradecanoylphorbol Acetate co-treated with Ionomycin] results in increased activity of KRAS protein] CTD PMID:15263067 Kras Mouse phlorizin decreases expression EXP 6480464 Phlorhizin results in decreased expression of KRAS mRNA CTD PMID:22538082 Kras Mouse phorbol 13-acetate 12-myristate multiple interactions ISO KRAS (Homo sapiens) 6480464 Methohexital inhibits the reaction [[Tetradecanoylphorbol Acetate co-treated with Ionomycin] results in increased activity of KRAS protein] more ... CTD PMID:15263067 Kras Mouse phorbol 13-acetate 12-myristate multiple interactions EXP 6480464 [sodium arsenite co-treated with Tetradecanoylphorbol Acetate] results in increased expression of KRAS mRNA and [sodium arsenite co-treated with Tetradecanoylphorbol Acetate] results in increased expression of KRAS protein CTD PMID:16368122 Kras Mouse picrotoxin decreases expression ISO Kras (Rattus norvegicus) 6480464 Picrotoxin results in decreased expression of KRAS mRNA CTD PMID:15170462 Kras Mouse piperonyl butoxide increases mutagenesis ISO KRAS (Homo sapiens) 6480464 Piperonyl Butoxide results in increased mutagenesis of KRAS gene CTD PMID:7565889 Kras Mouse pirinixic acid multiple interactions ISO KRAS (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in increased expression of KRAS mRNA CTD PMID:19710929 Kras Mouse quercetin multiple interactions ISO KRAS (Homo sapiens) 6480464 [bisphenol A co-treated with Quercetin metabolite] results in increased expression of KRAS mRNA more ... CTD PMID:19424582 and PMID:36982678 Kras Mouse quercetin increases expression ISO KRAS (Homo sapiens) 6480464 Quercetin metabolite results in increased expression of KRAS mRNA and Quercetin results in increased expression of KRAS mRNA CTD PMID:36982678 Kras Mouse quercetin decreases expression ISO KRAS (Homo sapiens) 6480464 Quercetin results in decreased expression of KRAS mRNA and Quercetin results in decreased expression of KRAS protein CTD PMID:10652438 and PMID:9381980 Kras Mouse Rebamipide increases expression ISO Kras (Rattus norvegicus) 6480464 rebamipide results in increased expression of KRAS mRNA CTD PMID:18299717 Kras Mouse resveratrol decreases expression ISO KRAS (Homo sapiens) 6480464 resveratrol results in decreased expression of KRAS mRNA and resveratrol results in decreased expression of KRAS protein CTD PMID:12002526 more ... Kras Mouse resveratrol multiple interactions ISO KRAS (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of KRAS mRNA CTD PMID:23557933 Kras Mouse resveratrol decreases expression EXP 6480464 resveratrol results in decreased expression of KRAS protein mutant form CTD PMID:25280562 Kras Mouse riddelliine increases mutagenesis EXP 6480464 riddelliine results in increased mutagenesis of KRAS gene CTD PMID:13678655 and PMID:20737008 Kras Mouse sarin decreases expression ISO Kras (Rattus norvegicus) 6480464 Sarin results in decreased expression of KRAS mRNA CTD PMID:16733813 Kras Mouse SB 431542 multiple interactions ISO KRAS (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Kras Mouse secobarbital multiple interactions ISO KRAS (Homo sapiens) 6480464 Secobarbital inhibits the reaction [[Tetradecanoylphorbol Acetate co-treated with Ionomycin] results in increased activity of KRAS protein] CTD PMID:15263067 Kras Mouse selumetinib multiple interactions ISO KRAS (Homo sapiens) 6480464 AZD 6244 inhibits the reaction [[KRAS protein mutant form affects the susceptibility to vemurafenib] promotes the reaction [TNFRSF10B protein results in increased cleavage of CASP3 protein]] more ... CTD PMID:27222248 Kras Mouse sevoflurane decreases expression ISO KRAS (Homo sapiens) 6480464 Sevoflurane results in decreased expression of KRAS mRNA CTD PMID:35953652 Kras Mouse simvastatin decreases prenylation ISO KRAS (Homo sapiens) 6480464 Simvastatin results in decreased prenylation of KRAS protein CTD PMID:8063617 Kras Mouse sodium arsenite increases expression ISO Kras (Rattus norvegicus) 6480464 sodium arsenite results in increased expression of KRAS mRNA CTD PMID:11241755 Kras Mouse sodium arsenite multiple interactions EXP 6480464 [sodium arsenite co-treated with Tetradecanoylphorbol Acetate] results in increased expression of KRAS mRNA and [sodium arsenite co-treated with Tetradecanoylphorbol Acetate] results in increased expression of KRAS protein CTD PMID:16368122 Kras Mouse sodium arsenite affects expression ISO KRAS (Homo sapiens) 6480464 sodium arsenite affects the expression of KRAS protein CTD PMID:17384772 Kras Mouse sodium arsenite affects expression EXP 6480464 sodium arsenite affects the expression of KRAS mRNA CTD PMID:16507464 Kras Mouse sodium arsenite increases expression ISO KRAS (Homo sapiens) 6480464 sodium arsenite results in increased expression of KRAS protein CTD PMID:24431212 and PMID:25804888 Kras Mouse sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of KRAS mRNA and sodium arsenite results in increased expression of KRAS protein CTD PMID:16014739 and PMID:16507464 Kras Mouse sodium chloride multiple interactions ISO KRAS (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of and affects the localization of KRAS protein more ... CTD PMID:38598786 Kras Mouse Soman increases expression ISO Kras (Rattus norvegicus) 6480464 Soman results in increased expression of KRAS mRNA CTD PMID:19281266 Kras Mouse sotorasib affects binding ISO KRAS (Homo sapiens) 6480464 sotorasib binds to KRAS protein mutant form CTD PMID:31666701 Kras Mouse sotorasib multiple interactions ISO KRAS (Homo sapiens) 6480464 KRAS protein affects the reaction [sotorasib results in decreased phosphorylation of MAPK1 protein] and KRAS protein affects the reaction [sotorasib results in decreased phosphorylation of MAPK3 protein] CTD PMID:31666701 Kras Mouse sotorasib increases response to substance ISO KRAS (Homo sapiens) 6480464 KRAS protein mutant form results in increased susceptibility to sotorasib CTD PMID:31666701 Kras Mouse styrene increases response to substance EXP 6480464 KRAS gene polymorphism results in increased susceptibility to Styrene CTD PMID:12807761 Kras Mouse sulfur dioxide increases expression ISO Kras (Rattus norvegicus) 6480464 Sulfur Dioxide results in increased expression of KRAS mRNA and Sulfur Dioxide results in increased expression of KRAS protein CTD PMID:19434695 Kras Mouse sulindac affects response to substance ISO KRAS (Homo sapiens) 6480464 KRAS protein affects the susceptibility to Sulindac CTD PMID:11751493 Kras Mouse sunitinib decreases expression ISO KRAS (Homo sapiens) 6480464 Sunitinib results in decreased expression of KRAS protein CTD PMID:39025287 Kras Mouse tacrolimus hydrate increases expression EXP 6480464 Tacrolimus results in increased expression of KRAS mRNA CTD PMID:25270620 Kras Mouse Tanshinone I decreases response to substance ISO KRAS (Homo sapiens) 6480464 KRAS mRNA results in decreased susceptibility to tanshinone CTD PMID:30506648 Kras Mouse Tanshinone I multiple interactions EXP 6480464 tanshinone inhibits the reaction [Carbon Tetrachloride results in increased expression of KRAS protein] CTD PMID:38348705 Kras Mouse Tanshinone I decreases expression ISO KRAS (Homo sapiens) 6480464 tanshinone results in decreased expression of KRAS mRNA and tanshinone results in decreased expression of KRAS protein CTD PMID:30506648 Kras Mouse Temsirolimus multiple interactions ISO KRAS (Homo sapiens) 6480464 KRAS protein mutant form inhibits the reaction [temsirolimus inhibits the reaction [CIP2A protein binds to MTOR protein]] more ... CTD PMID:24493623 Kras Mouse Temsirolimus decreases response to substance ISO KRAS (Homo sapiens) 6480464 KRAS protein mutant form results in decreased susceptibility to temsirolimus CTD PMID:24493623 Kras Mouse testosterone enanthate affects expression ISO KRAS (Homo sapiens) 6480464 testosterone enanthate affects the expression of KRAS mRNA CTD PMID:17440010 Kras Mouse tetrachloromethane affects expression EXP 6480464 Carbon Tetrachloride affects the expression of KRAS mRNA CTD PMID:17484886 Kras Mouse tetrachloromethane decreases expression ISO Kras (Rattus norvegicus) 6480464 Carbon Tetrachloride results in decreased expression of KRAS mRNA CTD PMID:33387578 Kras Mouse tetrachloromethane multiple interactions EXP 6480464 Colchicine inhibits the reaction [Carbon Tetrachloride results in increased expression of KRAS protein] and tanshinone inhibits the reaction [Carbon Tetrachloride results in increased expression of KRAS protein] CTD PMID:38348705 Kras Mouse tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of KRAS mRNA and Carbon Tetrachloride results in increased expression of KRAS protein CTD PMID:31919559 and PMID:38348705 Kras Mouse tetrachloromethane increases expression ISO Kras (Rattus norvegicus) 6480464 Carbon Tetrachloride results in increased expression of KRAS mRNA CTD PMID:31150632 and PMID:8847708 Kras Mouse Tetranitromethane increases mutagenesis EXP 6480464 Tetranitromethane results in increased mutagenesis of KRAS gene CTD PMID:14713543 Kras Mouse thiamylal multiple interactions ISO KRAS (Homo sapiens) 6480464 Thiamylal inhibits the reaction [[Tetradecanoylphorbol Acetate co-treated with Ionomycin] results in increased activity of KRAS protein] CTD PMID:15263067 Kras Mouse thimerosal decreases expression ISO KRAS (Homo sapiens) 6480464 Thimerosal results in decreased expression of KRAS mRNA CTD PMID:27188386 Kras Mouse thioacetamide increases expression ISO Kras (Rattus norvegicus) 6480464 Thioacetamide results in increased expression of KRAS mRNA CTD PMID:34492290 Kras Mouse tiazofurine decreases expression ISO KRAS (Homo sapiens) 6480464 tiazofurin results in decreased expression of KRAS CTD PMID:9381980 Kras Mouse tiazofurine multiple interactions ISO KRAS (Homo sapiens) 6480464 Guanosine inhibits the reaction [tiazofurin results in decreased expression of KRAS] CTD PMID:9381980 Kras Mouse tipifarnib increases expression ISO Kras (Rattus norvegicus) 6480464 tipifarnib results in increased expression of KRAS mRNA CTD PMID:16403772 Kras Mouse titanium dioxide decreases expression EXP 6480464 titanium dioxide results in decreased expression of KRAS mRNA CTD PMID:23557971 Kras Mouse titanium dioxide decreases methylation EXP 6480464 titanium dioxide results in decreased methylation of KRAS gene CTD PMID:35295148 Kras Mouse titanium dioxide multiple interactions EXP 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of KRAS mRNA CTD PMID:29950665 Kras Mouse titanium dioxide affects expression EXP 6480464 titanium dioxide affects the expression of KRAS mRNA CTD PMID:17656681 Kras Mouse toluene affects expression ISO Kras (Rattus norvegicus) 6480464 Toluene affects the expression of KRAS mRNA CTD PMID:21827849 Kras Mouse trimetrexate increases response to substance ISO KRAS (Homo sapiens) 6480464 KRAS gene mutant form results in increased susceptibility to Trimetrexate CTD PMID:24688052 Kras Mouse Triptolide increases expression ISO Kras (Rattus norvegicus) 6480464 triptolide results in increased expression of KRAS mRNA CTD PMID:23639586 Kras Mouse triptonide increases expression EXP 6480464 triptonide results in increased expression of KRAS mRNA CTD PMID:33045310 Kras Mouse urethane affects response to substance EXP 6480464 KRAS gene affects the susceptibility to Urethane CTD PMID:11807781 Kras Mouse urethane decreases expression ISO KRAS (Homo sapiens) 6480464 Urethane results in decreased expression of KRAS mRNA CTD PMID:28818685 Kras Mouse urethane increases mutagenesis EXP 6480464 Urethane results in increased mutagenesis of KRAS gene CTD PMID:10779650 Kras Mouse urethane increases mutagenesis ISO Kras (Rattus norvegicus) 6480464 Urethane results in increased mutagenesis of KRAS gene CTD PMID:18271921 Kras Mouse urethane decreases expression EXP 6480464 Urethane results in decreased expression of KRAS mRNA CTD PMID:16289808 Kras Mouse ursodeoxycholic acid multiple interactions ISO Kras (Rattus norvegicus) 6480464 Ursodeoxycholic Acid inhibits the reaction [Azoxymethane results in increased mutagenesis of KRAS gene] CTD PMID:12839936 Kras Mouse valproic acid increases expression ISO KRAS (Homo sapiens) 6480464 Valproic Acid results in increased expression of KRAS mRNA CTD PMID:28001369 Kras Mouse vemurafenib multiple interactions ISO KRAS (Homo sapiens) 6480464 [KRAS protein mutant form affects the susceptibility to vemurafenib] promotes the reaction [TNFRSF10B protein results in increased cleavage of CASP3 protein] more ... CTD PMID:27222248 Kras Mouse vemurafenib affects response to substance ISO KRAS (Homo sapiens) 6480464 KRAS protein mutant form affects the susceptibility to vemurafenib CTD PMID:27222248 Kras Mouse vinyl carbamate multiple interactions EXP 6480464 diallyl sulfone inhibits the reaction [vinyl carbamate results in increased mutagenesis of KRAS gene] CTD PMID:20205516 Kras Mouse vinyl carbamate increases mutagenesis EXP 6480464 vinyl carbamate results in increased mutagenesis of KRAS gene CTD PMID:20205516 Kras Mouse zearalenone increases expression EXP 6480464 Zearalenone results in increased expression of KRAS mRNA CTD PMID:29758222 Kras Mouse zearalenone decreases expression EXP 6480464 Zearalenone results in decreased expression of KRAS mRNA CTD PMID:30717214 Kras Mouse zidovudine increases mutagenesis EXP 6480464 Zidovudine results in increased mutagenesis of KRAS gene CTD PMID:18800350 Kras Mouse zinc protoporphyrin multiple interactions ISO KRAS (Homo sapiens) 6480464 [lead acetate co-treated with zinc protoporphyrin] results in decreased expression of KRAS mRNA CTD PMID:22839698 Kras Mouse zoledronic acid increases expression ISO KRAS (Homo sapiens) 6480464 zoledronic acid results in increased expression of KRAS protein CTD PMID:28871336
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
Kras Mouse abnormal astrocyte morphology IAGP 5509061 MGI PMID:18371380 Kras Mouse abnormal atrioventricular valve morphology IAGP 5509061 MGI PMID:17369402 Kras Mouse abnormal blood cell morphology/development IAGP 5509061 MGI PMID:20233966 Kras Mouse abnormal bone marrow cell physiology IAGP 5509061 MGI PMID:25359213 Kras Mouse abnormal brain development IAGP 5509061 MGI PMID:15093544 Kras Mouse abnormal brain development IAGP 5509061 MGI PMID:18371380 Kras Mouse abnormal brain vasculature morphology IAGP 5509061 MGI PMID:32552404 Kras Mouse abnormal branching involved in lung morphogenesis IAGP 5509061 MGI PMID:17369402 Kras Mouse abnormal bronchiole morphology IAGP 5509061 MGI PMID:19151761 Kras Mouse abnormal bronchiole morphology IAGP 5509061 MGI PMID:18493606 Kras Mouse abnormal bronchoalveolar duct junction morphology IAGP 5509061 MGI PMID:22411819 Kras Mouse abnormal bronchus epithelium morphology IAGP 5509061 MGI PMID:17369402 Kras Mouse abnormal bronchus morphology IAGP 5509061 MGI PMID:17369402 Kras Mouse abnormal bronchus morphology IAGP 5509061 MGI PMID:18493606 Kras Mouse abnormal cardiovascular system physiology IAGP 5509061 MGI PMID:17369402 Kras Mouse abnormal cell cycle IAGP 5509061 MGI PMID:20308544 Kras Mouse abnormal cell morphology IAGP 5509061 MGI PMID:17476360 Kras Mouse abnormal cell proliferation IAGP 5509061 MGI PMID:12957286 Kras Mouse abnormal centrosome morphology IAGP 5509061 MGI PMID:17607363 Kras Mouse abnormal CNS glial cell morphology IAGP 5509061 MGI PMID:18371380 Kras Mouse abnormal colon goblet cell morphology IAGP 5509061 MGI PMID:18372904 Kras Mouse abnormal colon morphology IAGP 5509061 MGI PMID:15093544 Kras Mouse abnormal colon morphology IAGP 5509061 MGI PMID:30952657 Kras Mouse abnormal colon morphology IAGP 5509061 MGI PMID:27032374 Kras Mouse abnormal common lymphocyte progenitor cell morphology IAGP 5509061 MGI PMID:25359213 Kras Mouse abnormal common myeloid progenitor cell morphology IAGP 5509061 MGI PMID:25359213 Kras Mouse abnormal cone electrophysiology IAGP 5509061 MGI PMID:21576358 Kras Mouse abnormal cranium morphology IAGP 5509061 MGI PMID:25359213 Kras Mouse abnormal cystic duct morphology IAGP 5509061 MGI PMID:27032374 Kras Mouse abnormal definitive hematopoiesis IAGP 5509061 MGI PMID:14966562 Kras Mouse abnormal definitive hematopoiesis IAGP 5509061 MGI PMID:17476360 Kras Mouse abnormal definitive hematopoiesis IAGP 5509061 MGI PMID:9334313 Kras Mouse abnormal DNA repair IAGP 5509061 MGI PMID:21317887 Kras Mouse abnormal duodenum morphology IAGP 5509061 MGI PMID:17114585 Kras Mouse abnormal ear position IAGP 5509061 MGI PMID:25359213 Kras Mouse abnormal embryonic erythrocyte morphology IAGP 5509061 MGI PMID:17369402 Kras Mouse abnormal embryonic erythropoiesis IAGP 5509061 MGI PMID:17369402 Kras Mouse abnormal embryonic hematopoiesis IAGP 5509061 MGI PMID:9334313 Kras Mouse abnormal embryonic neuroepithelium morphology IAGP 5509061 MGI PMID:15093544 Kras Mouse abnormal enterocyte proliferation IAGP 5509061 MGI PMID:20852630 Kras Mouse abnormal erythrocyte morphology IAGP 5509061 MGI PMID:14966562 Kras Mouse abnormal erythropoiesis IAGP 5509061 MGI PMID:9334313 Kras Mouse abnormal erythropoiesis IAGP 5509061 MGI PMID:14699048 Kras Mouse abnormal erythropoiesis IAGP 5509061 MGI PMID:16720837 Kras Mouse abnormal exocrine pancreas morphology IAGP 5509061 MGI PMID:20807812 Kras Mouse abnormal extrahepatic bile duct morphology IAGP 5509061 MGI PMID:27032374 Kras Mouse abnormal eye development IAGP 5509061 MGI PMID:9334313 Kras Mouse abnormal facial morphology IAGP 5509061 MGI PMID:25359213 Kras Mouse abnormal fetal cardiomyocyte proliferation IAGP 5509061 MGI PMID:9294608 Kras Mouse abnormal fibroblast proliferation IAGP 5509061 