Symbol:
Hdac1
Name:
histone deacetylase 1
RGD ID:
1309799
Description:
Enables DNA-binding transcription factor binding activity; chromatin binding activity; and deacetylase activity. Involved in several processes, including cellular response to platelet-derived growth factor stimulus; regulation of apoptotic process; and regulation of macromolecule metabolic process. Located in chromatin; nucleus; and perinuclear region of cytoplasm. Part of protein-containing complex. Biomarker of glaucoma and pulmonary hypertension. Orthologous to human HDAC1 (histone deacetylase 1); PARTICIPATES IN CHD family mediated chromatin remodeling pathway; Hedgehog signaling pathway; histone modification pathway; INTERACTS WITH (S)-nicotine; 1-[3-(dimethylamino)propyl]-1-(4-fluorophenyl)-1,3-dihydro-2-benzofuran-5-carbonitrile; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
HD1; LOC297893
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
HDAC1 (histone deacetylase 1) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Treefam
Mus musculus (house mouse):
Hdac1 (histone deacetylase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Hdac1 (histone deacetylase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
HDAC1 (histone deacetylase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
HDAC1 (histone deacetylase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Hdac1 (histone deacetylase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
HDAC1 (histone deacetylase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
HDAC1 (histone deacetylase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Hdac1 (histone deacetylase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
FAM174B (family with sequence similarity 174 member B) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
HDAC1 (histone deacetylase 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Hdac1 (histone deacetylase 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
hdac1 (histone deacetylase 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
hda-1
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
HDAC1
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
RPD3
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
hda-3
Alliance
DIOPT (OMA|OrthoFinder|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
hdac1
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Related Pseudogenes:
Hdac1-ps12
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 147,138,328 - 147,165,387 (-) NCBI GRCr8 mRatBN7.2 5 141,853,992 - 141,881,057 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 141,853,989 - 141,881,111 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 144,555,355 - 144,582,392 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 146,325,182 - 146,352,217 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 146,321,706 - 146,348,843 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 147,716,664 - 147,743,723 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 147,716,664 - 147,743,723 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 151,445,686 - 151,472,652 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 148,672,515 - 148,699,810 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 148,682,553 - 148,709,849 (-) NCBI Celera 5 140,329,254 - 140,356,320 (-) NCBI Celera Cytogenetic Map 5 q36 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Hdac1 Rat (20S)-ginsenoside Rh2 decreases expression ISO HDAC1 (Homo sapiens) 6480464 ginsenoside Rh2 results in decreased expression of HDAC1 protein CTD PMID:26482938 Hdac1 Rat (S)-nicotine increases expression ISO HDAC1 (Homo sapiens) 6480464 Nicotine results in increased expression of HDAC1 mRNA CTD PMID:24709674 Hdac1 Rat (S)-nicotine increases expression EXP 6480464 Nicotine results in increased expression of HDAC1 mRNA and Nicotine