MGI PMID:12957286 Kras Mouse abnormal gallbladder morphology IAGP 5509061 MGI PMID:27032374 Kras Mouse abnormal heart morphology IAGP 5509061 MGI PMID:9294608 Kras Mouse abnormal heart morphology IAGP 5509061 MGI PMID:25359213 Kras Mouse abnormal hematopoietic system morphology/development IAGP 5509061 MGI PMID:25359213 Kras Mouse abnormal hematopoietic system morphology/development IAGP 5509061 MGI PMID:30952657 Kras Mouse abnormal hepatic portal vein morphology IAGP 5509061 MGI PMID:17114585 Kras Mouse abnormal hepatic portal vein thrombosis IAGP 5509061 MGI PMID:17114585 Kras Mouse abnormal hepatobiliary system morphology IAGP 5509061 MGI PMID:14966562 Kras Mouse abnormal hepatocyte morphology IAGP 5509061 MGI PMID:9334313 Kras Mouse abnormal hippocampus morphology IAGP 5509061 MGI PMID:18371380 Kras Mouse abnormal intestinal epithelium morphology IAGP 5509061 MGI PMID:18372904 Kras Mouse abnormal intestinal goblet cell morphology IAGP 5509061 MGI PMID:18372904 Kras Mouse abnormal intestine morphology IAGP 5509061 MGI PMID:21965329 Kras Mouse abnormal kidney morphology IAGP 5509061 MGI PMID:25359213 Kras Mouse abnormal lacrimal gland development IAGP 5509061 MGI PMID:22745308 Kras Mouse abnormal large intestine crypts of Lieberkuhn morphology IAGP 5509061 MGI PMID:11323676 Kras Mouse abnormal large intestine crypts of Lieberkuhn morphology IAGP 5509061 MGI PMID:30952657 Kras Mouse abnormal large intestine crypts of Lieberkuhn morphology IAGP 5509061 MGI PMID:18372904 Kras Mouse abnormal liver morphology IAGP 5509061 MGI PMID:17476360 Kras Mouse abnormal liver morphology IAGP 5509061 MGI PMID:27032374 Kras Mouse abnormal lung adenoma incidence IAGP 5509061 MGI PMID:25813352 Kras Mouse abnormal lung development IAGP 5509061 MGI PMID:17468755 Kras Mouse abnormal lung epithelium morphology IAGP 5509061 MGI PMID:17369402 Kras Mouse abnormal lung epithelium morphology IAGP 5509061 MGI PMID:25813352 Kras Mouse abnormal lung epithelium morphology IAGP 5509061 MGI PMID:20308544 Kras Mouse abnormal lung morphology IAGP 5509061 MGI PMID:18281487 Kras Mouse abnormal lymphatic vessel morphology IAGP 5509061 MGI PMID:20179099 Kras Mouse abnormal melanocyte morphology IAGP 5509061 MGI PMID:20697345 Kras Mouse abnormal metabolism IAGP 5509061 MGI PMID:19629168 Kras Mouse abnormal metastatic potential IAGP 5509061 MGI PMID:17936562 Kras Mouse abnormal mismatch repair IAGP 5509061 MGI PMID:18264106 Kras Mouse abnormal myeloid leukocyte morphology IAGP 5509061 MGI PMID:21911454 Kras Mouse abnormal myelopoiesis IAGP 5509061 MGI PMID:14966562 Kras Mouse abnormal myelopoiesis IAGP 5509061 MGI PMID:14699048 Kras Mouse abnormal myocardial fiber physiology IAGP 5509061 MGI PMID:25359213 Kras Mouse abnormal ovary morphology IAGP 5509061 MGI PMID:15619626 Kras Mouse abnormal pancreas development IAGP 5509061 MGI PMID:23266956 Kras Mouse abnormal pancreas morphology IAGP 5509061 MGI PMID:19629168 Kras Mouse abnormal pancreas morphology IAGP 5509061 MGI PMID:23453624 Kras Mouse abnormal pancreatic acinar cell morphology IAGP 5509061 MGI PMID:29670173 Kras Mouse abnormal pancreatic duct morphology IAGP 5509061 MGI PMID:12957286 Kras Mouse abnormal pancreatic duct morphology IAGP 5509061 MGI PMID:25042889 Kras Mouse abnormal peritoneum morphology IAGP 5509061 MGI PMID:15619626 Kras Mouse abnormal placenta labyrinth morphology IAGP 5509061 MGI PMID:17369402 Kras Mouse abnormal placental labyrinth vasculature morphology IAGP 5509061 MGI PMID:17369402 Kras Mouse abnormal prostate gland morphology IAGP 5509061 MGI PMID:22350410 Kras Mouse abnormal prostate gland physiology IAGP 5509061 MGI PMID:21965329 Kras Mouse abnormal pulmonary alveolus morphology IAGP 5509061 MGI PMID:22411819 Kras Mouse abnormal rod electrophysiology IAGP 5509061 MGI PMID:21576358 Kras Mouse abnormal skin sebaceous gland morphology IAGP 5509061 MGI PMID:21502497 Kras Mouse abnormal spleen morphology IAGP 5509061 MGI PMID:17476360 Kras Mouse abnormal survival IAGP 5509061 MGI PMID:28294115 Kras Mouse abnormal systemic arterial blood pressure IAGP 5509061 MGI PMID:15864294 Kras Mouse abnormal translation IAGP 5509061 MGI PMID:30858608 Kras Mouse abnormal tumor incidence IAGP 5509061 MGI PMID:17468755 Kras Mouse abnormal tumor morphology IAGP 5509061 MGI PMID:17607363 Kras Mouse abnormal tumor morphology IAGP 5509061 MGI PMID:19847165 Kras Mouse abnormal tumor morphology IAGP 5509061 MGI PMID:19151761 Kras Mouse abnormal tumor morphology IAGP 5509061 MGI PMID:17486075 Kras Mouse absent lacrimal glands IAGP 5509061 MGI PMID:22745308 Kras Mouse absent Paneth cells IAGP 5509061 MGI PMID:30952657 Kras Mouse absent visceral yolk sac blood islands IAGP 5509061 MGI PMID:9334313 Kras Mouse absent vitelline blood vessels IAGP 5509061 MGI PMID:17369402 Kras Mouse anemia IAGP 5509061 MGI PMID:30952657 Kras Mouse anemia IAGP 5509061 MGI PMID:28846072 Kras Mouse anemia IAGP 5509061 MGI PMID:25359213 Kras Mouse anemia IAGP 5509061 MGI PMID:16720837 Kras Mouse anemia IAGP 5509061 MGI PMID:14699048 Kras Mouse anemia IAGP 5509061 MGI PMID:20233966 Kras Mouse anemia IAGP 5509061 MGI PMID:9334313 Kras Mouse anemia IAGP 5509061 MGI PMID:14966562 Kras Mouse anisopoikilocytosis IAGP 5509061 MGI PMID:16720837 Kras Mouse arteriovenous malformation IAGP 5509061 MGI PMID:32552404 Kras Mouse ascites IAGP 5509061 MGI PMID:20807812 Kras Mouse ascites IAGP 5509061 MGI PMID:22113502 Kras Mouse bile duct hyperplasia IAGP 5509061 MGI PMID:29386660 Kras Mouse bile duct hyperplasia IAGP 5509061 MGI PMID:27032374 Kras Mouse bronchial epithelial hyperplasia IAGP 5509061 MGI PMID:27032374 Kras Mouse bronchiolar epithelial hyperplasia IAGP 5509061 MGI PMID:19151761 Kras Mouse cachexia IAGP 5509061 MGI PMID:14966562 Kras Mouse cachexia IAGP 5509061 MGI PMID:21458673 Kras Mouse cachexia IAGP 5509061 MGI PMID:15894267 Kras Mouse cardiac fibrosis IAGP 5509061 MGI PMID:15864294 Kras Mouse cellular necrosis IAGP 5509061 MGI PMID:25359213 Kras Mouse cholestasis IAGP 5509061 MGI PMID:15894267 Kras Mouse chromosomal instability IAGP 5509061 MGI PMID:15894267 Kras Mouse chromosome breakage IAGP 5509061 MGI PMID:16023597 Kras Mouse chylous ascites IAGP 5509061 MGI PMID:20179099 Kras Mouse conotruncal ridge hyperplasia IAGP 5509061 MGI PMID:17369402 Kras Mouse decreased a-wave amplitude IAGP 5509061 MGI PMID:21576358 Kras Mouse decreased B cell number IAGP 5509061 MGI PMID:28846072 Kras Mouse decreased b-wave amplitude IAGP 5509061 MGI PMID:21576358 Kras Mouse decreased body length IAGP 5509061 MGI PMID:25359213 Kras Mouse decreased body size IAGP 5509061 MGI PMID:25359213 Kras Mouse decreased CD8-positive, alpha-beta T cell number IAGP 5509061 MGI PMID:25359213 Kras Mouse decreased cell proliferation IAGP 5509061 MGI PMID:17476360 Kras Mouse decreased cell proliferation IAGP 5509061 MGI PMID:21514245 Kras Mouse decreased cell proliferation IAGP 5509061 MGI PMID:20609353 Kras Mouse decreased circulating estradiol level IAGP 5509061 MGI PMID:21860425 Kras Mouse decreased circulating progesterone level IAGP 5509061 MGI PMID:21860425 Kras Mouse decreased circulating thyroid-stimulating hormone level IAGP 5509061 MGI PMID:19351816 Kras Mouse decreased classified tumor incidence IAGP 5509061 MGI PMID:21514245 Kras Mouse decreased cranium length IAGP 5509061 MGI PMID:25359213 Kras Mouse decreased double-negative T cell number IAGP 5509061 MGI PMID:28846072 Kras Mouse decreased double-positive T cell number IAGP 5509061 MGI PMID:28846072 Kras Mouse decreased embryo size IAGP 5509061 MGI PMID:15093544 Kras Mouse decreased embryo size IAGP 5509061 MGI PMID:9334313 Kras Mouse decreased embryo size IAGP 5509061 MGI PMID:9294608 Kras Mouse decreased fibroblast proliferation IAGP 5509061 MGI PMID:31400748 Kras Mouse decreased gland tumor incidence IAGP 5509061 MGI PMID:36241718 Kras Mouse decreased gland tumor incidence IAGP 5509061 MGI PMID:31048544 Kras Mouse decreased glutamic acid level IAGP 5509061 MGI PMID:31685994 Kras Mouse decreased heart left ventricle muscle contractility IAGP 5509061 MGI PMID:15864294 Kras Mouse decreased hematocrit IAGP 5509061 MGI PMID:14966562 Kras Mouse decreased hematopoietic stem cell number IAGP 5509061 MGI PMID:28846072 Kras Mouse decreased hemoglobin content IAGP 5509061 MGI PMID:30952657 Kras Mouse decreased incidence of induced tumors IAGP 5509061 MGI PMID:17540175 Kras Mouse decreased incidence of induced tumors IAGP 5509061 MGI PMID:19847165 Kras Mouse decreased incidence of tumors by chemical induction IAGP 5509061 MGI PMID:17607363 Kras Mouse decreased interferon-gamma secretion IAGP 5509061 MGI PMID:19841240 Kras Mouse decreased lung tumor incidence IAGP 5509061 MGI PMID:17540175 Kras Mouse decreased lung tumor incidence IAGP 5509061 MGI PMID:36548081 Kras Mouse decreased lung tumor incidence IAGP 5509061 MGI PMID:30686754 Kras Mouse decreased lung tumor incidence IAGP 5509061 MGI PMID:32767810 Kras Mouse decreased lung tumor incidence IAGP 5509061 MGI PMID:27462406 Kras Mouse decreased lung tumor incidence IAGP 5509061 MGI PMID:26095252 Kras Mouse decreased lung tumor incidence IAGP 5509061 MGI PMID:25813352 Kras Mouse decreased lung tumor incidence IAGP 5509061 MGI PMID:24430184 Kras Mouse decreased lung tumor incidence IAGP 5509061 MGI PMID:20832755 Kras Mouse decreased lung tumor incidence IAGP 5509061 MGI PMID:8152802 Kras Mouse decreased lung tumor incidence IAGP 5509061 MGI PMID:2891865 Kras Mouse decreased lung tumor incidence IAGP 5509061 MGI PMID:19029981 Kras Mouse decreased lymphocyte cell number IAGP 5509061 MGI PMID:17476360 Kras Mouse decreased lymphoma incidence IAGP 5509061 MGI PMID:27462406 Kras Mouse decreased mean corpuscular hemoglobin IAGP 5509061 MGI PMID:16720837 Kras Mouse decreased metastatic potential IAGP 5509061 MGI PMID:18713982 Kras Mouse decreased metastatic potential IAGP 5509061 MGI PMID:38733589 Kras Mouse decreased metastatic potential IAGP 5509061 MGI PMID:28294115 Kras Mouse decreased metastatic potential IAGP 5509061 MGI PMID:25180607 Kras Mouse decreased ovarian tumor incidence IAGP 5509061 MGI PMID:20505730 Kras Mouse decreased skin tumor incidence IAGP 5509061 MGI PMID:27462406 Kras Mouse decreased survivor rate IAGP 5509061 MGI PMID:21514245 Kras Mouse decreased susceptibility to induced pancreatitis IAGP 5509061 MGI PMID:38574733 Kras Mouse decreased T cell number IAGP 5509061 MGI PMID:28846072 Kras Mouse decreased tumor growth/size IAGP 5509061 MGI PMID:19151761 Kras Mouse decreased tumor growth/size IAGP 5509061 MGI PMID:31685994 Kras Mouse decreased tumor growth/size IAGP 5509061 MGI PMID:27462406 Kras Mouse decreased tumor growth/size IAGP 5509061 MGI PMID:26095252 Kras Mouse decreased tumor growth/size IAGP 5509061 MGI PMID:23063435 Kras Mouse decreased tumor growth/size IAGP 5509061 MGI PMID:20832755 Kras Mouse decreased tumor growth/size IAGP 5509061 MGI PMID:20308544 Kras Mouse decreased tumor growth/size IAGP 5509061 MGI PMID:20609353 Kras Mouse decreased tumor growth/size IAGP 5509061 MGI PMID:19847165 Kras Mouse decreased tumor incidence IAGP 5509061 MGI PMID:20609353 Kras Mouse decreased tumor incidence IAGP 5509061 MGI PMID:38574733 Kras Mouse decreased tumor incidence IAGP 5509061 MGI PMID:31400748 Kras Mouse decreased tumor incidence IAGP 5509061 MGI PMID:27462406 Kras Mouse decreased tumor incidence IAGP 5509061 MGI PMID:20832755 Kras Mouse decreased tumor latency IAGP 5509061 MGI PMID:17936562 Kras Mouse decreased tumor latency IAGP 5509061 MGI PMID:22034435 Kras Mouse decreased tumor-free survival time IAGP 5509061 MGI PMID:23285300 Kras Mouse decreased tumor-free survival time IAGP 5509061 MGI PMID:36548081 Kras Mouse decreased tumor-free survival time IAGP 5509061 MGI PMID:17114584 Kras Mouse decreased tumor-free survival time IAGP 5509061 MGI PMID:14681207 Kras Mouse decreased tumor-free survival time IAGP 5509061 MGI PMID:22411819 Kras Mouse dilated bile duct IAGP 5509061 MGI PMID:29386660 Kras Mouse dilated cardiomyopathy IAGP 5509061 MGI PMID:15864294 Kras Mouse dilated gallbladder IAGP 5509061 MGI PMID:17114585 Kras Mouse dilated gallbladder IAGP 5509061 MGI PMID:27032374 Kras Mouse dilated heart IAGP 5509061 MGI PMID:9334313 Kras Mouse dilated pancreatic duct IAGP 5509061 MGI PMID:19629168 Kras Mouse dilated respiratory conducting tube IAGP 5509061 MGI PMID:17369402 Kras Mouse disorganized pancreatic islets IAGP 5509061 MGI PMID:19629168 Kras Mouse distended abdomen IAGP 5509061 MGI PMID:20807812 Kras Mouse distended abdomen IAGP 5509061 MGI PMID:27032374 Kras Mouse distended abdomen IAGP 5509061 MGI PMID:22113502 Kras Mouse distended abdomen IAGP 5509061 MGI PMID:15894267 Kras Mouse distended abdomen IAGP 5509061 MGI PMID:17114585 Kras Mouse distended pericardium IAGP 5509061 MGI PMID:9334313 Kras Mouse double outlet right ventricle IAGP 5509061 MGI PMID:17369402 Kras Mouse early cellular replicative senescence IAGP 5509061 MGI PMID:20609353 Kras Mouse edema IAGP 5509061 MGI PMID:17369402 Kras Mouse edema IAGP 5509061 MGI PMID:20807812 Kras Mouse embryonic growth arrest IAGP 5509061 MGI PMID:9334313 Kras Mouse embryonic growth arrest IAGP 5509061 MGI PMID:17369402 Kras Mouse embryonic growth retardation IAGP 5509061 MGI PMID:9294608 Kras Mouse embryonic growth retardation IAGP 5509061 MGI PMID:9334313 Kras Mouse embryonic lethality during organogenesis, complete penetrance IAGP 5509061 MGI PMID:15093544 Kras Mouse embryonic lethality during organogenesis, complete penetrance IAGP 5509061 MGI PMID:18059342 Kras Mouse embryonic lethality during organogenesis, complete penetrance IAGP 5509061 MGI PMID:17369402 Kras Mouse embryonic lethality during organogenesis, complete penetrance IAGP 5509061 MGI PMID:12957286 Kras Mouse embryonic lethality during organogenesis, incomplete penetrance IAGP 5509061 MGI PMID:9334313 Kras Mouse embryonic lethality during organogenesis, incomplete penetrance IAGP 5509061 MGI PMID:17369402 Kras Mouse embryonic lethality, complete penetrance IAGP 5509061 MGI PMID:9334313 Kras Mouse embryonic lethality, incomplete penetrance IAGP 5509061 MGI PMID:9334313 Kras Mouse enlarged heart IAGP 5509061 MGI PMID:15093544 Kras Mouse enlarged liver IAGP 5509061 MGI PMID:14699048 Kras Mouse enlarged liver IAGP 5509061 MGI PMID:27032374 Kras Mouse enlarged lung IAGP 5509061 MGI PMID:17468755 Kras Mouse enlarged pancreas IAGP 5509061 MGI PMID:14706336 Kras Mouse enlarged pancreatic islets IAGP 5509061 MGI PMID:14681207 Kras Mouse enlarged sebaceous gland IAGP 5509061 MGI PMID:21502497 Kras Mouse enlarged spleen IAGP 5509061 MGI PMID:14966562 Kras Mouse enlarged spleen IAGP 5509061 MGI PMID:30952657 Kras Mouse enlarged spleen IAGP 5509061 MGI PMID:25359213 Kras Mouse enlarged spleen IAGP 5509061 MGI PMID:16720837 Kras Mouse enlarged spleen IAGP 5509061 MGI PMID:14699048 Kras Mouse enlarged spleen IAGP 5509061 MGI PMID:17114585 Kras Mouse enlarged thyroid gland IAGP 5509061 MGI PMID:19351816 Kras Mouse epidermal hyperplasia IAGP 5509061 MGI PMID:21502497 Kras Mouse excessive folding of visceral yolk sac IAGP 5509061 MGI PMID:9334313 Kras Mouse exocrine pancreas atrophy IAGP 5509061 MGI PMID:20807812 Kras Mouse exocrine pancreatic insufficiency IAGP 5509061 MGI PMID:21056012 Kras Mouse extramedullary hematopoiesis IAGP 5509061 MGI PMID:14966562 Kras Mouse extramedullary hematopoiesis IAGP 5509061 MGI PMID:25359213 Kras Mouse fetal growth retardation IAGP 5509061 MGI PMID:9334313 Kras Mouse flattened snout IAGP 5509061 MGI PMID:25359213 Kras Mouse Harderian gland hyperplasia IAGP 5509061 MGI PMID:12957286 Kras Mouse heart hyperplasia IAGP 5509061 MGI PMID:25359213 Kras Mouse hemoperitoneum IAGP 5509061 MGI PMID:22266220 Kras Mouse hemorrhage IAGP 5509061 MGI PMID:17369402 Kras Mouse hemorrhagic ascites IAGP 5509061 MGI PMID:17114585 Kras Mouse hemorrhagic ascites IAGP 5509061 MGI PMID:27032374 Kras Mouse hemorrhagic ascites IAGP 5509061 MGI PMID:25042889 Kras Mouse hemorrhagic ascites IAGP 5509061 MGI PMID:15894267 Kras Mouse hepatic necrosis IAGP 5509061 MGI PMID:17114585 Kras Mouse hepatosplenomegaly IAGP 5509061 MGI PMID:28846072 Kras Mouse hunched posture IAGP 5509061 MGI PMID:22964582 Kras Mouse hydrops fetalis IAGP 5509061 MGI PMID:9334313 Kras Mouse hyperpigmentation IAGP 5509061 MGI PMID:20697345 Kras Mouse hyperpigmentation IAGP 5509061 MGI PMID:25252692 Kras Mouse hyperpigmentation IAGP 5509061 MGI PMID:20141835 Kras Mouse hypertension IAGP 5509061 MGI PMID:15864294 Kras Mouse impaired branching involved in bronchus morphogenesis IAGP 5509061 MGI PMID:17369402 Kras Mouse impaired branching involved in terminal bronchiole morphogenesis IAGP 5509061 MGI PMID:17369402 Kras Mouse impaired granulosa cell differentiation IAGP 5509061 MGI PMID:21860425 Kras Mouse increased adenocarcinoma incidence IAGP 5509061 MGI PMID:16288016 Kras Mouse increased adenocarcinoma incidence IAGP 5509061 MGI PMID:17676052 Kras Mouse increased adenocarcinoma incidence IAGP 5509061 MGI PMID:22113502 Kras Mouse increased adenocarcinoma incidence IAGP 5509061 MGI PMID:20080688 Kras Mouse increased adenocarcinoma incidence IAGP 5509061 MGI PMID:22411819 Kras Mouse increased adenocarcinoma incidence IAGP 5509061 MGI PMID:20609353 Kras Mouse increased adenoma incidence IAGP 5509061 MGI PMID:20609353 Kras Mouse increased adenoma incidence IAGP 5509061 MGI PMID:23999427 Kras Mouse increased apoptosis IAGP 5509061 MGI PMID:9334313 Kras Mouse increased B cell number IAGP 5509061 MGI PMID:21911454 Kras Mouse increased basophil cell number IAGP 5509061 MGI PMID:25359213 Kras Mouse increased body weight IAGP 5509061 MGI PMID:38574733 Kras Mouse increased carcinoma incidence IAGP 5509061 MGI PMID:17607363 Kras Mouse increased carcinoma incidence IAGP 5509061 MGI PMID:20080688 Kras Mouse increased carcinoma incidence IAGP 5509061 MGI PMID:21965329 Kras Mouse increased carcinoma incidence IAGP 5509061 MGI PMID:21502497 Kras Mouse increased carcinoma incidence IAGP 5509061 MGI PMID:17486075 Kras Mouse increased cardiac muscle contractility IAGP 5509061 MGI PMID:25359213 Kras Mouse increased cardiac output IAGP 5509061 MGI PMID:25359213 Kras Mouse increased cell proliferation IAGP 5509061 MGI PMID:20609353 Kras Mouse increased cell proliferation IAGP 5509061 MGI PMID:25359213 Kras Mouse increased cell proliferation IAGP 5509061 MGI PMID:23266956 Kras Mouse increased cell proliferation IAGP 5509061 MGI PMID:22892241 Kras Mouse increased cell proliferation IAGP 5509061 MGI PMID:21502497 Kras Mouse increased cellular sensitivity to oxidative stress IAGP 5509061 MGI PMID:26095252 Kras Mouse increased cholangiocarcinoma incidence IAGP 5509061 MGI PMID:17936562 Kras Mouse increased cholangiocarcinoma incidence IAGP 5509061 MGI PMID:27032374 Kras Mouse increased cholangiocarcinoma incidence IAGP 5509061 MGI PMID:29386660 Kras Mouse increased cholangiocarcinoma incidence IAGP 5509061 MGI PMID:22266220 Kras Mouse increased circulating erythropoietin level IAGP 5509061 MGI PMID:16720837 Kras Mouse increased circulating follicle stimulating hormone level IAGP 5509061 MGI PMID:21860425 Kras Mouse increased circulating luteinizing hormone level IAGP 5509061 MGI PMID:21860425 Kras Mouse increased classified tumor incidence IAGP 5509061 MGI PMID:19846776 Kras Mouse increased colon adenoma incidence IAGP 5509061 MGI PMID:20080688 Kras Mouse increased colon adenoma incidence IAGP 5509061 MGI PMID:30952657 Kras Mouse increased cranium height IAGP 5509061 MGI PMID:25359213 Kras Mouse increased cranium width IAGP 5509061 MGI PMID:25359213 Kras Mouse increased cutaneous melanoma incidence IAGP 5509061 MGI PMID:25252692 Kras Mouse increased dendritic cell number IAGP 5509061 MGI PMID:28846072 Kras Mouse increased embryonic neuroepithelium apoptosis IAGP 5509061 MGI PMID:15093544 Kras Mouse increased embryonic tissue cell apoptosis IAGP 5509061 MGI PMID:9334313 Kras Mouse increased embryonic tissue cell apoptosis IAGP 5509061 MGI PMID:17369402 Kras Mouse increased endometrial carcinoma incidence IAGP 5509061 MGI PMID:15619626 Kras Mouse increased eosinophil cell number IAGP 5509061 MGI PMID:25359213 Kras Mouse increased esophageal papilloma incidence IAGP 5509061 MGI PMID:14966562 Kras Mouse increased esophageal papilloma incidence IAGP 5509061 MGI PMID:15894267 Kras Mouse increased facial tumor incidence IAGP 5509061 MGI PMID:21502497 Kras Mouse increased fibroblast proliferation IAGP 5509061 MGI PMID:22892241 Kras Mouse increased fibroblast proliferation IAGP 5509061 MGI PMID:22606359 Kras Mouse increased fibrosarcoma incidence IAGP 5509061 MGI PMID:17486075 Kras Mouse increased fibrosarcoma incidence IAGP 5509061 MGI PMID:11323676 Kras Mouse increased gastrointestinal tumor incidence IAGP 5509061 MGI PMID:21502497 Kras Mouse increased granulocyte monocyte progenitor cell number IAGP 5509061 MGI PMID:25359213 Kras Mouse increased granulocyte number IAGP 5509061 MGI PMID:14966562 Kras Mouse increased granulosa cell tumor incidence IAGP 5509061 MGI PMID:21860425 Kras Mouse increased hair follicle cell proliferation IAGP 5509061 MGI PMID:21502497 Kras Mouse increased hamartoma incidence IAGP 5509061 MGI PMID:22266220 Kras Mouse increased hemangiosarcoma incidence IAGP 5509061 MGI PMID:12957286 Kras Mouse increased hemangiosarcoma incidence IAGP 5509061 MGI PMID:11323676 Kras Mouse increased hemangiosarcoma incidence IAGP 5509061 MGI PMID:17486075 Kras Mouse increased hematopoietic stem cell number IAGP 5509061 MGI PMID:25359213 Kras Mouse increased hemolymphoid system tumor incidence IAGP 5509061 MGI PMID:17468755 Kras Mouse increased hepatocellular carcinoma incidence IAGP 5509061 MGI PMID:20643348 Kras Mouse increased hepatocellular carcinoma incidence IAGP 5509061 MGI PMID:27032374 Kras Mouse increased hepatocyte apoptosis IAGP 5509061 MGI PMID:17369402 Kras Mouse increased IgG level IAGP 5509061 MGI PMID:19841240 Kras Mouse increased IgM level IAGP 5509061 MGI PMID:19841240 Kras Mouse increased incidence of tumors by chemical induction IAGP 5509061 MGI PMID:17607363 Kras Mouse increased inflammatory response IAGP 5509061 MGI PMID:16288213 Kras Mouse increased intestinal adenocarcinoma incidence IAGP 5509061 MGI PMID:18372904 Kras Mouse increased leukemia incidence IAGP 5509061 MGI PMID:28846072 Kras Mouse increased leukocyte cell number IAGP 5509061 MGI PMID:14966562 Kras Mouse increased leukocyte cell number IAGP 5509061 MGI PMID:30952657 Kras Mouse increased leukocyte cell number IAGP 5509061 MGI PMID:28846072 Kras Mouse increased leukocyte cell number IAGP 5509061 MGI PMID:30423293 Kras Mouse increased leukocyte cell number IAGP 5509061 MGI PMID:25359213 Kras Mouse increased leukocyte cell number IAGP 5509061 MGI PMID:14699048 Kras Mouse increased leukocyte cell number IAGP 5509061 MGI PMID:20233966 Kras Mouse increased lip tumor incidence IAGP 5509061 MGI PMID:21502497 Kras Mouse increased liver tumor incidence IAGP 5509061 MGI PMID:27032374 Kras Mouse increased lung adenocarcinoma incidence IAGP 5509061 MGI PMID:12957286 Kras Mouse increased lung adenocarcinoma incidence IAGP 5509061 MGI PMID:36548081 Kras Mouse increased lung adenocarcinoma incidence IAGP 5509061 MGI PMID:17676035 Kras Mouse increased lung adenocarcinoma incidence IAGP 5509061 MGI PMID:23285300 Kras Mouse increased lung adenocarcinoma incidence IAGP 5509061 MGI PMID:22611036 Kras Mouse increased lung adenocarcinoma incidence IAGP 5509061 MGI PMID:22430205 Kras Mouse increased lung adenocarcinoma incidence IAGP 5509061 MGI PMID:21911454 Kras Mouse increased lung adenocarcinoma incidence IAGP 5509061 MGI PMID:22228755 Kras Mouse increased lung adenocarcinoma incidence IAGP 5509061 MGI PMID:21317887 Kras Mouse increased lung adenocarcinoma incidence IAGP 5509061 MGI PMID:18281487 Kras Mouse increased lung adenocarcinoma incidence IAGP 5509061 MGI PMID:19151761 Kras Mouse increased lung adenocarcinoma incidence IAGP 5509061 MGI PMID:11323676 Kras Mouse increased lung adenocarcinoma incidence IAGP 5509061 MGI PMID:17936562 Kras Mouse increased lung adenocarcinoma incidence IAGP 5509061 MGI PMID:18493606 Kras Mouse increased lung adenocarcinoma incidence IAGP 5509061 MGI PMID:23565506 Kras Mouse increased lung adenocarcinoma incidence IAGP 5509061 MGI PMID:16288016 Kras Mouse increased lung adenocarcinoma incidence IAGP 5509061 MGI PMID:19847165 Kras Mouse increased lung adenocarcinoma incidence IAGP 5509061 MGI PMID:22964582 Kras Mouse increased lung adenocarcinoma incidence IAGP 5509061 MGI PMID:17468755 Kras Mouse increased lung adenocarcinoma incidence IAGP 5509061 MGI PMID:24430184 Kras Mouse increased lung adenocarcinoma incidence IAGP 5509061 MGI PMID:17476360 Kras Mouse increased lung adenocarcinoma incidence IAGP 5509061 MGI PMID:16288213 Kras Mouse increased lung adenocarcinoma incidence IAGP 5509061 MGI PMID:15837621 Kras Mouse increased lung adenoma incidence IAGP 5509061 MGI PMID:14966562 Kras Mouse increased lung adenoma incidence IAGP 5509061 MGI PMID:36548081 Kras Mouse increased lung adenoma incidence IAGP 5509061 MGI PMID:22606359 Kras Mouse increased lung adenoma incidence IAGP 5509061 MGI PMID:23285300 Kras Mouse increased lung adenoma incidence IAGP 5509061 MGI PMID:22892241 Kras Mouse increased lung adenoma incidence IAGP 5509061 MGI PMID:20832755 Kras Mouse increased lung adenoma incidence IAGP 5509061 MGI PMID:22411819 Kras Mouse increased lung adenoma incidence IAGP 5509061 MGI PMID:21911454 Kras Mouse increased lung adenoma incidence IAGP 5509061 MGI PMID:21458673 Kras Mouse increased lung adenoma incidence IAGP 5509061 MGI PMID:18281487 Kras Mouse increased lung adenoma incidence IAGP 5509061 MGI PMID:20308544 Kras Mouse increased lung adenoma incidence IAGP 5509061 MGI PMID:8152802 Kras Mouse increased lung adenoma incidence IAGP 5509061 MGI PMID:2891865 Kras Mouse increased lung adenoma incidence IAGP 5509061 MGI PMID:19061836 Kras Mouse increased lung adenoma incidence IAGP 5509061 MGI PMID:17486075 Kras Mouse increased lung adenoma incidence IAGP 5509061 MGI PMID:11323676 Kras Mouse increased lung adenoma incidence IAGP 5509061 MGI PMID:17936562 Kras Mouse increased lung adenoma incidence IAGP 5509061 MGI PMID:16288016 Kras Mouse increased lung adenoma incidence IAGP 5509061 MGI PMID:24239348 Kras Mouse increased lung adenoma incidence IAGP 5509061 MGI PMID:17468755 Kras Mouse increased lung adenoma incidence IAGP 5509061 MGI PMID:24430184 Kras Mouse increased lung adenoma incidence IAGP 5509061 MGI PMID:17476360 Kras Mouse increased lung adenoma incidence IAGP 5509061 MGI PMID:15837621 Kras Mouse increased lung adenoma incidence IAGP 5509061 MGI PMID:12957286 Kras Mouse increased lung carcinoma incidence IAGP 5509061 MGI PMID:20308544 Kras Mouse increased lung carcinoma incidence IAGP 5509061 MGI PMID:18281487 Kras Mouse increased lung large cell carcinoma incidence IAGP 5509061 MGI PMID:17676035 Kras Mouse increased lung non-small cell carcinoma incidence IAGP 5509061 MGI PMID:22964582 Kras Mouse increased lung non-small cell carcinoma incidence IAGP 5509061 MGI PMID:23453624 Kras Mouse increased lung non-small cell carcinoma incidence IAGP 5509061 MGI PMID:21514245 Kras Mouse increased lung non-small cell carcinoma incidence IAGP 5509061 MGI PMID:22611036 Kras Mouse increased lung non-small cell carcinoma incidence IAGP 5509061 MGI PMID:20832755 Kras Mouse increased lung non-small cell carcinoma incidence IAGP 5509061 MGI PMID:20609353 Kras Mouse increased lung squamous cell carcinoma incidence IAGP 5509061 MGI PMID:17676035 Kras Mouse increased lung tumor incidence IAGP 5509061 MGI PMID:17476360 Kras Mouse increased lung tumor incidence IAGP 5509061 MGI PMID:36548081 Kras Mouse increased lung tumor incidence IAGP 5509061 MGI PMID:32767810 Kras Mouse increased lung tumor incidence IAGP 5509061 MGI PMID:17676035 Kras Mouse increased lung tumor incidence IAGP 5509061 MGI PMID:18264106 Kras Mouse increased lung tumor incidence IAGP 5509061 MGI PMID:20832755 Kras Mouse increased lung tumor incidence IAGP 5509061 MGI PMID:21512139 Kras Mouse increased lung tumor incidence IAGP 5509061 MGI PMID:21504907 Kras Mouse increased lung tumor incidence IAGP 5509061 MGI PMID:21317887 Kras Mouse increased lung tumor incidence IAGP 5509061 MGI PMID:18281487 Kras Mouse increased lung tumor incidence IAGP 5509061 MGI PMID:20609353 Kras Mouse increased lung tumor incidence IAGP 5509061 MGI PMID:20308544 Kras Mouse increased lung tumor incidence IAGP 5509061 MGI PMID:19151761 Kras Mouse increased lung tumor incidence IAGP 5509061 MGI PMID:19061836 Kras Mouse increased lung tumor incidence IAGP 5509061 MGI PMID:19029981 Kras Mouse increased lung tumor incidence IAGP 5509061 MGI PMID:19010921 Kras Mouse increased lung tumor incidence IAGP 5509061 MGI PMID:27462406 Kras Mouse increased lung tumor incidence IAGP 5509061 MGI PMID:11323676 Kras Mouse increased lung tumor incidence IAGP 5509061 MGI PMID:17936562 Kras Mouse increased lung tumor incidence IAGP 5509061 MGI PMID:22964582 Kras Mouse increased lung tumor incidence IAGP 5509061 MGI PMID:16288016 Kras Mouse increased lung tumor incidence IAGP 5509061 MGI PMID:17468755 Kras Mouse increased lung tumor incidence IAGP 5509061 MGI PMID:17369402 Kras Mouse increased lung tumor incidence IAGP 5509061 MGI PMID:24276238 Kras Mouse increased lung weight IAGP 5509061 MGI PMID:17476360 Kras Mouse increased lung weight IAGP 5509061 MGI PMID:20308544 Kras Mouse increased lymphoblastic lymphoma incidence IAGP 5509061 MGI PMID:14966562 Kras Mouse increased lymphoma incidence IAGP 5509061 MGI PMID:17486075 Kras Mouse increased macrophage cell number IAGP 5509061 MGI PMID:23597566 Kras Mouse increased malignant tumor incidence IAGP 5509061 MGI PMID:14681207 Kras Mouse increased melanoma incidence IAGP 5509061 MGI PMID:20697345 Kras Mouse increased mesothelioma incidence IAGP 5509061 MGI PMID:17486075 Kras Mouse increased metastatic potential IAGP 5509061 MGI PMID:14681207 Kras Mouse increased metastatic potential IAGP 5509061 MGI PMID:28790031 Kras Mouse increased metastatic potential IAGP 5509061 MGI PMID:19351816 Kras Mouse increased metastatic potential IAGP 5509061 MGI PMID:22350410 Kras Mouse increased metastatic potential IAGP 5509061 MGI PMID:25180607 Kras Mouse increased metastatic potential IAGP 5509061 MGI PMID:17676035 Kras Mouse increased metastatic potential IAGP 5509061 MGI PMID:17676052 Kras Mouse increased metastatic potential IAGP 5509061 MGI PMID:23999427 Kras Mouse increased metastatic potential IAGP 5509061 MGI PMID:17349585 Kras Mouse increased metastatic potential IAGP 5509061 MGI PMID:22266220 Kras Mouse increased metastatic potential IAGP 5509061 MGI PMID:21911454 Kras Mouse increased metastatic potential IAGP 5509061 MGI PMID:15619626 Kras Mouse increased metastatic potential IAGP 5509061 MGI PMID:18713982 Kras Mouse increased metastatic potential IAGP 5509061 MGI PMID:17486075 Kras Mouse increased metastatic potential IAGP 5509061 MGI PMID:17607363 Kras Mouse increased metastatic potential IAGP 5509061 MGI PMID:16288016 Kras Mouse increased metastatic potential IAGP 5509061 MGI PMID:17114585 Kras Mouse increased metastatic potential IAGP 5509061 MGI PMID:16585505 Kras Mouse increased monocyte cell number IAGP 5509061 MGI PMID:14699048 Kras Mouse increased monocyte cell number IAGP 5509061 MGI PMID:28846072 Kras Mouse increased mouth tumor incidence IAGP 5509061 MGI PMID:24525739 Kras Mouse increased myeloid cell number IAGP 5509061 MGI PMID:25359213 Kras Mouse increased myeloid cell number IAGP 5509061 MGI PMID:30952657 Kras Mouse increased myeloid cell number in bone marrow IAGP 5509061 MGI PMID:30952657 Kras Mouse increased myocardial fiber number IAGP 5509061 MGI PMID:25359213 Kras Mouse increased myocardial fiber size IAGP 5509061 MGI PMID:15864294 Kras Mouse increased neurofibroma incidence IAGP 5509061 MGI PMID:17936562 Kras Mouse increased neurofibroma incidence IAGP 5509061 MGI PMID:19846776 Kras Mouse increased neurofibrosarcoma incidence IAGP 5509061 MGI PMID:19846776 Kras Mouse increased neuron apoptosis IAGP 5509061 MGI PMID:9294608 Kras Mouse increased neutrophil cell number IAGP 5509061 MGI PMID:17476360 Kras Mouse increased neutrophil cell number IAGP 5509061 MGI PMID:25359213 Kras Mouse increased oral papilloma incidence IAGP 5509061 MGI PMID:14966562 Kras Mouse increased oral papilloma incidence IAGP 5509061 MGI PMID:24525739 Kras Mouse increased oral papilloma incidence IAGP 5509061 MGI PMID:22699621 Kras Mouse increased organ/body region tumor incidence IAGP 5509061 MGI PMID:21565614 Kras Mouse increased organ/body region tumor incidence IAGP 5509061 MGI PMID:20080688 Kras Mouse increased osteosarcoma incidence IAGP 5509061 MGI PMID:17936562 Kras Mouse increased ovary tumor incidence IAGP 5509061 MGI PMID:17936562 Kras Mouse increased ovary tumor incidence IAGP 5509061 MGI PMID:21860425 Kras Mouse increased ovary tumor incidence IAGP 5509061 MGI PMID:20505730 Kras Mouse increased pancreas adenoma incidence IAGP 5509061 MGI PMID:22113502 Kras Mouse increased pancreas apoptosis IAGP 5509061 MGI PMID:21056012 Kras Mouse increased pancreas tumor incidence IAGP 5509061 MGI PMID:14681207 Kras Mouse increased pancreas tumor incidence IAGP 5509061 MGI PMID:31048544 Kras Mouse increased pancreas tumor incidence IAGP 5509061 MGI PMID:38574733 Kras Mouse increased pancreas tumor incidence IAGP 5509061 MGI PMID:23453624 Kras Mouse increased pancreas tumor incidence IAGP 5509061 MGI PMID:22113502 Kras Mouse increased pancreas tumor incidence IAGP 5509061 MGI PMID:22699621 Kras Mouse increased pancreas tumor incidence IAGP 5509061 MGI PMID:20807812 Kras Mouse increased pancreas tumor incidence IAGP 5509061 MGI PMID:19629168 Kras Mouse increased pancreas tumor incidence IAGP 5509061 MGI PMID:26996122 Kras Mouse increased pancreas tumor incidence IAGP 5509061 MGI PMID:18713982 Kras Mouse increased pancreas tumor incidence IAGP 5509061 MGI PMID:17114585 Kras Mouse increased pancreas tumor incidence IAGP 5509061 MGI PMID:16585505 Kras Mouse increased pancreas weight IAGP 5509061 MGI PMID:18713982 Kras Mouse increased pancreatic acinar cell carcinoma incidence IAGP 5509061 MGI PMID:21056012 Kras Mouse increased pancreatic ductal adenocarcinoma incidence IAGP 5509061 MGI PMID:30858608 Kras Mouse increased pancreatic ductal adenocarcinoma incidence IAGP 5509061 MGI PMID:31048544 Kras Mouse increased pancreatic ductal adenocarcinoma incidence IAGP 5509061 MGI PMID:38574733 Kras Mouse increased pancreatic ductal adenocarcinoma incidence IAGP 5509061 MGI PMID:30952657 Kras Mouse increased pancreatic ductal adenocarcinoma incidence IAGP 5509061 MGI PMID:31685994 Kras Mouse increased pancreatic ductal adenocarcinoma incidence IAGP 5509061 MGI PMID:28790031 Kras Mouse increased pancreatic ductal adenocarcinoma incidence IAGP 5509061 MGI PMID:28934293 Kras Mouse increased pancreatic ductal adenocarcinoma incidence IAGP 5509061 MGI PMID:25878147 Kras Mouse increased pancreatic ductal adenocarcinoma incidence IAGP 5509061 MGI PMID:25042889 Kras Mouse increased pancreatic ductal adenocarcinoma incidence IAGP 5509061 MGI PMID:23453624 Kras Mouse increased pancreatic ductal adenocarcinoma