results in increased expression of HDAC1 protein CTD PMID:34245815 Hdac1 Rat (S)-nicotine multiple interactions EXP 6480464 SNAI1 protein affects the reaction [Nicotine results in increased expression of HDAC1 mRNA] and SNAI1 protein affects the reaction [Nicotine results in increased expression of HDAC1 protein] CTD PMID:34245815 Hdac1 Rat 1,2-dimethylhydrazine decreases expression ISO Hdac1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of HDAC1 mRNA CTD PMID:22206623 Hdac1 Rat 1-[3-(dimethylamino)propyl]-1-(4-fluorophenyl)-1,3-dihydro-2-benzofuran-5-carbonitrile decreases expression EXP 6480464 Citalopram results in decreased expression of HDAC1 mRNA CTD PMID:28467792 Hdac1 Rat 15-deoxy-Delta(12,14)-prostaglandin J2 decreases expression ISO HDAC1 (Homo sapiens) 6480464 15-deoxy-delta(12 and 14)-prostaglandin J2 results in decreased expression of HDAC1 mRNA CTD PMID:21957481 Hdac1 Rat 17alpha-ethynylestradiol increases expression ISO Hdac1 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of HDAC1 mRNA CTD PMID:17942748 Hdac1 Rat 17alpha-ethynylestradiol multiple interactions ISO Hdac1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of HDAC1 mRNA CTD PMID:17942748 Hdac1 Rat 17beta-estradiol multiple interactions ISO HDAC1 (Homo sapiens) 6480464 [Tetrachlorodibenzodioxin co-treated with Estradiol] promotes the reaction [HDAC1 protein binds to BRCA1 promoter] more ... CTD PMID:16489025 more ... Hdac1 Rat 17beta-estradiol decreases expression ISO HDAC1 (Homo sapiens) 6480464 Estradiol results in decreased expression of HDAC1 mRNA CTD PMID:16029874 and PMID:23373633 Hdac1 Rat 17beta-estradiol increases expression ISO HDAC1 (Homo sapiens) 6480464 Estradiol results in increased expression of HDAC1 mRNA CTD PMID:22952798 and PMID:30684530 Hdac1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Hdac1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of HDAC1 mRNA CTD PMID:24058054 Hdac1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of HDAC1 mRNA CTD PMID:22493514 and PMID:34747641 Hdac1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Hdac1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of HDAC1 mRNA and Tetrachlorodibenzodioxin affects the reaction [HDAC1 protein binds to CYP1A1 promoter] CTD PMID:17652329 and PMID:17942748 Hdac1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO HDAC1 (Homo sapiens) 6480464 [IL1B protein co-treated with Tetrachlorodibenzodioxin] inhibits the reaction [HDAC1 protein binds to IL6 promoter] more ... CTD PMID:16489025 and PMID:20511231 Hdac1 Rat 2,4,6-tribromophenol increases expression ISO HDAC1 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Hdac1 Rat 3,3',4,4',5-pentachlorobiphenyl affects expression ISO Hdac1 (Mus musculus) 6480464 3 more ... CTD PMID:37080397 Hdac1 Rat 3,3'-diindolylmethane multiple interactions ISO Hdac1 (Mus musculus) 6480464 3 more ... CTD PMID:24200994 Hdac1 Rat 3,4-methylenedioxymethamphetamine increases expression ISO Hdac1 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of HDAC1 mRNA CTD PMID:20188158 Hdac1 Rat 4-phenylbutyric acid multiple interactions ISO HDAC1 (Homo sapiens) 6480464 [4-phenylbutyric acid affects the acetylation of HDAC1 protein] which affects the expression of TUBB3 protein CTD PMID:18497984 Hdac1 Rat 5-aza-2'-deoxycytidine multiple interactions ISO HDAC1 (Homo sapiens) 6480464 Decitabine inhibits the reaction [HDAC1 protein binds to ABCG2 promoter] more ... CTD PMID:16043219 more ... Hdac1 Rat 5-fluorouracil multiple interactions ISO Hdac1 (Mus musculus) 6480464 [HDAC1 protein co-treated with HDAC2 protein] promotes the reaction [TCF7L2 protein inhibits the reaction [Fluorouracil results in decreased expression of MBP mRNA]] more ... CTD PMID:25178657 Hdac1 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of HDAC1 mRNA CTD PMID:30047161 Hdac1 Rat 7,12-dimethyltetraphene increases expression ISO Hdac1 (Mus musculus) 6480464 9 more ... CTD PMID:24792773 Hdac1 Rat 7,12-dimethyltetraphene multiple interactions ISO Hdac1 (Mus musculus) 6480464 Butyric Acid affects the reaction [9 more ... CTD PMID:24792773 Hdac1 Rat acetylsalicylic acid increases expression ISO HDAC1 (Homo sapiens) 6480464 Aspirin results in increased expression of HDAC1 mRNA CTD PMID:15456535 Hdac1 Rat acrylamide affects expression EXP 6480464 Acrylamide affects the expression of HDAC1 mRNA CTD PMID:28959563 Hdac1 Rat aldehydo-D-glucose multiple interactions ISO Hdac1 (Mus musculus) 6480464 Glucose promotes the reaction [HDAC1 protein binds to TUG1 promoter] CTD PMID:32467232 Hdac1 Rat all-trans-retinoic acid multiple interactions ISO HDAC1 (Homo sapiens) 6480464 Thiophenes analog promotes the reaction [Tretinoin results in increased expression of HDAC1 mRNA] CTD PMID:16140955 Hdac1 Rat all-trans-retinoic acid increases expression ISO HDAC1 (Homo sapiens) 6480464 Tretinoin results in increased expression of HDAC1 mRNA CTD PMID:16140955 Hdac1 Rat allethrin multiple interactions EXP 6480464 [Allethrins co-treated with cyhalothrin co-treated with cypermethrin co-treated with decamethrin co-treated with fenvalerate] affects the expression of HDAC1 mRNA more ... CTD PMID:33051911 more ... Hdac1 Rat alpha-mangostin increases expression ISO HDAC1 (Homo sapiens) 6480464 mangostin results in increased expression of HDAC1 protein CTD PMID:30502394 Hdac1 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of HDAC1 mRNA CTD PMID:30047161 Hdac1 Rat ammonium chloride increases expression EXP 6480464 Ammonium Chloride results in increased expression of HDAC1 protein CTD PMID:16483693 Hdac1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of HDAC1 mRNA CTD PMID:16483693 Hdac1 Rat amphetamine multiple interactions EXP 6480464 Amphetamine promotes the reaction [HDAC1 protein binds to FOS promoter] CTD PMID:18632938 Hdac1 Rat amphetamine multiple interactions ISO Hdac1 (Mus musculus) 6480464 HDAC1 gene mutant form promotes the reaction [Amphetamine results in increased expression of FOS mRNA] CTD PMID:18632938 Hdac1 Rat andrographolide decreases expression ISO HDAC1 (Homo sapiens) 6480464 andrographolide results in decreased expression of HDAC1 protein CTD PMID:28651835 Hdac1 Rat antirheumatic drug decreases expression ISO HDAC1 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of HDAC1 mRNA CTD PMID:24449571 Hdac1 Rat arsenous acid multiple interactions ISO HDAC1 (Homo sapiens) 6480464 [[Arsenic Trioxide results in increased phosphorylation of JUN protein] which binds to HDAC1 protein] which binds to CDKN1A promoter more ... CTD PMID:18210215 more ... Hdac1 Rat aspartame multiple interactions ISO Hdac1 (Mus musculus) 6480464 [Fats and Unsaturated co-treated with Sodium Glutamate co-treated with Aspartame] affects the expression of HDAC1 mRNA CTD PMID:23783067 Hdac1 Rat benomyl decreases activity ISO HDAC1 (Homo sapiens) 6480464 Benomyl results in decreased activity of HDAC1 protein CTD PMID:25543211 Hdac1 Rat benzamide decreases activity ISO HDAC1 (Homo sapiens) 6480464 benzamide analog results in decreased activity of HDAC1 protein CTD PMID:19362838 Hdac1 Rat benzo[a]pyrene decreases expression ISO HDAC1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of HDAC1 mRNA CTD PMID:16269432 Hdac1 Rat benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of HDAC1 protein CTD PMID:26358852 Hdac1 Rat benzo[a]pyrene multiple interactions ISO Hdac1 (Mus musculus) 6480464 Benzo(a)pyrene inhibits the reaction [[DNMT1 protein binds to HDAC1 protein] which binds to CYP1A1 promoter] more ... CTD PMID:14625279 and PMID:17682057 Hdac1 Rat benzo[b]fluoranthene decreases expression ISO HDAC1 (Homo sapiens) 6480464 benzo(b)fluoranthene results in decreased expression