incidence IAGP 5509061 MGI PMID:17349585 Kras Mouse increased pancreatic ductal adenocarcinoma incidence IAGP 5509061 MGI PMID:22611036 Kras Mouse increased pancreatic ductal adenocarcinoma incidence IAGP 5509061 MGI PMID:22699621 Kras Mouse increased pancreatic ductal adenocarcinoma incidence IAGP 5509061 MGI PMID:21056012 Kras Mouse increased pancreatic ductal adenocarcinoma incidence IAGP 5509061 MGI PMID:15894267 Kras Mouse increased pancreatic ductal adenocarcinoma incidence IAGP 5509061 MGI PMID:18713982 Kras Mouse increased pancreatic ductal adenocarcinoma incidence IAGP 5509061 MGI PMID:18621715 Kras Mouse increased pancreatic ductal adenocarcinoma incidence IAGP 5509061 MGI PMID:17114585 Kras Mouse increased pancreatic ductal adenocarcinoma incidence IAGP 5509061 MGI PMID:14706336 Kras Mouse increased pancreatic ductal adenocarcinoma incidence IAGP 5509061 MGI PMID:14681207 Kras Mouse increased pancreatic ductal adenocarcinoma incidence IAGP 5509061 MGI PMID:16585505 Kras Mouse increased pancreatic ductal adenocarcinoma incidence IAGP 5509061 MGI PMID:17114584 Kras Mouse increased pancreatic ductal adenocarcinoma incidence IAGP 5509061 MGI PMID:20807812 Kras Mouse increased pancreatic intraepithelial neoplasia incidence IAGP 5509061 MGI PMID:14681207 Kras Mouse increased pancreatic intraepithelial neoplasia incidence IAGP 5509061 MGI PMID:31048544 Kras Mouse increased pancreatic intraepithelial neoplasia incidence IAGP 5509061 MGI PMID:30952657 Kras Mouse increased pancreatic intraepithelial neoplasia incidence IAGP 5509061 MGI PMID:31685994 Kras Mouse increased pancreatic intraepithelial neoplasia incidence IAGP 5509061 MGI PMID:28790031 Kras Mouse increased pancreatic intraepithelial neoplasia incidence IAGP 5509061 MGI PMID:28934293 Kras Mouse increased pancreatic intraepithelial neoplasia incidence IAGP 5509061 MGI PMID:27032374 Kras Mouse increased pancreatic intraepithelial neoplasia incidence IAGP 5509061 MGI PMID:22113502 Kras Mouse increased pancreatic intraepithelial neoplasia incidence IAGP 5509061 MGI PMID:22699621 Kras Mouse increased pancreatic intraepithelial neoplasia incidence IAGP 5509061 MGI PMID:25042889 Kras Mouse increased pancreatic intraepithelial neoplasia incidence IAGP 5509061 MGI PMID:15894267 Kras Mouse increased pancreatic intraepithelial neoplasia incidence IAGP 5509061 MGI PMID:20473331 Kras Mouse increased pancreatic intraepithelial neoplasia incidence IAGP 5509061 MGI PMID:19629168 Kras Mouse increased pancreatic intraepithelial neoplasia incidence IAGP 5509061 MGI PMID:18713982 Kras Mouse increased pancreatic intraepithelial neoplasia incidence IAGP 5509061 MGI PMID:26996122 Kras Mouse increased pancreatic intraepithelial neoplasia incidence IAGP 5509061 MGI PMID:19028876 Kras Mouse increased pancreatic intraepithelial neoplasia incidence IAGP 5509061 MGI PMID:19028870 Kras Mouse increased pancreatic intraepithelial neoplasia incidence IAGP 5509061 MGI PMID:17114585 Kras Mouse increased pancreatic intraepithelial neoplasia incidence IAGP 5509061 MGI PMID:29670173 Kras Mouse increased pancreatic intraepithelial neoplasia incidence IAGP 5509061 MGI PMID:20807812 Kras Mouse increased papilloma incidence IAGP 5509061 MGI PMID:14966562 Kras Mouse increased papilloma incidence IAGP 5509061 MGI PMID:23999427 Kras Mouse increased papilloma incidence IAGP 5509061 MGI PMID:15894267 Kras Mouse increased papilloma incidence IAGP 5509061 MGI PMID:17486075 Kras Mouse increased papilloma incidence IAGP 5509061 MGI PMID:12957286 Kras Mouse increased pituitary adenoma incidence IAGP 5509061 MGI PMID:12957286 Kras Mouse increased prostate gland adenocarcinoma incidence IAGP 5509061 MGI PMID:19117991 Kras Mouse increased prostate gland adenocarcinoma incidence IAGP 5509061 MGI PMID:22350410 Kras Mouse increased prostate gland adenocarcinoma incidence IAGP 5509061 MGI PMID:21965329 Kras Mouse increased prostate gland tumor incidence IAGP 5509061 MGI PMID:19117991 Kras Mouse increased prostate intraepithelial neoplasia incidence IAGP 5509061 MGI PMID:19117991 Kras Mouse increased prostate intraepithelial neoplasia incidence IAGP 5509061 MGI PMID:21965329 Kras Mouse increased regulatory T cell number IAGP 5509061 MGI PMID:19841240 Kras Mouse increased sarcoma incidence IAGP 5509061 MGI PMID:12957286 Kras Mouse increased sarcoma incidence IAGP 5509061 MGI PMID:17676052 Kras Mouse increased sarcoma incidence IAGP 5509061 MGI PMID:19956606 Kras Mouse increased sarcoma incidence IAGP 5509061 MGI PMID:24239359 Kras Mouse increased sarcoma incidence IAGP 5509061 MGI PMID:21512139 Kras Mouse increased sarcoma incidence IAGP 5509061 MGI PMID:22228755 Kras Mouse increased sarcoma incidence IAGP 5509061 MGI PMID:17486075 Kras Mouse increased skin papilloma incidence IAGP 5509061 MGI PMID:14966562 Kras Mouse increased skin papilloma incidence IAGP 5509061 MGI PMID:22699621 Kras Mouse increased skin papilloma incidence IAGP 5509061 MGI PMID:21502497 Kras Mouse increased skin papilloma incidence IAGP 5509061 MGI PMID:21504907 Kras Mouse increased skin papilloma incidence IAGP 5509061 MGI PMID:11323676 Kras Mouse increased skin papilloma incidence IAGP 5509061 MGI PMID:17936562 Kras Mouse increased skin papilloma incidence IAGP 5509061 MGI PMID:27462406 Kras Mouse increased skin papilloma incidence IAGP 5509061 MGI PMID:17607363 Kras Mouse increased skin squamous cell carcinoma incidence IAGP 5509061 MGI PMID:21502497 Kras Mouse increased skin squamous cell carcinoma incidence IAGP 5509061 MGI PMID:23999427 Kras Mouse increased skin tumor incidence IAGP 5509061 MGI PMID:21502497 Kras Mouse increased skin tumor incidence IAGP 5509061 MGI PMID:23999427 Kras Mouse increased spindle cell carcinoma incidence IAGP 5509061 MGI PMID:17607363 Kras Mouse increased spindle cell carcinoma incidence IAGP 5509061 MGI PMID:20697345 Kras Mouse increased spleen red pulp amount IAGP 5509061 MGI PMID:14966562 Kras Mouse increased splenocyte proliferation IAGP 5509061 MGI PMID:14699048 Kras Mouse increased squamous cell carcinoma incidence IAGP 5509061 MGI PMID:17607363 Kras Mouse increased squamous cell carcinoma incidence IAGP 5509061 MGI PMID:17486075 Kras Mouse increased stomach tumor incidence IAGP 5509061 MGI PMID:17114584 Kras Mouse increased susceptibility to induced pancreatitis IAGP 5509061 MGI PMID:31048544 Kras Mouse increased systemic arterial diastolic blood pressure IAGP 5509061 MGI PMID:15864294 Kras Mouse increased systemic arterial systolic blood pressure IAGP 5509061 MGI PMID:15864294 Kras Mouse increased T cell derived lymphoma incidence IAGP 5509061 MGI PMID:27462406 Kras Mouse increased T cell derived lymphoma incidence IAGP 5509061 MGI PMID:20832755 Kras Mouse increased T cell derived lymphoma incidence IAGP 5509061 MGI PMID:15894267 Kras Mouse increased T cell derived lymphoma incidence IAGP 5509061 MGI PMID:11323676 Kras Mouse increased T cell derived lymphoma incidence IAGP 5509061 MGI PMID:17936562 Kras Mouse increased T cell number IAGP 5509061 MGI PMID:21911454 Kras Mouse increased teratocarcinoma incidence IAGP 5509061 MGI PMID:15894267 Kras Mouse increased testis tumor incidence IAGP 5509061 MGI PMID:21860425 Kras Mouse increased thyroid carcinoma incidence IAGP 5509061 MGI PMID:19351816 Kras Mouse increased thyroxine level IAGP 5509061 MGI PMID:19351816 Kras Mouse increased trichoepithelioma incidence IAGP 5509061 MGI PMID:23999427 Kras Mouse increased tumor growth/size IAGP 5509061 MGI PMID:19151761 Kras Mouse increased tumor growth/size IAGP 5509061 MGI PMID:22430205 Kras Mouse increased tumor growth/size IAGP 5509061 MGI PMID:20832755 Kras Mouse increased tumor growth/size IAGP 5509061 MGI PMID:22228755 Kras Mouse increased tumor growth/size IAGP 5509061 MGI PMID:20697345 Kras Mouse increased tumor incidence IAGP 5509061 MGI PMID:14706336 Kras Mouse increased tumor incidence IAGP 5509061 MGI PMID:24591640 Kras Mouse increased tumor incidence IAGP 5509061 MGI PMID:24239359 Kras Mouse increased tumor incidence IAGP 5509061 MGI PMID:21458673 Kras Mouse increased tumor incidence IAGP 5509061 MGI PMID:20141835 Kras Mouse increased tumor incidence IAGP 5509061 MGI PMID:20609353 Kras Mouse increased tumor incidence IAGP 5509061 MGI PMID:11323676 Kras Mouse increased tumor incidence IAGP 5509061 MGI PMID:17486075 Kras Mouse increased tumor incidence IAGP 5509061 MGI PMID:17114584 Kras Mouse increased tumor latency IAGP 5509061 MGI PMID:17349585 Kras Mouse increased tumor-free survival time IAGP 5509061 MGI PMID:36548081 Kras Mouse increased type II pneumocyte number IAGP 5509061 MGI PMID:23285300 Kras Mouse increased urinary bladder carcinoma incidence IAGP 5509061 MGI PMID:21368895 Kras Mouse intestinal obstruction IAGP 5509061 MGI PMID:15894267 Kras Mouse intracranial hemorrhage IAGP 5509061 MGI PMID:32552404 Kras Mouse jaundice IAGP 5509061 MGI PMID:17114585 Kras Mouse jaundice IAGP 5509061 MGI PMID:27032374 Kras Mouse jaundice IAGP 5509061 MGI PMID:22113502 Kras Mouse lethality throughout fetal growth and development, complete penetrance IAGP 5509061 MGI PMID:17369402 Kras Mouse lethality, complete penetrance IAGP 5509061 MGI PMID:21502497 Kras Mouse liver hypoplasia IAGP 5509061 MGI PMID:9334313 Kras Mouse liver hypoplasia IAGP 5509061 MGI PMID:17369402 Kras Mouse lung epithelium hyperplasia IAGP 5509061 MGI PMID:20308544 Kras Mouse lung epithelium hyperplasia IAGP 5509061 MGI PMID:24276238 Kras Mouse lung epithelium hyperplasia IAGP 5509061 MGI PMID:20832755 Kras Mouse lung inflammation IAGP 5509061 MGI PMID:22964582 Kras Mouse lung inflammation IAGP 5509061 MGI PMID:27032374 Kras Mouse lung inflammation IAGP 5509061 MGI PMID:18281487 Kras Mouse lymphatic vessel hypoplasia IAGP 5509061 MGI PMID:20179099 Kras Mouse lymphedema IAGP 5509061 MGI PMID:20179099 Kras Mouse lymphoid hyperplasia IAGP 5509061 MGI PMID:14966562 Kras Mouse myeloid hyperplasia IAGP 5509061 MGI PMID:14966562 Kras Mouse myeloid hyperplasia IAGP 5509061 MGI PMID:14699048 Kras Mouse myeloid hyperplasia IAGP 5509061 MGI PMID:22932805 Kras Mouse no abnormal phenotype detected IAGP 5509061 MGI PMID:14645534 Kras Mouse no abnormal phenotype detected IAGP 5509061 MGI PMID:15864294 Kras Mouse no abnormal phenotype detected IAGP 5509061 MGI PMID:18059342 Kras Mouse no abnormal phenotype detected IAGP 5509061 MGI PMID:9294608 Kras Mouse ocular hypertelorism IAGP 5509061 MGI PMID:25359213 Kras Mouse oxidative stress IAGP 5509061 MGI PMID:26095252 Kras Mouse pale liver IAGP 5509061 MGI PMID:9334313 Kras Mouse pale yolk sac IAGP 5509061 MGI PMID:9334313 Kras Mouse pale yolk sac IAGP 5509061 MGI PMID:17369402 Kras Mouse pallor IAGP 5509061 MGI PMID:15093544 Kras Mouse pallor IAGP 5509061 MGI PMID:17369402 Kras Mouse pallor IAGP 5509061 MGI PMID:9334313 Kras Mouse pancreas cyst IAGP 5509061 MGI PMID:17114584 Kras Mouse pancreas cyst IAGP 5509061 MGI PMID:23266956 Kras Mouse pancreas cyst IAGP 5509061 MGI PMID:19629168 Kras Mouse pancreas hyperplasia IAGP 5509061 MGI PMID:19629168 Kras Mouse pancreas inflammation IAGP 5509061 MGI PMID:19629168 Kras Mouse pancreatic acinar-to-ductal metaplasia IAGP 5509061 MGI PMID:20807812 Kras Mouse pancreatic acinar-to-ductal metaplasia IAGP 5509061 MGI PMID:31048544 Kras Mouse pancreatic acinar-to-ductal metaplasia IAGP 5509061 MGI PMID:25042889 Kras Mouse paralysis IAGP 5509061 MGI PMID:17114585 Kras Mouse pericardial edema IAGP 5509061 MGI PMID:9334313 Kras Mouse perinatal lethality, complete penetrance IAGP 5509061 MGI PMID:25359213 Kras Mouse perinatal lethality, incomplete penetrance IAGP 5509061 MGI PMID:9334313 Kras Mouse perinatal lethality, incomplete penetrance IAGP 5509061 MGI PMID:25359213 Kras Mouse perinatal lethality, incomplete penetrance IAGP 5509061 MGI PMID:18059342 Kras Mouse polychromatophilia IAGP 5509061 MGI PMID:16720837 Kras Mouse postnatal growth retardation IAGP 5509061 MGI PMID:17476360 Kras Mouse postnatal growth retardation IAGP 5509061 MGI PMID:27032374 Kras Mouse postnatal lethality IAGP 5509061 MGI PMID:32552404 Kras Mouse postnatal lethality, complete penetrance IAGP 5509061 MGI PMID:9334313 Kras Mouse postnatal lethality, complete penetrance IAGP 5509061 MGI PMID:25042889 Kras Mouse postnatal lethality, complete penetrance IAGP 5509061 MGI PMID:20807812 Kras Mouse postnatal lethality, complete penetrance IAGP 5509061 MGI PMID:20308544 Kras Mouse postnatal lethality, complete penetrance IAGP 5509061 MGI PMID:18059342 Kras Mouse postnatal lethality, complete penetrance IAGP 5509061 MGI PMID:17369402 Kras Mouse postnatal lethality, incomplete penetrance IAGP 5509061 MGI PMID:17476360 Kras Mouse postnatal lethality, incomplete penetrance IAGP 5509061 MGI PMID:32552404 Kras Mouse premature death IAGP 5509061 MGI PMID:30858608 Kras Mouse premature death IAGP 5509061 MGI PMID:31048544 Kras Mouse premature death IAGP 5509061 MGI PMID:30952657 Kras Mouse premature death IAGP 5509061 MGI PMID:31685994 Kras Mouse premature death IAGP 5509061 MGI PMID:28790031 Kras Mouse premature death IAGP 5509061 MGI PMID:28846072 Kras Mouse premature death IAGP 5509061 MGI PMID:28934293 Kras Mouse premature death IAGP 5509061 MGI PMID:30423293 Kras Mouse premature death IAGP 5509061 MGI PMID:27032374 Kras Mouse premature death IAGP 5509061 MGI PMID:19351816 Kras Mouse premature death IAGP 5509061 MGI PMID:21368895 Kras Mouse premature death IAGP 5509061 MGI PMID:22350410 Kras Mouse premature death IAGP 5509061 MGI PMID:17676035 Kras Mouse premature death IAGP 5509061 MGI PMID:25359213 Kras Mouse premature death IAGP 5509061 MGI PMID:14699048 Kras Mouse premature death IAGP 5509061 MGI PMID:24430184 Kras Mouse premature death IAGP 5509061 MGI PMID:22113502 Kras Mouse premature death IAGP 5509061 MGI PMID:21514245 Kras Mouse premature death IAGP 5509061 MGI PMID:22932805 Kras Mouse premature death IAGP 5509061 MGI PMID:17349585 Kras Mouse premature death IAGP 5509061 MGI PMID:22699621 Kras Mouse premature death IAGP 5509061 MGI PMID:21860425 Kras Mouse premature death IAGP 5509061 MGI PMID:22266220 Kras Mouse premature death IAGP 5509061 MGI PMID:20832755 Kras Mouse premature death IAGP 5509061 MGI PMID:22411819 Kras Mouse premature death IAGP 5509061 MGI PMID:20807812 Kras Mouse premature death IAGP 5509061 MGI PMID:21911454 Kras Mouse premature death IAGP 5509061 MGI PMID:21965329 Kras Mouse premature death IAGP 5509061 MGI PMID:21458673 Kras Mouse premature death IAGP 5509061 MGI PMID:21504907 Kras Mouse premature death IAGP 5509061 MGI PMID:21056012 Kras Mouse premature death IAGP 5509061 MGI PMID:15894267 Kras Mouse premature death IAGP 5509061 MGI PMID:21317887 Kras Mouse premature death IAGP 5509061 MGI PMID:20308544 Kras Mouse premature death IAGP 5509061 MGI PMID:18281487 Kras Mouse premature death IAGP 5509061 MGI PMID:15619626 Kras Mouse premature death IAGP 5509061 MGI PMID:19846776 Kras Mouse premature death IAGP 5509061 MGI PMID:20697345 Kras Mouse premature death IAGP 5509061 MGI PMID:20609353 Kras Mouse premature death IAGP 5509061 MGI PMID:20233966 Kras Mouse premature death IAGP 5509061 MGI PMID:19151761 Kras Mouse premature death IAGP 5509061 MGI PMID:19117991 Kras Mouse premature death IAGP 5509061 MGI PMID:18621715 Kras Mouse premature death IAGP 5509061 MGI PMID:18372904 Kras Mouse premature death IAGP 5509061 MGI PMID:11323676 Kras Mouse premature death IAGP 5509061 MGI PMID:17936562 Kras Mouse premature death IAGP 5509061 MGI PMID:27462406 Kras Mouse premature death IAGP 5509061 MGI PMID:17486075 Kras Mouse premature death IAGP 5509061 MGI PMID:16288016 Kras Mouse premature death IAGP 5509061 MGI PMID:17468755 Kras Mouse premature death IAGP 5509061 MGI PMID:17114585 Kras Mouse premature death IAGP 5509061 MGI PMID:16288213 Kras Mouse premature death IAGP 5509061 MGI PMID:16023597 Kras Mouse premature death IAGP 5509061 MGI PMID:12957286 Kras Mouse premature death IAGP 5509061 MGI PMID:14966562 Kras Mouse prenatal lethality, complete penetrance IAGP 5509061 MGI PMID:9294608 Kras Mouse prenatal lethality, complete penetrance IAGP 5509061 MGI PMID:9334313 Kras Mouse prenatal lethality, incomplete penetrance IAGP 5509061 MGI PMID:12957286 Kras Mouse prostate gland hyperplasia IAGP 5509061 MGI PMID:19117991 Kras Mouse prostate gland hyperplasia IAGP 5509061 MGI PMID:21965329 Kras Mouse respiratory distress IAGP 5509061 MGI PMID:12957286 Kras Mouse respiratory distress IAGP 5509061 MGI PMID:21458673 Kras Mouse respiratory distress IAGP 5509061 MGI PMID:22964582 Kras Mouse respiratory distress IAGP 5509061 MGI PMID:17476360 Kras Mouse respiratory failure IAGP 5509061 MGI PMID:27032374 Kras Mouse reticulocytosis IAGP 5509061 MGI PMID:16720837 Kras Mouse ruffled hair IAGP 5509061 MGI PMID:14966562 Kras Mouse sebaceous gland hyperplasia IAGP 5509061 MGI PMID:21502497 Kras Mouse seminiferous tubule degeneration IAGP 5509061 MGI PMID:21860425 Kras Mouse short tail IAGP 5509061 MGI PMID:9334313 Kras Mouse skin lesions IAGP 5509061 MGI PMID:21502497 Kras Mouse slow postnatal weight gain IAGP 5509061 MGI PMID:25359213 Kras Mouse small heart IAGP 5509061 MGI PMID:9294608 Kras Mouse small liver IAGP 5509061 MGI PMID:9334313 Kras Mouse small pancreas IAGP 5509061 MGI PMID:38574733 Kras Mouse spleen vascular congestion IAGP 5509061 MGI PMID:25359213 Kras Mouse squamous metaplasia of bulbourethral gland IAGP 5509061 MGI PMID:19117991 Kras Mouse squamous metaplasia of urethral gland IAGP 5509061 MGI PMID:19117991 Kras Mouse stomach mucosa hyperplasia IAGP 5509061 MGI PMID:27032374 Kras Mouse submandibular gland hyperplasia IAGP 5509061 MGI PMID:15093544 Kras Mouse tachypnea IAGP 5509061 MGI PMID:18281487 Kras Mouse thick aortic valve IAGP 5509061 MGI PMID:25359213 Kras Mouse thick epidermis IAGP 5509061 MGI PMID:21502497 Kras Mouse thick pulmonary interalveolar septum IAGP 5509061 MGI PMID:19151761 Kras Mouse thin myocardium IAGP 5509061 MGI PMID:9294608 Kras Mouse thin ventricular wall IAGP 5509061 MGI PMID:9294608 Kras Mouse thrombocytopenia IAGP 5509061 MGI PMID:25359213 Kras Mouse thrombocytopenia IAGP 5509061 MGI PMID:28846072 Kras Mouse thymus atrophy IAGP 5509061 MGI PMID:28846072 Kras Mouse triangular face IAGP 5509061 MGI PMID:25359213 Kras Mouse uterus adenomyosis IAGP 5509061 MGI PMID:19841240 Kras Mouse ventricular septal defect IAGP 5509061 MGI PMID:17369402 Kras Mouse weight loss IAGP 5509061 MGI PMID:17114585 Kras Mouse weight loss IAGP 5509061 MGI PMID:28846072 Kras Mouse weight loss IAGP 5509061 MGI PMID:27032374 Kras Mouse weight loss IAGP 5509061 MGI PMID:22113502 Kras Mouse weight loss IAGP 5509061 MGI PMID:18281487 Kras Mouse weight loss IAGP 5509061 MGI PMID:22964582 Kras Mouse weight loss IAGP 5509061 MGI PMID:17476360
Acute Experimental Pancreatitis (ISO) acute lymphoblastic leukemia (ISO) acute myeloid leukemia (ISO) adenocarcinoma (ISO) adenoma (ISO) anaplastic astrocytoma (ISO) anemia (ISO) angiosarcoma (ISO) Animal Disease Models (ISO) arteriovenous malformations of the brain (IAGP,ISO) autoimmune lymphoproliferative syndrome type 4 (ISO) breast adenocarcinoma (ISO) breast cancer (ISO) Breast Cancer, Familial (ISO) Breast Neoplasms (ISO) bronchiolo-alveolar adenocarcinoma (IMP) Capillary Malformation-Arteriovenous Malformation 1 (ISO) Carcinogenesis (ISO) carcinoma (ISO) cardiofaciocutaneous syndrome (ISO) cardiofaciocutaneous syndrome 1 (ISO) cardiofaciocutaneous syndrome 2 (ISO) cardiomyopathy (IMP) Cecal Neoplasms (ISO) cholangiocarcinoma (ISO) chronic myelogenous leukemia, BCR-ABL1 positive (ISO) Colonic Neoplasms (ISO) colorectal cancer (ISO) Colorectal Neoplasms (IDA,ISO) Costello syndrome (ISO) dilated cardiomyopathy (IDA) disease of cellular proliferation (ISO) Disease Progression (ISO) Encephalocraniocutaneous Lipomatosis (ISO) endometrial adenocarcinoma (ISO) endometrial carcinoma (ISO) endometrial hyperplasia (ISO) Endometrial Hyperplasia without Atypia (ISO) Endometrial Intraepithelial Neoplasia (ISO) Endometrial Neoplasms (ISO) Endometrioid Carcinomas (ISO) endometriosis (IAGP,ISO) epidermal nevus (ISO) Experimental Liver Neoplasms (ISO) Experimental Neoplasms (ISO) Experimental Sarcoma (ISO) Familial Pancreatic Carcinoma (ISO) fibrillary astrocytoma (ISO) follicular thyroid carcinoma (ISO) gallbladder cancer (ISO) Gallbladder Neoplasms (ISO) gastrointestinal stromal tumor (ISO) genetic disease (ISO) glioblastoma (IMP,ISO) hepatocellular adenoma (ISO) hepatocellular carcinoma (ISO) hereditary breast ovarian cancer syndrome (ISO) hereditary diffuse gastric cancer (ISO) high grade glioma (IMP,ISO) Hodgkin's lymphoma (ISO) Hydrops Fetalis (ISO) hypertension (IDA) intellectual disability (ISO) intrahepatic cholangiocarcinoma (IAGP,ISO) juvenile myelomonocytic leukemia (IAGP,ISO) juvenile rheumatoid arthritis (ISO) Kidney Neoplasms (ISO) Klatskin's tumor (ISO) Leukocytosis (ISO) linear nevus sebaceous syndrome (ISO) Liver Neoplasms (ISO) lung adenocarcinoma (ISO) lung cancer (IAGP,ISO) lung carcinoma (ISO) Lung Neoplasms (IMP,ISO) lung non-small cell carcinoma (ISO) Lung Reperfusion Injury (IEP) lung sarcomatoid carcinoma (ISO) lung squamous cell carcinoma (ISO) lymphoma (ISO) Lynch syndrome (ISO) malignant astrocytoma (IGI,ISO) Mouth Neoplasms (ISO) Multiple Abnormalities (ISO) multiple myeloma (ISO) muscular atrophy (ISO) myelodysplastic syndrome (ISO) myeloid neoplasm (IMP) myeloid sarcoma (ISO) Neoplasm Metastasis (IEP,ISO) Neoplastic Cell Transformation (ISO) neuroblastoma (ISO) Noonan syndrome (IMP,ISO) Noonan syndrome 1 (ISO) Noonan syndrome 3 (IAGP,ISO) oculoectodermal syndrome (ISO) Ovarian Neoplasms (ISO) ovary serous adenocarcinoma (ISO) pancreatic cancer (ISO) pancreatic carcinoma (IAGP,ISO) pancreatic ductal carcinoma (ISO) pancreatic mucinous cystadenoma (ISO) Paraproteinemias (ISO) Parasitic Liver Diseases (ISO) Penile Neoplasms (ISO) pilocytic astrocytoma (ISO) plasma cell neoplasm (ISO) prostate cancer (IAGP) Prostate Cancer, Hereditary, 1 (ISO) prostate carcinoma in situ (IAGP) Prostatic Neoplasms (IAGP,ISO) RASopathy (ISO) Recurrence (ISO) renal cell carcinoma (ISO) renal fibrosis (ISO) Sebaceous Nevus Syndrome and Hemimegalencephaly (ISO) seminoma (ISO) Splenomegaly (ISO) squamous cell carcinoma (ISO) stomach cancer (ISO) stomach carcinoma (ISO) Stomach Neoplasms (ISO) T-cell acute lymphoblastic leukemia (IMP) teratoma (ISO) Thyroid Carcinoma, Nonmedullary 1 (ISO) Thyroid Neoplasms (ISO) transitional cell carcinoma (ISO) Triple Negative Breast Neoplasms (ISO) urinary bladder cancer (ISO) Urinary Bladder Neoplasm (ISO) Uterine Cervical Neoplasms (ISO) Uterine Neoplasms (ISO) Vascular Malformations (ISO)
(S)-colchicine (EXP) (S)-naringenin (ISO) (trichloromethyl)benzene (EXP) 1,1-dichloroethene (EXP) 1,2-dimethylhydrazine (EXP) 1-nitropyrene (EXP) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (EXP,ISO) 2,2-Bis(bromomethyl)propane-1,3-diol (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (ISO) 2,6-di-tert-butyl-4-methylphenol (EXP) 2,6-dimethoxyphenol (ISO) 2-trans,6-trans-farnesyl diphosphate (ISO) 3-methyl-3H-imidazo[4,5-f]quinolin-2-amine (ISO) 3-methylcholanthrene (EXP) 4,4'-sulfonyldiphenol (EXP) 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one (EXP,ISO) 4-nitrophenol (EXP) 4-vinylcyclohexene dioxide (EXP) 5-aza-2'-deoxycytidine (ISO) 5-fluorouracil (ISO) 5-Methylchrysene (EXP) acrolein (ISO) actinomycin D (ISO) afimoxifene (ISO) ammonium chloride (ISO) amphetamine (ISO) antirheumatic drug (ISO) Antrocin (ISO) aristolochic acid A (ISO) Aroclor 1254 (EXP) ARS-1620 (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) asbestos (ISO) Azoxymethane (EXP,ISO) Benz[j]aceanthrylene (EXP) benzene (EXP) benzo[a]pyrene (EXP,ISO) benzo[a]pyrene diol epoxide I (ISO) benzo[b]fluoranthene (EXP) bisphenol A (EXP,ISO) bleomycin A2 (EXP) buta-1,3-diene (EXP) cadmium atom (ISO) cadmium dichloride (ISO) cannabidiol (ISO) carbamazepine (ISO) carbon nanotube (EXP) ceruletide (EXP) CGP 52608 (ISO) chloroethene (EXP,ISO) chloroprene (EXP) chlorpyrifos (ISO) chymostatin (ISO) cisplatin (ISO) clofibrate (EXP) cobalt atom (EXP,ISO) cobimetinib (ISO) copper atom (ISO) copper(0) (ISO) coumestrol (ISO) crizotinib (ISO) cumene (EXP) Cuprizon (ISO) curcumin (EXP,ISO) cycloheximide (ISO) Cyclopenta[cd]pyrene (EXP) dabrafenib (ISO) dextran sulfate (EXP) dibenzo[a,l]pyrene (EXP) Dibutyl phosphate (ISO) dichlorine (ISO) diclofenac (ISO) dioxygen (ISO) dorsomorphin (ISO) doxorubicin (ISO) emamectin benzoate (ISO) erlotinib hydrochloride (ISO) ethanol (EXP) farnesyl diphosphate (ISO) flutamide (ISO) folic acid (EXP) furfural (ISO) GDP (ISO) gefitinib (ISO) genistein (ISO) gentamycin (ISO) geraniol (ISO) GTP (ISO) guanosine (ISO) haloperidol (ISO) hydrogen peroxide (EXP) hydroquinone (ISO) hydroxyurea (EXP) ionomycin (ISO) irbesartan (EXP,ISO) isoprenaline (EXP) isoprene (EXP) isotretinoin (ISO) ivermectin (ISO) kainic acid (ISO) L-744832 (ISO) lapatinib (ISO) lead diacetate (EXP,ISO) lead(0) (EXP) lipopolysaccharide (EXP,ISO) losartan (ISO) lovastatin (EXP,ISO) luzindole (EXP) manumycin A (ISO) MeIQx (ISO) mercury dibromide (ISO) metformin (ISO) methohexital (ISO) methotrexate (ISO) metyrapone (ISO) monosodium L-glutamate (ISO) Morindone (ISO) N,N-bis(2-hydroxypropyl)nitrosamine (ISO) N-acetyl-L-cysteine (ISO) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO) N-ethyl-N-nitrosourea (EXP) N-methyl-N'-nitro-N-nitrosoguanidine (ISO) N-methyl-N-nitrosourea (EXP,ISO) N-nitrosodiethylamine (EXP,ISO) N-nitrosodimethylamine (EXP) nicotinic acid (EXP) nitrates (EXP) ochratoxin A (ISO) oncrasin-1 (ISO) oxirane (EXP) oxybenzone (ISO) ozone (ISO) p-chloromercuribenzoic acid (ISO) paclitaxel (ISO) paracetamol (EXP) PD 0325901 (EXP,ISO) pemetrexed (ISO) pentobarbital (ISO) phlorizin (EXP) phorbol 13-acetate 12-myristate (EXP,ISO) picrotoxin (ISO) piperonyl butoxide (ISO) pirinixic acid (ISO) quercetin (ISO) Rebamipide (ISO) resveratrol (EXP,ISO) riddelliine (EXP) sarin (ISO) SB 431542 (ISO) secobarbital (ISO) selumetinib (ISO) sevoflurane (ISO) simvastatin (ISO) sodium arsenite (EXP,ISO) sodium chloride (ISO) Soman (ISO) sotorasib (ISO) styrene (EXP) sulfur dioxide (ISO) sulindac (ISO) sunitinib (ISO) tacrolimus hydrate (EXP) Tanshinone I (EXP,ISO) Temsirolimus (ISO) testosterone enanthate (ISO) tetrachloromethane (EXP,ISO) Tetranitromethane (EXP) thiamylal (ISO) thimerosal (ISO) thioacetamide (ISO) tiazofurine (ISO) tipifarnib (ISO) titanium dioxide (EXP) toluene (ISO) trimetrexate (ISO) Triptolide (ISO) triptonide (EXP) urethane (EXP,ISO) ursodeoxycholic acid (ISO) valproic acid (ISO) vemurafenib (ISO) vinyl carbamate (EXP) zearalenone (EXP) zidovudine (EXP) zinc protoporphyrin (ISO) zoledronic acid (ISO)
Mammalian Phenotype
abnormal astrocyte morphology (IAGP) abnormal atrioventricular valve morphology (IAGP) abnormal blood cell morphology/development (IAGP) abnormal bone marrow cell physiology (IAGP) abnormal brain development (IAGP) abnormal brain vasculature morphology (IAGP) abnormal branching involved in lung morphogenesis (IAGP) abnormal bronchiole morphology (IAGP) abnormal bronchoalveolar duct junction morphology (IAGP) abnormal bronchus epithelium morphology (IAGP) abnormal bronchus morphology (IAGP) abnormal cardiovascular system physiology (IAGP) abnormal cell cycle (IAGP) abnormal cell morphology (IAGP) abnormal cell proliferation (IAGP) abnormal centrosome morphology (IAGP) abnormal CNS glial cell morphology (IAGP) abnormal colon goblet cell morphology (IAGP) abnormal colon morphology (IAGP) abnormal common lymphocyte progenitor cell morphology (IAGP) abnormal common myeloid progenitor cell morphology (IAGP) abnormal cone electrophysiology (IAGP) abnormal cranium morphology (IAGP) abnormal cystic duct morphology (IAGP) abnormal definitive hematopoiesis (IAGP) abnormal DNA repair (IAGP) abnormal duodenum morphology (IAGP) abnormal ear position (IAGP) abnormal embryonic erythrocyte morphology (IAGP) abnormal embryonic erythropoiesis (IAGP) abnormal embryonic hematopoiesis (IAGP) abnormal embryonic neuroepithelium morphology (IAGP) abnormal enterocyte proliferation (IAGP) abnormal erythrocyte morphology (IAGP) abnormal erythropoiesis (IAGP) abnormal exocrine pancreas morphology (IAGP) abnormal extrahepatic bile duct morphology (IAGP) abnormal eye development (IAGP) abnormal facial morphology (IAGP) abnormal fetal cardiomyocyte proliferation (IAGP) abnormal fibroblast proliferation (IAGP) abnormal gallbladder morphology (IAGP) abnormal heart morphology (IAGP) abnormal hematopoietic system morphology/development (IAGP) abnormal hepatic portal vein morphology (IAGP) abnormal hepatic portal vein thrombosis (IAGP) abnormal hepatobiliary system morphology (IAGP) abnormal hepatocyte morphology (IAGP) abnormal hippocampus morphology (IAGP) abnormal intestinal epithelium morphology (IAGP) abnormal intestinal goblet cell morphology (IAGP) abnormal intestine morphology (IAGP) abnormal kidney morphology (IAGP) abnormal lacrimal gland development (IAGP) abnormal large intestine crypts of Lieberkuhn morphology (IAGP) abnormal liver morphology (IAGP) abnormal lung adenoma incidence (IAGP) abnormal lung development (IAGP) abnormal lung epithelium morphology (IAGP) abnormal lung morphology (IAGP) abnormal lymphatic vessel morphology (IAGP) abnormal melanocyte morphology (IAGP) abnormal metabolism (IAGP) abnormal metastatic potential (IAGP) abnormal mismatch repair (IAGP) abnormal myeloid leukocyte morphology (IAGP) abnormal myelopoiesis (IAGP) abnormal myocardial fiber physiology (IAGP) abnormal ovary morphology (IAGP) abnormal pancreas development (IAGP) abnormal pancreas morphology (IAGP) abnormal pancreatic acinar cell morphology (IAGP) abnormal pancreatic duct morphology (IAGP) abnormal peritoneum morphology (IAGP) abnormal placenta labyrinth morphology (IAGP) abnormal placental labyrinth vasculature morphology (IAGP) abnormal prostate gland morphology (IAGP) abnormal prostate gland physiology (IAGP) abnormal pulmonary alveolus morphology (IAGP) abnormal rod electrophysiology (IAGP) abnormal skin sebaceous gland morphology (IAGP) abnormal spleen morphology (IAGP) abnormal survival (IAGP) abnormal systemic arterial blood pressure (IAGP) abnormal translation (IAGP) abnormal tumor incidence (IAGP) abnormal tumor morphology (IAGP) absent lacrimal glands (IAGP) absent Paneth cells (IAGP) absent visceral yolk sac blood islands (IAGP) absent vitelline blood vessels (IAGP) anemia (IAGP) anisopoikilocytosis (IAGP) arteriovenous malformation (IAGP) ascites (IAGP) bile duct hyperplasia (IAGP) bronchial epithelial hyperplasia (IAGP) bronchiolar epithelial hyperplasia (IAGP) cachexia (IAGP) cardiac fibrosis (IAGP) cellular necrosis (IAGP) cholestasis (IAGP) chromosomal instability (IAGP) chromosome breakage (IAGP) chylous ascites (IAGP) conotruncal ridge hyperplasia (IAGP) decreased a-wave amplitude (IAGP) decreased B cell number (IAGP) decreased b-wave amplitude (IAGP) decreased body length (IAGP) decreased body size (IAGP) decreased CD8-positive, alpha-beta T cell number (IAGP) decreased cell proliferation (IAGP) decreased circulating estradiol level (IAGP) decreased circulating progesterone level (IAGP) decreased circulating thyroid-stimulating hormone level (IAGP) decreased classified tumor incidence (IAGP) decreased cranium length (IAGP) decreased double-negative T cell number (IAGP) decreased double-positive T cell number (IAGP) decreased embryo size (IAGP) decreased fibroblast proliferation (IAGP) decreased gland tumor incidence (IAGP) decreased glutamic acid level (IAGP) decreased heart left ventricle muscle contractility (IAGP) decreased hematocrit (IAGP) decreased hematopoietic stem cell number (IAGP) decreased hemoglobin content (IAGP) decreased incidence of induced tumors (IAGP) decreased incidence of tumors by chemical induction (IAGP) decreased interferon-gamma secretion (IAGP) decreased lung tumor incidence (IAGP) decreased lymphocyte cell number (IAGP) decreased lymphoma incidence (IAGP) decreased mean corpuscular hemoglobin (IAGP) decreased metastatic potential (IAGP) decreased ovarian tumor incidence (IAGP) decreased skin tumor incidence (IAGP) decreased survivor rate (IAGP) decreased susceptibility to induced pancreatitis (IAGP) decreased T cell number (IAGP) decreased tumor growth/size (IAGP) decreased tumor incidence (IAGP) decreased tumor latency (IAGP) decreased tumor-free survival time (IAGP) dilated bile duct (IAGP) dilated cardiomyopathy (IAGP) dilated gallbladder (IAGP) dilated heart (IAGP) dilated pancreatic duct (IAGP) dilated respiratory conducting tube (IAGP) disorganized pancreatic islets (IAGP) distended abdomen (IAGP) distended pericardium (IAGP) double outlet right ventricle (IAGP) early cellular replicative senescence (IAGP) edema (IAGP) embryonic growth arrest (IAGP) embryonic growth retardation (IAGP) embryonic lethality during organogenesis, complete penetrance (IAGP) embryonic lethality during organogenesis, incomplete penetrance (IAGP) embryonic lethality, complete penetrance (IAGP) embryonic lethality, incomplete penetrance (IAGP) enlarged heart (IAGP) enlarged liver (IAGP) enlarged lung (IAGP) enlarged pancreas (IAGP) enlarged pancreatic islets (IAGP) enlarged sebaceous gland (IAGP) enlarged spleen (IAGP) enlarged thyroid gland (IAGP) epidermal hyperplasia (IAGP) excessive folding of visceral yolk sac (IAGP) exocrine pancreas atrophy (IAGP) exocrine pancreatic insufficiency (IAGP) extramedullary hematopoiesis (IAGP) fetal growth retardation (IAGP) flattened snout (IAGP) Harderian gland hyperplasia (IAGP) heart hyperplasia (IAGP) hemoperitoneum (IAGP) hemorrhage (IAGP) hemorrhagic ascites (IAGP) hepatic necrosis (IAGP) hepatosplenomegaly (IAGP) hunched posture (IAGP) hydrops fetalis (IAGP) hyperpigmentation (IAGP) hypertension (IAGP) impaired branching involved in bronchus morphogenesis (IAGP) impaired branching involved in terminal bronchiole morphogenesis (IAGP) impaired granulosa cell differentiation (IAGP) increased adenocarcinoma incidence (IAGP) increased adenoma incidence (IAGP) increased apoptosis (IAGP) increased B cell number (IAGP) increased basophil cell number (IAGP) increased body weight (IAGP) increased carcinoma incidence (IAGP) increased cardiac muscle contractility (IAGP) increased cardiac output (IAGP) increased cell proliferation (IAGP) increased cellular sensitivity to oxidative stress (IAGP) increased cholangiocarcinoma incidence (IAGP) increased circulating erythropoietin level (IAGP) increased circulating follicle stimulating hormone level (IAGP) increased circulating luteinizing hormone level (IAGP) increased classified tumor incidence (IAGP) increased colon adenoma incidence (IAGP) increased cranium height (IAGP) increased cranium width (IAGP) increased cutaneous melanoma incidence (IAGP) increased dendritic cell number (IAGP) increased embryonic neuroepithelium apoptosis (IAGP) increased embryonic tissue cell apoptosis (IAGP) increased endometrial carcinoma incidence (IAGP) increased eosinophil cell number (IAGP) increased esophageal papilloma incidence (IAGP) increased facial tumor incidence (IAGP) increased fibroblast proliferation (IAGP) increased fibrosarcoma incidence (IAGP) increased gastrointestinal tumor incidence (IAGP) increased granulocyte monocyte progenitor cell number (IAGP) increased granulocyte number (IAGP) increased granulosa cell tumor incidence (IAGP) increased hair follicle cell proliferation (IAGP) increased hamartoma incidence (IAGP) increased hemangiosarcoma incidence (IAGP) increased hematopoietic stem cell number (IAGP) increased hemolymphoid system tumor incidence (IAGP) increased hepatocellular carcinoma incidence (IAGP) increased hepatocyte apoptosis (IAGP) increased IgG level (IAGP) increased IgM level (IAGP) increased incidence of tumors by chemical induction (IAGP) increased inflammatory response (IAGP) increased intestinal adenocarcinoma incidence (IAGP) increased leukemia incidence (IAGP) increased leukocyte cell number (IAGP) increased lip tumor incidence (IAGP) increased liver tumor incidence (IAGP) increased lung adenocarcinoma incidence (IAGP) increased lung adenoma incidence (IAGP) increased lung carcinoma incidence (IAGP) increased lung large cell carcinoma incidence (IAGP) increased lung non-small cell carcinoma incidence (IAGP) increased lung squamous cell carcinoma incidence (IAGP) increased lung tumor incidence (IAGP) increased lung weight (IAGP) increased lymphoblastic lymphoma incidence (IAGP) increased lymphoma incidence (IAGP) increased macrophage cell number (IAGP) increased malignant tumor incidence (IAGP) increased melanoma incidence (IAGP) increased mesothelioma incidence (IAGP) increased metastatic potential (IAGP) increased monocyte cell number (IAGP) increased mouth tumor incidence (IAGP) increased myeloid cell number (IAGP) increased myeloid cell number in bone marrow (IAGP) increased myocardial fiber number (IAGP) increased myocardial fiber size (IAGP) increased neurofibroma incidence (IAGP) increased neurofibrosarcoma incidence (IAGP) increased neuron apoptosis (IAGP) increased neutrophil cell number (IAGP) increased oral papilloma incidence (IAGP) increased organ/body region tumor incidence (IAGP) increased osteosarcoma incidence (IAGP) increased ovary tumor incidence (IAGP) increased pancreas adenoma incidence (IAGP) increased pancreas apoptosis (IAGP) increased pancreas tumor incidence (IAGP) increased pancreas weight (IAGP) increased pancreatic acinar cell carcinoma incidence (IAGP) increased pancreatic ductal adenocarcinoma incidence (IAGP) increased pancreatic intraepithelial neoplasia incidence (IAGP) increased papilloma incidence (IAGP) increased pituitary adenoma incidence (IAGP) increased prostate gland adenocarcinoma incidence (IAGP) increased prostate gland tumor incidence (IAGP) increased prostate intraepithelial neoplasia incidence (IAGP) increased regulatory T cell number (IAGP) increased sarcoma incidence (IAGP) increased skin papilloma incidence (IAGP) increased skin squamous cell carcinoma incidence (IAGP) increased skin tumor incidence (IAGP) increased spindle cell carcinoma incidence (IAGP) increased spleen red pulp amount (IAGP) increased splenocyte proliferation (IAGP) increased squamous cell carcinoma incidence (IAGP) increased stomach tumor incidence (IAGP) increased susceptibility to induced pancreatitis (IAGP) increased systemic arterial diastolic blood pressure (IAGP) increased systemic arterial systolic blood pressure (IAGP) increased T cell derived lymphoma incidence (IAGP) increased T cell number (IAGP) increased teratocarcinoma incidence (IAGP) increased testis tumor incidence (IAGP) increased thyroid carcinoma incidence (IAGP) increased thyroxine level (IAGP) increased trichoepithelioma incidence (IAGP) increased tumor growth/size (IAGP) increased tumor incidence (IAGP) increased tumor latency (IAGP) increased tumor-free survival time (IAGP) increased type II pneumocyte number (IAGP) increased urinary bladder carcinoma incidence (IAGP) intestinal obstruction (IAGP) intracranial hemorrhage (IAGP) jaundice (IAGP) lethality throughout fetal growth and development, complete penetrance (IAGP) lethality, complete penetrance (IAGP) liver hypoplasia (IAGP) lung epithelium hyperplasia (IAGP) lung inflammation (IAGP) lymphatic vessel hypoplasia (IAGP) lymphedema (IAGP) lymphoid hyperplasia (IAGP) myeloid hyperplasia (IAGP) no abnormal phenotype detected (IAGP) ocular hypertelorism (IAGP) oxidative stress (IAGP) pale liver (IAGP) pale yolk sac (IAGP) pallor (IAGP) pancreas cyst (IAGP) pancreas hyperplasia (IAGP) pancreas inflammation (IAGP) pancreatic acinar-to-ductal metaplasia (IAGP) paralysis (IAGP) pericardial edema (IAGP) perinatal lethality, complete penetrance (IAGP) perinatal lethality, incomplete penetrance (IAGP) polychromatophilia (IAGP) postnatal growth retardation (IAGP) postnatal lethality (IAGP) postnatal lethality, complete penetrance (IAGP) postnatal lethality, incomplete penetrance (IAGP) premature death (IAGP) prenatal lethality, complete penetrance (IAGP) prenatal lethality, incomplete penetrance (IAGP) prostate gland hyperplasia (IAGP) respiratory distress (IAGP) respiratory failure (IAGP) reticulocytosis (IAGP) ruffled hair (IAGP) sebaceous gland hyperplasia (IAGP) seminiferous tubule degeneration (IAGP) short tail (IAGP) skin lesions (IAGP) slow postnatal weight gain (IAGP) small heart (IAGP) small liver (IAGP) small pancreas (IAGP) spleen vascular congestion (IAGP) squamous metaplasia of bulbourethral gland (IAGP) squamous metaplasia of urethral gland (IAGP) stomach mucosa hyperplasia (IAGP) submandibular gland hyperplasia (IAGP) tachypnea (IAGP) thick aortic valve (IAGP) thick epidermis (IAGP) thick pulmonary interalveolar septum (IAGP) thin myocardium (IAGP) thin ventricular wall (IAGP) thrombocytopenia (IAGP) thymus atrophy (IAGP) triangular face (IAGP) uterus adenomyosis (IAGP) ventricular septal defect (IAGP) weight loss (IAGP)
1.
GFAP-Cre-mediated activation of oncogenic K-ras results in expansion of the subventricular zone and infiltrating glioma.
Abel TW, etal., Mol Cancer Res. 2009 May;7(5):645-53. doi: 10.1158/1541-7786.MCR-08-0477. Epub 2009 May 12.
2.
Cigarette smoking is strongly associated with mutation of the K-ras gene in patients with primary adenocarcinoma of the lung.
Ahrendt SA, etal., Cancer. 2001 Sep 15;92(6):1525-30.
3.
Association in the expression of Kirsten-ras oncogene and the major histocompatibility complex class I antigens in fibrosarcoma tumor cell variants exhibiting different metastatic capabilities.
Alon Y, etal., Cancer Res. 1987 May 15;47(10):2553-7.
4.
The molecular biology of endometrial cancers and the implications for pathogenesis, classification, and targeted therapies.
Bansal N, etal., Cancer Control. 2009 Jan;16(1):8-13.
5.
Biochemical characterization of a novel KRAS insertion mutation from a human leukemia.
Bollag G, etal., J Biol Chem. 1996 Dec 20;271(51):32491-4.
6.
Activation of RAS family genes in urothelial carcinoma.
Boulalas I, etal., J Urol. 2009 May;181(5):2312-9. Epub 2009 Mar 19.
7.
Long noncoding RNA H19 mediates melatonin inhibition of premature senescence of c-kit(+) cardiac progenitor cells by promoting miR-675.
Cai B, etal., J Pineal Res. 2016 Aug;61(1):82-95. doi: 10.1111/jpi.12331. Epub 2016 Apr 29.
8.
K-ras codon 12 and 61 point mutations in bromodeoxyuridine- and N-nitrosomethylurea-induced rat renal mesenchymal tumors.
Calvert RJ, etal., Cancer Lett. 1996 Dec 3;109(1-2):1-7.
9.
The degradation of cell cycle regulators by SKP2/CKS1 ubiquitin ligase is genetically controlled in rodent liver cancer and contributes to determine the susceptibility to the disease.
Calvisi DF, etal., Int J Cancer. 2009 Jun 16.
10.
ZFP36 protects lungs from intestinal I/R-induced injury and fibrosis through the CREBBP/p53/p21/Bax pathway.
Cao Y, etal., Cell Death Dis. 2021 Jul 8;12(7):685. doi: 10.1038/s41419-021-03950-y.
11.
Mutant KRAS, chromosomal instability and prognosis in colorectal cancer.
Castagnola P and Giaretti W, Biochim Biophys Acta. 2005 Nov 25;1756(2):115-25. Epub 2005 Jul 13.
12.
Mutational analysis of KRAS, BRAF, and TP53 genes of ovarian serous carcinomas in Korean women.
Cho YH, etal., Yonsei Med J. 2009 Apr 30;50(2):266-72.
13.
Myocardial KRAS(G12D) expression does not cause cardiomyopathy in mice.
Dalin MG, etal., Cardiovasc Res. 2014 Feb 1;101(2):229-35. doi: 10.1093/cvr/cvt260. Epub 2013 Nov 20.
14.
Wild type Kirsten rat sarcoma is a novel microRNA-622-regulated therapeutic target for hepatocellular carcinoma and contributes to sorafenib resistance.
Dietrich P, etal., Gut. 2018 Jul;67(7):1328-1341. doi: 10.1136/gutjnl-2017-315402. Epub 2017 Dec 23.
15.
Mutations of the KRAS oncogene in endometrial hyperplasia and carcinoma.
Dobrzycka B, etal., Folia Histochem Cytobiol. 2009;47(1):65-8.
16.
Circulating free DNA, p53 antibody and mutations of KRAS gene in endometrial cancer.
Dobrzycka B, etal., Int J Cancer. 2009 Dec 3.
17.
MiR-193a-3p is an Important Tumour Suppressor in Lung Cancer and Directly Targets KRAS.
Fan Q, etal., Cell Physiol Biochem. 2017;44(4):1311-1324. doi: 10.1159/000485491. Epub 2017 Nov 29.
18.
Comprehensive analysis of genomic alterations of Chinese hilar cholangiocarcinoma patients.
Feng F, etal., Int J Clin Oncol. 2021 Apr;26(4):717-727. doi: 10.1007/s10147-020-01846-z. Epub 2021 Jan 2.
19.
Involvement of Gpr125 in the myeloid sarcoma formation induced by cooperating MLL/AF10(OM-LZ) and oncogenic KRAS in a mouse bone marrow transplantation model.
Fu JF, etal., Int J Cancer. 2013 Oct 15;133(8):1792-802. doi: 10.1002/ijc.28195. Epub 2013 May 7.
20.
Mucinous cystic neoplasms of the liver and pancreas: relationship between KRAS driver mutations and disease progression.
Fujikura K, etal., Histopathology. 2017 Oct;71(4):591-600. doi: 10.1111/his.13271. Epub 2017 Aug 2.
21.
Pathogenetic pathways in ovarian endometrioid adenocarcinoma: a molecular study of 29 cases.
Geyer JT, etal., Am J Surg Pathol. 2009 Aug;33(8):1157-63.
22.
TP53 and KRAS2 mutations in plasma DNA of healthy subjects and subsequent cancer occurrence: a prospective study.
Gormally E, etal., Cancer Res. 2006 Jul 1;66(13):6871-6.
23.
Detection of a rare point mutation in Ki-ras of a human bladder cancer xenograft by polymerase chain reaction and direct sequencing.
Grimmond SM, etal., Urol Res. 1992;20(2):121-6.
24.
The inv(3)(q21q26)/t(3;3)(q21;q26) is frequently accompanied by alterations of the RUNX1, KRAS and NRAS and NF1 genes and mediates adverse prognosis both in MDS and in AML: a study in 39 cases of MDS or AML.
Haferlach C, etal., Leukemia. 2011 May;25(5):874-7. doi: 10.1038/leu.2011.5. Epub 2011 Feb 1.
25.
K-RasV14I recapitulates Noonan syndrome in mice.
Hernandez-Porras I, etal., Proc Natl Acad Sci U S A. 2014 Nov 18;111(46):16395-400. doi: 10.1073/pnas.1418126111. Epub 2014 Oct 30.
26.
Essential role for Ras signaling in glioblastoma maintenance.
Holmen SL and Williams BO, Cancer Res. 2005 Sep 15;65(18):8250-5. doi: 10.1158/0008-5472.CAN-05-1173.
27.
Kras, Egfr, and Tp53 Mutations in B6C3F1/N Mouse and F344/NTac Rat Alveolar/Bronchiolar Carcinomas Resulting from Chronic Inhalation Exposure to Cobalt Metal.
Hong HH, etal., Toxicol Pathol. 2015 Aug;43(6):872-82. doi: 10.1177/0192623315581192. Epub 2015 Jun 9.
28.
Core signaling pathways in human pancreatic cancers revealed by global genomic analyses.
Jones S, etal., Science. 2008 Sep 26;321(5897):1801-6. Epub 2008 Sep 4.
29.
Higher expression of K-ras is associated with parathyroid hormone-related protein-induced hypercalcaemia in renal cell carcinoma.
Kamai T, etal., BJU Int. 2001 Dec;88(9):960-6.
30.
Notch1 gene mutations target KRAS G12D-expressing CD8+ cells and contribute to their leukemogenic transformation.
Kong G, etal., J Biol Chem. 2013 Jun 21;288(25):18219-27. doi: 10.1074/jbc.M113.475376. Epub 2013 May 14.
31.
The human c-Kirsten ras gene is activated by a novel mutation in codon 13 in the breast carcinoma cell line MDA-MB231.
Kozma SC, etal., Nucleic Acids Res. 1987 Aug 11;15(15):5963-71.
32.
KRAS Status as an Independent Prognostic Factor for Survival after Yttrium-90 Radioembolization Therapy for Unresectable Colorectal Cancer Liver Metastases.
Lahti SJ, etal., J Vasc Interv Radiol. 2015 Aug;26(8):1102-11. doi: 10.1016/j.jvir.2015.05.032.
33.
Clinicopathologic significance of the K-ras gene codon 12 point mutation in stomach cancer. An analysis of 140 cases.
Lee KH, etal., Cancer. 1995 Jun 15;75(12):2794-801.
34.
Detection of KRAS mutations and their associations with clinicopathological features and survival in Chinese colorectal cancer patients.
Li Z, etal., J Int Med Res. 2012;40(4):1589-98. doi: 10.1177/147323001204000439.
35.
TSC1 loss synergizes with KRAS activation in lung cancer development in the mouse and confers rapamycin sensitivity.
Liang MC, etal., Oncogene. 2010 Mar 18;29(11):1588-97. doi: 10.1038/onc.2009.452. Epub 2009 Dec 7.
36.
Down-regulation of K-ras and H-ras in human brain gliomas.
Lymbouridou R, etal., Eur J Cancer. 2009 May;45(7):1294-303. doi: 10.1016/j.ejca.2008.12.028. Epub 2009 Jan 27.
37.
A MEK inhibitor abrogates myeloproliferative disease in Kras mutant mice.
Lyubynska N, etal., Sci Transl Med. 2011 Mar 30;3(76):76ra27. doi: 10.1126/scitranslmed.3001069.
38.
Frameshift mutational target gene analysis identifies similarities and differences in constitutional mismatch repair-deficiency and Lynch syndrome.
Maletzki C, etal., Mol Carcinog. 2017 Jul;56(7):1753-1764. doi: 10.1002/mc.22632. Epub 2017 Mar 30.
39.
KRAS and CREBBP mutations: a relapse-linked malicious liaison in childhood high hyperdiploid acute lymphoblastic leukemia.
Malinowska-Ozdowy K, etal., Leukemia. 2015 Aug;29(8):1656-67. doi: 10.1038/leu.2015.107. Epub 2015 Apr 28.
40.
Transcriptional activation of H- and N-ras oncogenes in human cervical cancer.
Mammas IN, etal., Gynecol Oncol. 2004 Mar;92(3):941-8.
41.
Activating KRAS mutation is prognostic only among patients who receive preoperative chemotherapy before resection of colorectal liver metastases.
Margonis GA, etal., J Surg Oncol. 2016 Sep;114(3):361-7. doi: 10.1002/jso.24319. Epub 2016 Jun 6.
42.
MGDs mouse GO annotations
MGD data from the GO Consortium
43.
MGD IEA
MGD IEA
44.
Loss of p53 cooperates with K-ras activation to induce glioma formation in a region-independent manner.
Muñoz DM, etal., Glia. 2013 Nov;61(11):1862-72. doi: 10.1002/glia.22563. Epub 2013 Aug 30.
45.
Germline KRAS and BRAF mutations in cardio-facio-cutaneous syndrome.
Niihori T, etal., Nat Genet. 2006 Mar;38(3):294-6. Epub 2006 Feb 12.
46.
K-ras point mutation in the nerve plexuses around the superior mesenteric artery in resectable adenocarcinoma of the pancreatic head: distribution pattern and related factors.
Ohigashi H, etal., Arch Surg. 2000 Dec;135(12):1450-5.
47.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
48.
N-RAS and K-RAS gene mutations in Brazilian patients with multiple myeloma.
Ortega MM, etal., Leuk Lymphoma. 2006 Feb;47(2):285-9.
49.
The prevalence and prognostic significance of KRAS mutation in bladder cancer, chronic myeloid leukemia and colorectal cancer.
Ouerhani S, etal., Mol Biol Rep. 2013 Jun;40(6):4109-14. doi: 10.1007/s11033-013-2512-8. Epub 2013 May 3.
50.
Mutations of FLT3, NRAS, KRAS, and PTPN11 are frequent and possibly mutually exclusive in high hyperdiploid childhood acute lymphoblastic leukemia.
Paulsson K, etal., Genes Chromosomes Cancer. 2008 Jan;47(1):26-33.
51.
K-ras and Wnt signaling synergize to accelerate prostate tumorigenesis in the mouse.
Pearson HB, etal., Cancer Res. 2009 Jan 1;69(1):94-101.
52.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
53.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
54.
Replacement of K-Ras with H-Ras supports normal embryonic development despite inducing cardiovascular pathology in adult mice.
Potenza N, etal., EMBO Rep. 2005 May;6(5):432-7.
55.
Primary mediastinal and testicular seminomas: a comparison of K-ras-2 gene sequence and p53 immunoperoxidase analysis of 26 cases.
Przygodzki RM, etal., Hum Pathol. 1996 Sep;27(9):975-9.
56.
Mouse MP Annotation Import Pipeline
RGD automated import pipeline
57.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
58.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
59.
The frequency of KRAS and BRAF mutations in intrahepatic cholangiocarcinomas and their correlation with clinical outcome.
Robertson S, etal., Hum Pathol. 2013 Dec;44(12):2768-73. doi: 10.1016/j.humpath.2013.07.026. Epub 2013 Oct 15.
60.
MEK1/2 dual-specificity protein kinases: Structure and regulation.
Roskoski R Jr Biochem Biophys Res Commun. 2012 Jan 6;417(1):5-10. Epub 2011 Dec 8.
61.
Somatic mutations of signaling genes in non-small-cell lung cancer.
Sanders HR and Albitar M, Cancer Genet Cytogenet. 2010 Nov;203(1):7-15.
62.
Increases in Ki-ras and ornithine decarboxylase gene expression in rat pancreas after caerulein-induced pancreatitis.
Sarfati P, etal., Digestion. 1996 Nov-Dec;57(6):453-63.
63.
Resveratrol prevents tumorigenesis in mouse model of Kras activated sporadic colorectal cancer by suppressing oncogenic Kras expression.
Saud SM, etal., Carcinogenesis. 2014 Dec;35(12):2778-86. doi: 10.1093/carcin/bgu209. Epub 2014 Oct 3.
64.
Germline KRAS mutations cause Noonan syndrome.
Schubbert S, etal., Nat Genet. 2006 Mar;38(3):331-6. Epub 2006 Feb 12.
65.
The ALPPS Approach for Colorectal Liver Metastases: Impact of KRAS Mutation Status in Survival.
Serenari M, etal., Dig Surg. 2018;35(4):303-310. doi: 10.1159/000471930. Epub 2017 Oct 14.
66.
RAS pathway activation and an oncogenic RAS mutation in sporadic pilocytic astrocytoma.
Sharma MK, etal., Neurology. 2005 Oct 25;65(8):1335-6.
67.
Activation of the c-Ki-ras oncogene in aflatoxin B1-induced hepatocellular carcinoma and adenoma in the rat: detection by denaturing gradient gel electrophoresis.
Soman NR and Wogan GN, Proc Natl Acad Sci U S A. 1993 Mar 1;90(5):2045-9.
68.
Aldosterone stimulates proliferation of cardiac fibroblasts by activating Ki-RasA and MAPK1/2 signaling.
Stockand JD and Meszaros JG, Am J Physiol Heart Circ Physiol 2003 Jan;284(1):H176-84.
69.
Assignment of three rat cellular RAS oncogenes to chromosomes 1, 4, and X.
Szpirer J, etal., Somat Cell Mol Genet 1985 Jan;11(1):93-7.
70.
K-ras point mutations in spontaneously occurring endometrial adenocarcinomas in the Donryu rat.
Tanoguchi K, etal., Tohoku J Exp Med. 1999 Oct;189(2):87-93.
71.
Alteration of gene expression profiles in skeletal muscle of rats exposed to microgravity during a spaceflight.
Taylor WE, etal., J Gravit Physiol. 2002 Dec;9(2):61-70.
72.
Monitoring of endometrial K-ras mutation in tamoxifen-treated patients with breast cancer.
Tsujioka H, etal., Int J Gynecol Cancer. 2009 Aug;19(6):1052-6.
73.
ACAT inhibition reverses LCAT deficiency and improves plasma HDL in chronic renal failure.
Vaziri ND and Liang K, Am J Physiol Renal Physiol. 2004 Nov;287(5):F1038-43. Epub 2004 Jul 27.
74.
Antisense knockdown of Kras inhibits fibrosis in a rat model of unilateral ureteric obstruction.
Wang JH, etal., Am J Pathol. 2012 Jan;180(1):82-90. doi: 10.1016/j.ajpath.2011.09.036. Epub 2011 Nov 7.
75.
MiR-181d acts as a tumor suppressor in glioma by targeting K-ras and Bcl-2.
Wang XF, etal., J Cancer Res Clin Oncol. 2012 Apr;138(4):573-84. doi: 10.1007/s00432-011-1114-x. Epub 2011 Dec 30.
76.
Linkage mapping of 40 randomly isolated liver cDNA clones in the mouse.
Warden CH, etal., Genomics 1993 Nov;18(2):295-307.
77.
Pancreatic cancer: molecular pathogenesis and new therapeutic targets.
Wong HH and Lemoine NR, Nat Rev Gastroenterol Hepatol. 2009 Jul;6(7):412-22. Epub 2009 Jun 9.
78.
Elevated Orai1 and STIM1 expressions upregulate MACC1 expression to promote tumor cell proliferation, metabolism, migration, and invasion in human gastric cancer.
Xia J, etal., Cancer Lett. 2016 Oct 10;381(1):31-40. doi: 10.1016/j.canlet.2016.07.014. Epub 2016 Jul 16.
79.
Expansion of the genotypic and phenotypic spectrum in patients with KRAS germline mutations.
Zenker M, etal., J Med Genet. 2007 Feb;44(2):131-5. Epub 2006 Oct 20.
Kras (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 6 145,162,425 - 145,197,631 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 6 145,162,425 - 145,195,965 (-) Ensembl GRCm39 Ensembl GRCm38 6 145,216,699 - 145,250,420 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 6 145,216,699 - 145,250,239 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 6 145,165,219 - 145,198,751 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 6 145,173,866 - 145,207,390 (-) NCBI MGSCv36 mm8 Celera 6 148,290,985 - 148,324,546 (-) NCBI Celera Cytogenetic Map 6 G3 NCBI cM Map 6 77.37 NCBI
KRAS (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 12 25,205,246 - 25,250,929 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 12 25,205,246 - 25,250,936 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 12 25,358,180 - 25,403,863 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 12 25,249,447 - 25,295,121 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 12 25,249,446 - 25,295,121 NCBI Celera 12 30,505,144 - 30,550,804 (-) NCBI Celera Cytogenetic Map 12 p12.1 NCBI HuRef 12 25,128,895 - 25,174,493 (-) NCBI HuRef CHM1_1 12 25,323,336 - 25,368,979 (-) NCBI CHM1_1 T2T-CHM13v2.0 12 25,076,496 - 25,122,152 (-) NCBI T2T-CHM13v2.0
Kras (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 179,916,255 - 179,949,613 (-) NCBI GRCr8 mRatBN7.2 4 178,185,418 - 178,218,484 (-) NCBI mRatBN7.2 mRatBN7.2 UTH_Rnor_SHR_Utx 4 184,490,327 - 184,516,219 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 180,274,827 - 180,300,720 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 178,895,248 - 178,921,140 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 179,482,562 - 179,515,483 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 179,486,105 - 179,515,558 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 243,667,912 - 243,696,325 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 182,869,242 - 182,895,106 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 183,114,365 - 183,140,230 (-) NCBI Celera 4 166,708,846 - 166,734,692 (-) NCBI Celera Cytogenetic Map 4 q44 NCBI
Kras (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955413 20,298,824 - 20,328,758 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955413 20,298,852 - 20,328,756 (-) NCBI ChiLan1.0 ChiLan1.0
KRAS (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 10 71,565,722 - 71,611,563 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 12 71,562,118 - 71,607,959 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 12 61,062,689 - 61,108,524 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 12 63,679,293 - 63,724,335 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 12 63,679,293 - 63,724,335 (+) Ensembl panpan1.1 panPan2
KRAS (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 27 22,261,753 - 22,296,704 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 27 22,257,941 - 22,293,369 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 27 24,078,345 - 24,117,288 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 27 22,456,489 - 22,495,435 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 27 22,456,012 - 22,495,428 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 27 22,271,689 - 22,310,648 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 27 22,290,777 - 22,329,504 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 27 24,245,249 - 24,284,170 (-) NCBI UU_Cfam_GSD_1.0
Kras (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404945 84,156,600 - 84,190,995 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936548 2,079,036 - 2,110,523 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936548 2,078,568 - 2,113,877 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
KRAS (Sus scrofa - pig)
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 5 48,508,811 - 48,549,358 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 5 48,508,774 - 48,546,260 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 5 52,229,592 - 52,270,153 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
KRAS (Chlorocebus sabaeus - green monkey)
Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 11 24,963,396 - 25,010,747 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 11 24,973,619 - 25,005,191 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666069 10,116,447 - 10,163,816 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Kras (Heterocephalus glaber - naked mole-rat)
.
Predicted Target Of
Count of predictions: 1616 Count of miRNA genes: 678 Interacting mature miRNAs: 858 Transcripts: ENSMUST00000032399, ENSMUST00000111710, ENSMUST00000123972, ENSMUST00000149314, ENSMUST00000155145, ENSMUST00000156486 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
4142079 Skmw15_m skeletal muscle weight 15 (mouse) Not determined 6 116829851 149588044 Mouse 10043864 T2dm4sa_m type 2 diabetes mellitus 4 in SMXA RI mice (mouse) Not determined 6 83690851 146954059 Mouse 11252138 Clas1_m carcinogen-induced lung adenoma susceptibility 1 (mouse) 6 112246918 146954059 Mouse 10449437 Pas15_m pulmonary adenoma susceptibility 15 (mouse) 6 128180868 149588044 Mouse 10449436 Pas17_m pulmonary adenoma susceptibility 17 (mouse) 6 124334273 145601739 Mouse 10449435 Pas18_m pulmonary adenoma susceptibility 18 (mouse) 6 145162425 145195965 Mouse 1301658 Radpf3_m radiation pulmonary fibrosis 3 (mouse) Not determined 6 115219814 146330736 Mouse 4141940 W6q5_m weight 6 weeks QTL 5 (mouse) Not determined 96632912 146535124 Mouse 4140980 Mvwf2_m modifier of von Willebrand factor 2 (mouse) Not determined 114345693 145601739 Mouse 4141617 Ncilt_m nuclear cytoplasmic invaginations in lung tumors (mouse) Not determined 145162425 145195965 Mouse 1301084 Bpq5_m blood pressure QTL 5 (mouse) Not determined 6 129330484 149588044 Mouse 14746990 Manh61_m mandible shape 61 (mouse) 6 130156355 149588044 Mouse 4141295 Rua_m raffinose acetate tasting (mouse) Not determined 115546805 149549364 Mouse 10766452 Sle23_m systematic lupus erythematosus susceptibility 23 (mouse) 6 128601582 149588044 Mouse 25314320 Histh5_m histamine hypersensitivity 5 (mouse) 6 48696934 148351498 Mouse 14746999 Mancz6_m mandible centroid size 6 (mouse) 6 130156355 149588044 Mouse 1302089 Wta2_m weight adult 2 (mouse) Not determined 6 125269523 149588044 Mouse 1301518 Bbaa5_m B.burgdorferi-associated arthritis 5 (mouse) Not determined 6 98483798 145881170 Mouse 11353842 Bmiq4_m body mass index QTL 4 (mouse) 6 92584287 146330736 Mouse 4141536 Idd6.2_m insulin dependent diabetes susceptibility 6.2 (mouse) Not determined 6 143556651 146215056 Mouse 1301686 Trmq1_m T cell ratio modifier QTL 1 (mouse) Not determined 6 129330484 149588044 Mouse 1357555 Tesq2_m testis weight QTL 2 (mouse) Not determined 6 96632912 146535124 Mouse 1301620 Insq8_m insulin QTL 8 (mouse) Not determined 6 129534979 149588044 Mouse 12879916 Shm5_m sperm head morphology 5 (mouse) 6 132266532 145601739 Mouse 10053680 Lith25_m lithogenic gene 25 (mouse) Not determined 6 128601582 149588044 Mouse 4141974 Skmw14_m skeletal muscle weight 14 (mouse) Not determined 6 129330484 149588044 Mouse 15092047 Wsigrme2_m week six growth rate, maternal effect 2 (mouse) 6 140497205 147252976 Mouse 15092045 Wngrme2_m week nine growth rate, maternal effect 2 (mouse) 6 140497205 147252976 Mouse 4142416 Egq11_m early growth QTL 11 (mouse) Not determined 96632912 146535124 Mouse 1301820 Mop1_m morphine preference 1 (mouse) Not determined 6 132578005 146330736 Mouse 1301027 Hdlq12_m HDL QTL 12 (mouse) Not determined 6 128601582 149588044 Mouse 15092052 Wsegrme2_m week seven growth rate, maternal effect 2 (mouse) 6 140497205 147252976 Mouse 1301152 Athsq2_m atherosclerosis susceptibility QTL 2 (mouse) Not determined 6 117059949 149588044 Mouse 15092053 Wegrme2_m week eight growth rate, maternal effect 2 (mouse) 6 140445726 147201498 Mouse 1301927 Etohcta6_m ethanol conditioned taste aversion 6 (mouse) Not determined 6 115578005 149578150 Mouse 4141194 Cyx_m cycloheximide tasting (mouse) Not determined 115546805 149549364 Mouse 1558959 Eamcd2_m experimental autoimmune myocarditis 2 (mouse) Not determined 6 129953954 149588044 Mouse 15092060 Wfogrme1_m week four growth rate, maternal effect 1 (mouse) 6 140497205 147252976 Mouse 15092061 Wfigrme1_m week five growth rate, maternal effect 1 (mouse) 6 140445726 147201498 Mouse 15092058 Lgrme2_m late growth rate, maternal effect 2 (mouse) 6 140497205 147252976 Mouse 4141889 Qui_m quinine sensitivity, taste (mouse) Not determined 115546805 149549364 Mouse 15092056 Mgrme1_m mid growth rate, maternal effect 1 (mouse) 6 140497205 147252976 Mouse 1301804 Bulb2_m bulb size 2 (mouse) Not determined 6 120416806 149588044 Mouse
D6Mit57
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 6 145,235,142 - 145,235,338 UniSTS GRCm38 MGSCv37 6 145,183,662 - 145,183,858 UniSTS GRCm37 Celera 6 148,309,449 - 148,309,647 UniSTS Cytogenetic Map 6 G2 UniSTS cM Map 6 71.1 UniSTS Whitehead Genetic 6 62.3 UniSTS Whitehead/MRC_RH 6 1458.33 UniSTS Whitehead_YAC 6 UniSTS
AI929937
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 6 145,218,279 - 145,218,427 UniSTS GRCm38 MGSCv37 6 145,166,799 - 145,166,947 UniSTS GRCm37 Celera 6 148,292,569 - 148,292,717 UniSTS Cytogenetic Map 6 G2 UniSTS cM Map 6 71.2 UniSTS Whitehead/MRC_RH 6 1458.43 UniSTS
PMC316567P1
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 6 145,246,797 - 145,247,199 UniSTS GRCm38 MGSCv37 6 145,195,317 - 145,195,719 UniSTS GRCm37 Celera 6 148,321,118 - 148,321,520 UniSTS Cytogenetic Map 6 G2 UniSTS cM Map 6 71.2 UniSTS
Kras2
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 6 145,246,377 - 145,246,552 UniSTS GRCm38 MGSCv37 6 145,194,897 - 145,195,072 UniSTS GRCm37 Celera 6 148,320,698 - 148,320,873 UniSTS Cytogenetic Map 6 G2 UniSTS cM Map 6 71.2 UniSTS
Kras2
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 6 G2 UniSTS cM Map 6 71.2 UniSTS
Kras2
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 6 145,246,472 - 145,246,805 UniSTS GRCm38 MGSCv37 6 145,194,992 - 145,195,325 UniSTS GRCm37 Celera 6 148,320,793 - 148,321,126 UniSTS Cytogenetic Map 6 G2 UniSTS cM Map 6 71.2 UniSTS
Kras2
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 6 145,246,687 - 145,246,818 UniSTS GRCm38 MGSCv37 6 145,195,207 - 145,195,338 UniSTS GRCm37 Celera 6 148,321,008 - 148,321,139 UniSTS Cytogenetic Map 6 G2 UniSTS cM Map 6 71.2 UniSTS
Kras2
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 6 145,246,928 - 145,247,108 UniSTS GRCm38 MGSCv37 6 145,195,448 - 145,195,628 UniSTS GRCm37 Celera 6 148,321,249 - 148,321,429 UniSTS Cytogenetic Map 6 G2 UniSTS cM Map 6 71.2 UniSTS
Kras2
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 6 145,246,264 - 145,246,548 UniSTS GRCm38 MGSCv37 6 145,194,784 - 145,195,068 UniSTS GRCm37 Celera 6 148,320,585 - 148,320,869 UniSTS Cytogenetic Map 6 G2 UniSTS cM Map 6 71.2 UniSTS
Kras2
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 6 145,219,570 - 145,219,680 UniSTS GRCm38 MGSCv37 6 145,168,090 - 145,168,200 UniSTS GRCm37 Celera 6 148,293,870 - 148,293,980 UniSTS Cytogenetic Map 6 G2 UniSTS cM Map 6 71.2 UniSTS
Kras2
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 6 145,220,057 - 145,220,250 UniSTS GRCm38 MGSCv37 6 145,168,577 - 145,168,770 UniSTS GRCm37 Celera 6 148,294,361 - 148,294,554 UniSTS Cytogenetic Map 6 G2 UniSTS cM Map 6 71.2 UniSTS
Kras2
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 6 145,219,521 - 145,219,688 UniSTS GRCm38 MGSCv37 6 145,168,041 - 145,168,208 UniSTS GRCm37 Celera 6 148,293,821 - 148,293,988 UniSTS Cytogenetic Map 6 G2 UniSTS cM Map 6 71.2 UniSTS
Kras
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 6 G2 UniSTS cM Map 6 71.2 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000032399 ⟹ ENSMUSP00000032399
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 6 145,162,425 - 145,195,965 (-) Ensembl GRCm38.p6 Ensembl 6 145,216,699 - 145,250,239 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000111710 ⟹ ENSMUSP00000107339
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 6 145,165,971 - 145,195,903 (-) Ensembl GRCm38.p6 Ensembl 6 145,220,245 - 145,250,177 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000123972
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 6 145,165,706 - 145,176,550 (-) Ensembl GRCm38.p6 Ensembl 6 145,219,980 - 145,230,824 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000149314
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 6 145,166,336 - 145,171,283 (-) Ensembl GRCm38.p6 Ensembl 6 145,220,610 - 145,225,557 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000155145 ⟹ ENSMUSP00000118251
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 6 145,192,430 - 145,195,928 (-) Ensembl GRCm38.p6 Ensembl 6 145,246,704 - 145,250,202 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000156486 ⟹ ENSMUSP00000119414
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 6 145,166,023 - 145,195,896 (-) Ensembl GRCm38.p6 Ensembl 6 145,220,297 - 145,250,170 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000203147 ⟹ ENSMUSP00000145294
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 6 145,165,947 - 145,195,965 (-) Ensembl GRCm38.p6 Ensembl 6 145,220,221 - 145,250,239 (-) Ensembl
RefSeq Acc Id:
NM_001403240 ⟹ NP_001390169
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 6 145,162,429 - 145,197,631 (-) NCBI
RefSeq Acc Id:
NM_001403241 ⟹ NP_001390170
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 6 145,162,429 - 145,195,965 (-) NCBI
RefSeq Acc Id:
NM_001403242 ⟹ NP_001390171
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 6 145,162,429 - 145,195,965 (-) NCBI
RefSeq Acc Id:
NM_001403243 ⟹ NP_001390172
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 6 145,162,429 - 145,195,965 (-) NCBI
RefSeq Acc Id:
NM_001403244 ⟹ NP_001390173
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 6 145,162,429 - 145,197,631 (-) NCBI
RefSeq Acc Id:
NM_001403245 ⟹ NP_001390174
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 6 145,162,429 - 145,195,965 (-) NCBI
RefSeq Acc Id:
NM_001403246 ⟹ NP_001390175
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 6 145,162,429 - 145,195,965 (-) NCBI
RefSeq Acc Id:
NM_021284 ⟹ NP_067259
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 6 145,162,429 - 145,195,965 (-) NCBI GRCm38 6 145,216,699 - 145,250,231 (-) NCBI MGSCv37 6 145,165,219 - 145,198,751 (-) RGD Celera 6 148,290,985 - 148,324,546 (-) RGD cM Map 6 ENTREZGENE
Sequence:
AGGCGGCGGCCGCGGCGGCTGAGGCGGCAGCGCTGTGGCGGCGGCTGAGACGGCAGGGGAAGGCGGCGGCGGCTCGGCCCGGAGTCCCGCTCCCGCGCCATTTCGGACCCGGAGCGAGCGCGGCGCGG GCCTGAAGGCGGCGGCGGGAGCCTGAGGCGCGGCGGCTCCGCGGCGCGGAGAGAGGCCTGCTGAAAATGACTGAGTATAAACTTGTGGTGGTTGGAGCTGGTGGCGTAGGCAAGAGCGCCTTGACGAT ACAGCTAATTCAGAATCACTTTGTGGATGAGTATGACCCTACGATAGAGGACTCCTACAGGAAACAAGTAGTAATTGATGGAGAAACCTGTCTCTTGGATATTCTCGACACAGCAGGTCAAGAGGAGT ACAGTGCAATGAGGGACCAGTACATGAGAACTGGGGAGGGCTTTCTTTGTGTATTTGCCATAAATAATACTAAATCATTTGAAGATATTCACCATTATAGAGAACAAATTAAAAGAGTAAAGGACTCT GAAGATGTGCCTATGGTCCTGGTAGGGAATAAGTGTGATTTGCCTTCTAGAACAGTAGACACGAAACAGGCTCAGGAGTTAGCAAGGAGTTACGGGATTCCGTTCATTGAGACCTCAGCAAAGACAAG ACAGGGTGTTGACGATGCCTTCTATACATTAGTCCGAGAAATTCGAAAACATAAAGAAAAGATGAGCAAAGATGGGAAGAAGAAGAAGAAGAAGTCAAGGACAAGGTGTACAGTTATGTGAATACTTT GTACTCTTTCTTAAGGCACACTTAAGTAAAAGTGTGATTTTTGTACATTACACTAAATTATTAGCATTTGTTTTAGCATTACCTAATCTTTTTTTTTCTTCTGTTCGTGCAAACTGTCAGCTTTTATC TCAAATGCTTATTTTAAAAGAACAGTGGAAACCTTCTTTTTTCTAAGTGCCAGTATTCCCTGGGTTTTGGACTTAAACTAGCAATGCCTGTGGAAGAGACTAAAGACCTGAGACTCTGTCTTGGGATT TGGTGCATGCAGTTGATTCCTTGCTAGTTCTCTTACCAACTGTGAACACTGATGGGAAGCAGGATAATGAAGCTTCCGGACCATCCCTGCTCTGTGTCCATCTACTCATCCAATGGAGTCATTAGCAG TCAATCGCCGCTTCACTGGACACTGAGGGGTCACAGACTTAGGCTCCCTTTGAGTCGCGTCCAGCGTGTCCTAGACTTTATCATCTTTCAGAGGCGTAGGCAGACTGTTCACAAAGGCTTTCTGTAGC TTTCCACTGCAATTAATCTTGGTCACTCCCTCAAATAGTATATTTTTTCTAGAAAAGGGGAAAAATGGAAAAAAAAAGGCAATGGAAAATGTTGAAATCCATTCAGTTTCCATGTTAGCTAAATTACT GTAAGATTCCTATAATAGCTTTTCCTGGTAAGGCAGACCCAGTATGAAATAGTAATAACCATTTGGGCTATATTTACATGCTACTAAATTTTTGTAATAATTCAAACAACTTTAGCATATATAAAAAG TTCTCATAAGAATTAAGTACAATTCCCCTTTGTCAGATTGTTCTTATCCTAACTTTCAAGTCTTTTTTGAATTTCTGTTGTTGAAAGTAGTTTTAATGGTTGTGAAGCTGAAGATGATCTGAGACAGT TATAGCTTGGCAGGTGTTGAGGAGACCAGAGTTGCAGGGTTGGGCCTTACGTGAACCTGTGACGAACGCTACTGGGTTTTGCAGCACTGCTGCATTCAATGTTGGCGACGCATTGTTTGGTCAACATA GGGGATAAGGAGACTTTGATGGCTTAGTATAATGCATTCTCACCATGTAACAGTCCTACTGACAAATCAAGAAATTTGTTTATAATAATAAAAAATTTTTAAAAATTTCGATGTTCGCTTCAAGGTTG AGATTTTGGGGTAGGAGGCTACAACAAGAGTAAATCTTAAAGCAAGGTTTTAAGAAGGTTTGAAAATGCAGGTTTGACTAGTCTCTCAACTCTAGCTAAACAAACATTCCCAAGTACTTCCCAAATCT GATAGGTATTTAAAATTATCTAATGCTTTAAGAATAGTTAACAGGAAAAAAATCTCCTCAGTGCACTTAAAGCAACCCTTCACATCATTTGAAATGAGATGGAAATATCACTGGACTATGAGGACTGG ATGTCTGTCTGATTTTAAGCAAATCACTGTCTGCTTGGTTTTGAATCATCTCAAAGACATTAACCTCCCAGCCGTGTAACATAGTTTACATGTTGACACACCTAGTTATCAAGCTCAGCACAATCTGT AACTGTTTTACATGGATTAACATCTTCACTGCCAGTCTTGGGCAAATTGTGCAAGAGGTAAAATTTATATTTCAGTATCCATTCTCCCATTTCAGGACTCCCCTCCAACATTATGCTGGCTTTCAGCC TGTCTCTCACCTGCCCATCACTTAGTGTAGTTTTAATAATTTCCCCCACTTCAAACTTTGTTTCCACTATGGACAACTTCATGAACTTTGCCCACTAAGGTAGGTACATCAAAGCTGCCCTATGGCTT TCTTCCCCGGGACTGAAAATAACAGACACCATAGTGGGATTTAAACTAATAGATGGTTTTCAGGGCCACTACAACAATTCAATCTCAATCCTTTGGACTTCATTCCTGCTGCCCAGGCCACTGGTGCC TCAGTAGGAATTTTCAAAATTAGTGTGAACAGACAGAGCACAGTCCAGTGGAAGGTGAGCTTAATCTTCATCTAGCCATCATCATGGTAAGTGATAGATTCTATTGTTTTAATAAATACAGTCTAACA ATGAAAAACACTTCGAAGTTTCAATCATAAAGCTGTCTTTTTAAAAATTTTATTTACTCAACATTTATTCAGTGCTTGTCATATTCTGGGAATTACACTAGGCACTCAGGGTGCGGTGTCCTCAATCC TTGGCCAGTGGTATGTAGCATGATCTGTAATACCACTAAATAAGGCATATAGCATATGACTTAGACATAATGAAATACATGATTTGAGTTTTGCAGAGAGGAGTTTGGGTTTGTACATTCCCTTCCCC CCCAGTTTAGCAAGAATTGTTTGCTGTGAATCCAATGCAACTTTTAAATCAAACTACTTTATATAATTATTTCATTTTTCTAAAGGAACAGAAGTACCCTAAACTATTTTTTTGAAATGTTCTAAACT GTACATATTCATAGAACATTCTTTGGGTGAATTTTAAGTCTTAAAATGCAATTAGTAATACTTCTCATTTCTATTCAGAGGAACAGGTGTACTTCAAAAGCTGCAGTGTATAATCAGATATTTTTAAT GGACAATGTGTTAAAGAAGTGGTAATTACCACTATGTAAATTTGAATTGTGTTACACTTTGGTTAACAAAAGGGGAAAGAATCCTAGAAACAAATATGTTATCTAGTTACTGCAGCCTTAAAGTCCTT GTTGAAGTTAAAAAGCAATGCTAAGTTACAGTCATAGGCATTAACATGTTTATGGGAAGGATATAGTAGGCAAATACAATTTGAGTAAATATTTTCAGTAGGGAATTTTAGGCTCTACTGACTGAGTC ACACTGCATAGGAATTTAGATCTTAACTTTTATAGGTTATCGACCTTTGCCACCATTGCACAATTTTGTCCTAACATAAATACAAGTTCTGTGAGGCATGTCAAAAGTTACAGTTTGCATAAATTCAT CTCATTTTGTATTCCACTGATTTTACATTTTCCTCAAACATACATACATACATACATACAACACACACACACTCACACATGAAGGGTTTTTTTTTTGTAGGCAATAAAAATTTAACTAATTTCCATTT GTTAAAAAGTAGTGATTTATTGAGAATTATGCAGTCATTTTTTAAACCCAAAAGTTATTTAAAGGTGAATTTATACTCAATAACTTCTGTGTAATACTGGGTAGCATGAATTCTGCATTGAAAAATTG AACAGATAATACCAATAGCTGTAAATTCTGTCAAAACATGAAAATTATTTCTAAAGAAGTACATTAGTTTTCAAAGAACAGTTATTAGAATCAGATCTGTGGTTTAGTTCAATAATTTGAAGTGCCTG TTTGGGATGGTGGTAGGCATTTTAGATGAATTTGGGAAAAATAAAGTTCTGCAGAAATGCCAGTTTCAGACCCCGCTAACCCGCTGAGTGGGCTGTGTGCTGTGTTAGCTCCAGTGCCCCAATCCCGT TTCATGTCTTCATGTTGAAACACTTCTGCATTTTTATTTGAGTGCCAATTTCTTACTAGTGCTATTTCTTAGTGTAACATGTTTACCTGGGATGTATTTTAACTATTTTTGTATAGTGTAAACTGAAA CATGCACATTTTGTACATTGTGCTTTCCTTCTTTCCATTCCTTTTCTTTCTGTTTTGTTTGTTTGTTTGTTTGTTTGTTTGTTATGGGACATATGCAGTGTGATCCAGTTGTTTTCCATCCTTTGGTT GCGCTGACCTAGGGAATGTTGGTCATATCAAACATTAAATTTAAAAGTGACCACTCTTAATTAAAATTAACTTTTAAATGTTTATAGGAGTACGTGCTGTGAAGTGATCTGAAATTTGTAATATTTTT GTCATGAACCGTACTGCTCCTAATCATTGTAATGTAATAAAAATAGTTATGGTGACTATGAA
hide sequence
RefSeq Acc Id:
NR_175367
RefSeq Status:
VALIDATED
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 6 145,162,429 - 145,195,965 (-) NCBI
RefSeq Acc Id:
NR_175368
RefSeq Status:
VALIDATED
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 6 145,162,429 - 145,195,965 (-) NCBI
RefSeq Acc Id:
XM_006506919 ⟹ XP_006506982
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 6 145,162,425 - 145,196,069 (-) NCBI GRCm38 6 145,216,699 - 145,250,141 (-) NCBI
Sequence:
CCTCCCGCGCGCGCGGCCGAGGCAGCGCGGAGCACCGAGCGCATCGATCGGCCTGCTCTGCGGC CGCCCGCCCGCCTGCCGGGCCCATCGCGCACTCCGGGCTCGATTCGGCAGGCGGCGGCCGCGGCGGCTGAGGCGGCAGCGCTGTGGCGGCGGCTGAGACGGCAGGGGAAGGCGGCGGCGGCTCGGCCC GGAGTCCCGCTCCCGCGCCATTTCGGACCCGGAGCGAGCGCGGCGCGGGCCTGAAGGCGGCGGCGGGAGCCTGAGGCGCGGCGGCTCCGCGGCGCGGAGAGAGGCCTGCTGAAAATGACTGAGTATAA ACTTGTGGTGGTTGGAGCTGGTGGCGTAGGCAAGAGCGCCTTGACGATACAGCTAATTCAGAATCACTTTGTGGATGAGTATGACCCTACGATAGAGGACTCCTACAGGAAACAAGTAGTAATTGATG GAGAAACCTGTCTCTTGGATATTCTCGACACAGCAGGTCAAGAGGAGTACAGTGCAATGAGGGACCAGTACATGAGAACTGGGGAGGGCTTTCTTTGTGTATTTGCCATAAATAATACTAAATCATTT GAAGATATTCACCATTATAGAGAACAAATTAAAAGAGTAAAGGACTCTGAAGATGTGCCTATGGTCCTGGTAGGGAATAAGTGTGATTTGCCTTCTAGAACAGTAGACACGAAACAGGCTCAGGAGTT AGCAAGGAGTTACGGGATTCCGTTCATTGAGACCTCAGCAAAGACAAGACAGAGAGTGGAGGATGCTTTTTATACATTGGTGAGAGAGATCCGACAGTACAGATTGAAAAAAATCAGCAAAGAAGAAA AGACTCCTGGCTGTGTGAAAATTAAAAAATGCGTTATAATGGGTGTTGACGATGCCTTCTATACATTAGTCCGAGAAATTCGAAAACATAAAGAAAAGATGAGCAAAGATGGGAAGAAGAAGAAGAAG AAGTCAAGGACAAGGTGTACAGTTATGTGAATACTTTGTACTCTTTCTTAAGGCACACTTAAGTAAAAGTGTGATTTTTGTACATTACACTAAATTATTAGCATTTGTTTTAGCATTACCTAATCTTT TTTTTTCTTCTGTTCGTGCAAACTGTCAGCTTTTATCTCAAATGCTTATTTTAAAAGAACAGTGGAAACCTTCTTTTTTCTAAGTGCCAGTATTCCCTGGGTTTTGGACTTAAACTAGCAATGCCTGT GGAAGAGACTAAAGACCTGAGACTCTGTCTTGGGATTTGGTGCATGCAGTTGATTCCTTGCTAGTTCTCTTACCAACTGTGAACACTGATGGGAAGCAGGATAATGAAGCTTCCGGACCATCCCTGCT CTGTGTCCATCTACTCATCCAATGGAGTCATTAGCAGTCAATCGCCGCTTCACTGGACACTGAGGGGTCACAGACTTAGGCTCCCTTTGAGTCGCGTCCAGCGTGTCCTAGACTTTATCATCTTTCAG AGGCGTAGGCAGACTGTTCACAAAGGCTTTCTGTAGCTTTCCACTGCAATTAATCTTGGTCACTCCCTCAAATAGTATATTTTTTCTAGAAAAGGGGAAAAATGGAAAAAAAAAGGCAATGGAAAATG TTGAAATCCATTCAGTTTCCATGTTAGCTAAATTACTGTAAGATTCCTATAATAGCTTTTCCTGGTAAGGCAGACCCAGTATGAAATAGTAATAACCATTTGGGCTATATTTACATGCTACTAAATTT TTGTAATAATTCAAACAACTTTAGCATATATAAAAAGTTCTCATAAGAATTAAGTACAATTCCCCTTTGTCAGATTGTTCTTATCCTAACTTTCAAGTCTTTTTTGAATTTCTGTTGTTGAAAGTAGT TTTAATGGTTGTGAAGCTGAAGATGATCTGAGACAGTTATAGCTTGGCAGGTGTTGAGGAGACCAGAGTTGCAGGGTTGGGCCTTACGTGAACCTGTGACGAACGCTACTGGGTTTTGCAGCACTGCT GCATTCAATGTTGGCGACGCATTGTTTGGTCAACATAGGGGATAAGGAGACTTTGATGGCTTAGTATAATGCATTCTCACCATGTAACAGTCCTACTGACAAATCAAGAAATTTGTTTATAATAATAA AAAATTTTTAAAAATTTCGATGTTCGCTTCAAGGTTGAGATTTTGGGGTAGGAGGCTACAACAAGAGTAAATCTTAAAGCAAGGTTTTAAGAAGGTTTGAAAATGCAGGTTTGACTAGTCTCTCAACT CTAGCTAAACAAACATTCCCAAGTACTTCCCAAATCTGATAGGTATTTAAAATTATCTAATGCTTTAAGAATAGTTAACAGGAAAAAAATCTCCTCAGTGCACTTAAAGCAACCCTTCACATCATTTG AAATGAGATGGAAATATCACTGGACTATGAGGACTGGATGTCTGTCTGATTTTAAGCAAATCACTGTCTGCTTGGTTTTGAATCATCTCAAAGACATTAACCTCCCAGCCGTGTAACATAGTTTACAT GTTGACACACCTAGTTATCAAGCTCAGCACAATCTGTAACTGTTTTACATGGATTAACATCTTCACTGCCAGTCTTGGGCAAATTGTGCAAGAGGTAAAATTTATATTTCAGTATCCATTCTCCCATT TCAGGACTCCCCTCCAACATTATGCTGGCTTTCAGCCTGTCTCTCACCTGCCCATCACTTAGTGTAGTTTTAATAATTTCCCCCACTTCAAACTTTGTTTCCACTATGGACAACTTCATGAACTTTGC CCACTAAGGTAGGTACATCAAAGCTGCCCTATGGCTTTCTTCCCCGGGACTGAAAATAACAGACACCATAGTGGGATTTAAACTAATAGATGGTTTTCAGGGCCACTACAACAATTCAATCTCAATCC TTTGGACTTCATTCCTGCTGCCCAGGCCACTGGTGCCTCAGTAGGAATTTTCAAAATTAGTGTGAACAGACAGAGCACAGTCCAGTGGAAGGTGAGCTTAATCTTCATCTAGCCATCATCATGGTAAG TGATAGATTCTATTGTTTTAATAAATACAGTCTAACAATGAAAAACACTTCGAAGTTTCAATCATAAAGCTGTCTTTTTAAAAATTTTATTTACTCAACATTTATTCAGTGCTTGTCATATTCTGGGA ATTACACTAGGCACTCAGGGTGCGGTGTCCTCAATCCTTGGCCAGTGGTATGTAGCATGATCTGTAATACCACTAAATAAGGCATATAGCATATGACTTAGACATAATGAAATACATGATTTGAGTTT TGCAGAGAGGAGTTTGGGTTTGTACATTCCCTTCCCCCCCAGTTTAGCAAGAATTGTTTGCTGTGAATCCAATGCAACTTTTAAATCAAACTACTTTATATAATTATTTCATTTTTCTAAAGGAACAG AAGTACCCTAAACTATTTTTTTGAAATGTTCTAAACTGTACATATTCATAGAACATTCTTTGGGTGAATTTTAAGTCTTAAAATGCAATTAGTAATACTTCTCATTTCTATTCAGAGGAACAGGTGTA CTTCAAAAGCTGCAGTGTATAATCAGATATTTTTAATGGACAATGTGTTAAAGAAGTGGTAATTACCACTATGTAAATTTGAATTGTGTTACACTTTGGTTAACAAAAGGGGAAAGAATCCTAGAAAC AAATATGTTATCTAGTTACTGCAGCCTTAAAGTCCTTGTTGAAGTTAAAAAGCAATGCTAAGTTACAGTCATAGGCATTAACATGTTTATGGGAAGGATATAGTAGGCAAATACAATTTGAGTAAATA TTTTCAGTAGGGAATTTTAGGCTCTACTGACTGAGTCACACTGCATAGGAATTTAGATCTTAACTTTTATAGGTTATCGACCTTTGCCACCATTGCACAATTTTGTCCTAACATAAATACAAGTTCTG TGAGGCATGTCAAAAGTTACAGTTTGCATAAATTCATCTCATTTTGTATTCCACTGATTTTACATTTTCCTCAAACATACATACATACATACATACAACACACACACACTCACACATGAAGGGTTTTT TTTTTGTAGGCAATAAAAATTTAACTAATTTCCATTTGTTAAAAAGTAGTGATTTATTGAGAATTATGCAGTCATTTTTTAAACCCAAAAGTTATTTAAAGGTGAATTTATACTCAATAACTTCTGTG TAATACTGGGTAGCATGAATTCTGCATTGAAAAATTGAACAGATAATACCAATAGCTGTAAATTCTGTCAAAACATGAAAATTATTTCTAAAGAAGTACATTAGTTTTCAAAGAACAGTTATTAGAAT CAGATCTGTGGTTTAGTTCAATAATTTGAAGTGCCTGTTTGGGATGGTGGTAGGCATTTTAGATGAATTTGGGAAAAATAAAGTTCTGCAGAAATGCCAGTTTCAGACCCCGCTAACCCGCTGAGTGG GCTGTGTGCTGTGTTAGCTCCAGTGCCCCAATCCCGTTTCATGTCTTCATGTTGAAACACTTCTGCATTTTTATTTGAGTGCCAATTTCTTACTAGTGCTATTTCTTAGTGTAACATGTTTACCTGGG ATGTATTTTAACTATTTTTGTATAGTGTAAACTGAAACATGCACATTTTGTACATTGTGCTTTCCTTCTTTCCATTCCTTTTCTTTCTGTTTTGTTTGTTTGTTTGTTTGTTTGTTTGTTATGGGACA TATGCAGTGTGATCCAGTTGTTTTCCATCCTTTGGTTGCGCTGACCTAGGGAATGTTGGTCATATCAAACATTAAATTTAAAAGTGACCACTCTTAATTAAAATTAACTTTTAAATGTTTATAGGAGT ACGTGCTGTGAAGTGATCTGAAATTTGTAATATTTTTGTCATGAACCGTACTGCTCCTAATCATTGTAATGTAATAAAAATAGTTATGGTGACTATGAA
hide sequence
RefSeq Acc Id:
NP_067259 ⟸ NM_021284
- Peptide Label:
isoform 1
- UniProtKB:
Q5J7N1 (UniProtKB/TrEMBL), Q3U2W7 (UniProtKB/TrEMBL)
- Sequence:
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTK QAQELARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDGKKKKKKSRTRCTVM
hide sequence
RefSeq Acc Id:
XP_006506982 ⟸ XM_006506919
- Peptide Label:
isoform X2
- UniProtKB:
Q3U2W7 (UniProtKB/TrEMBL)
- Sequence:
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEY SAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQELARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGCVKIKKCVIMGVD DAFYTLVREIRKHKEKMSKDGKKKKKKSRTRCTVM
hide sequence
Ensembl Acc Id:
ENSMUSP00000107339 ⟸ ENSMUST00000111710
Ensembl Acc Id:
ENSMUSP00000145294 ⟸ ENSMUST00000203147
Ensembl Acc Id:
ENSMUSP00000032399 ⟸ ENSMUST00000032399
Ensembl Acc Id:
ENSMUSP00000119414 ⟸ ENSMUST00000156486
Ensembl Acc Id:
ENSMUSP00000118251 ⟸ ENSMUST00000155145
RefSeq Acc Id:
NP_001390173 ⟸ NM_001403244
- Peptide Label:
isoform 3
RefSeq Acc Id:
NP_001390169 ⟸ NM_001403240
- Peptide Label:
isoform 1
- UniProtKB:
Q5J7N1 (UniProtKB/TrEMBL), Q3U2W7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001390174 ⟸ NM_001403245
- Peptide Label:
isoform 3
RefSeq Acc Id:
NP_001390175 ⟸ NM_001403246
- Peptide Label:
isoform 4
- UniProtKB:
A0A0N4SVY1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001390172 ⟸ NM_001403243
- Peptide Label:
isoform 2
- UniProtKB:
P32883 (UniProtKB/Swiss-Prot), P04200 (UniProtKB/Swiss-Prot), P08643 (UniProtKB/Swiss-Prot), Q0VDV7 (UniProtKB/TrEMBL), A0A0G2JGP4 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001390171 ⟸ NM_001403242
- Peptide Label:
isoform 1
- UniProtKB:
Q5J7N1 (UniProtKB/TrEMBL), Q3U2W7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001390170 ⟸ NM_001403241
- Peptide Label:
isoform 1
- UniProtKB:
Q5J7N1 (UniProtKB/TrEMBL), Q3U2W7 (UniProtKB/TrEMBL)
RGD ID: 6839546
Promoter ID: MM_KWN:48206
Type: CpG-Island
SO ACC ID: SO:0000170
Source: MPROMDB
Tissues & Cell Lines: BoneMarrow_2Hour, BoneMarrow_4Hour
Transcripts: ENSMUST00000032397, ENSMUST00000111709, OTTMUST00000052666, OTTMUST00000053353, OTTMUST00000053356, UC009ERI.1
Position: Mouse Assembly Chr Position (strand) Source MGSCv36 6 145,198,499 - 145,198,999 (-) MPROMDB
RGD ID: 6891488
Promoter ID: EPDNEW_M9195
Type: initiation region
Name: Kras_1
Description: Mus musculus Kirsten rat sarcoma viral oncogene homolog , mRNA.
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Experiment Methods: Single-end sequencing.
Position: Mouse Assembly Chr Position (strand) Source GRCm38 6 145,250,231 - 145,250,291 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-01-05
Kras
Kirsten rat sarcoma viral oncogene homolog
v-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog
Symbol and/or name change
5135510
APPROVED