of HDAC1 mRNA CTD PMID:16269432 Hdac1 Rat beta-naphthoflavone increases expression EXP 6480464 beta-Naphthoflavone results in increased expression of HDAC1 protein CTD PMID:19389873 Hdac1 Rat bisphenol A multiple interactions EXP 6480464 HDAC1 mutant form inhibits the reaction [bisphenol A results in decreased expression of SLC12A5 mRNA] CTD PMID:23440186 Hdac1 Rat bisphenol A affects splicing ISO HDAC1 (Homo sapiens) 6480464 bisphenol A affects the splicing of HDAC1 mRNA CTD PMID:33670352 Hdac1 Rat bisphenol A affects expression ISO HDAC1 (Homo sapiens) 6480464 bisphenol A affects the expression of HDAC1 mRNA CTD PMID:30903817 Hdac1 Rat bisphenol A affects methylation ISO Hdac1 (Mus musculus) 6480464 bisphenol A affects the methylation of HDAC1 promoter CTD PMID:27334623 Hdac1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of HDAC1 mRNA CTD PMID:30816183 more ... Hdac1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of HDAC1 mRNA CTD PMID:25181051 more ... Hdac1 Rat butyric acid multiple interactions ISO Hdac1 (Mus musculus) 6480464 Butyric Acid affects the reaction [9 more ... CTD PMID:24792773 Hdac1 Rat butyric acid multiple interactions EXP 6480464 Butyric Acid inhibits the reaction [[Ethylene Glycol co-treated with Calcium Oxalate] results in increased expression of HDAC1 mRNA] CTD PMID:37414240 Hdac1 Rat butyric acid multiple interactions ISO HDAC1 (Homo sapiens) 6480464 Butyric Acid inhibits the reaction [HDAC1 protein binds to CYP1A1 enhancer] and Butyric Acid inhibits the reaction [Oxalic Acid results in increased expression of HDAC1 mRNA] CTD PMID:27830268 and PMID:37414240 Hdac1 Rat C.I. Natural Red 20 multiple interactions ISO HDAC1 (Homo sapiens) 6480464 [shikonin results in increased acetylation of HDAC1 protein] which results in increased expression of ATF3 protein and shikonin promotes the reaction [HDAC1 protein binds to ATF3 promoter] CTD PMID:37268198 Hdac1 Rat C60 fullerene decreases expression EXP 6480464 fullerene C60 results in decreased expression of HDAC1 mRNA CTD PMID:19167457 Hdac1 Rat cadmium dichloride decreases expression ISO HDAC1 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of HDAC1 mRNA CTD PMID:38568856 Hdac1 Rat caffeine increases expression EXP 6480464 Caffeine results in increased expression of HDAC1 mRNA CTD PMID:24717552 Hdac1 Rat calcium oxalate multiple interactions EXP 6480464 [Ethylene Glycol co-treated with Calcium Oxalate] results in increased expression of HDAC1 mRNA and Butyric Acid inhibits the reaction [[Ethylene Glycol co-treated with Calcium Oxalate] results in increased expression of HDAC1 mRNA] CTD PMID:37414240 Hdac1 Rat captan increases expression ISO Hdac1 (Mus musculus) 6480464 Captan results in increased expression of HDAC1 mRNA CTD PMID:31558096 Hdac1 Rat carbamazepine affects expression ISO HDAC1 (Homo sapiens) 6480464 Carbamazepine affects the expression of HDAC1 mRNA CTD PMID:25979313 Hdac1 Rat Chlamydocin decreases activity ISO HDAC1 (Homo sapiens) 6480464 chlamydocin analog results in decreased activity of HDAC1 protein CTD PMID:16439135 Hdac1 Rat chlorpyrifos decreases methylation EXP 6480464 Chlorpyrifos results in decreased methylation of HDAC1 gene CTD PMID:32905263 Hdac1 Rat chlorpyrifos increases expression EXP 6480464 Chlorpyrifos results in increased expression of HDAC1 mRNA CTD PMID:30290214 Hdac1 Rat choline multiple interactions ISO Hdac1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of HDAC1 gene CTD PMID:20938992 Hdac1 Rat chromium atom multiple interactions ISO Hdac1 (Mus musculus) 6480464 Chromium inhibits the reaction [Benzo(a)pyrene inhibits the reaction [HDAC1 protein binds to CYP1A1 promoter]] more ... CTD PMID:14625279 and PMID:17682057 Hdac1 Rat chromium(6+) multiple interactions ISO HDAC1 (Homo sapiens) 6480464 chromium hexavalent ion promotes the reaction [HDAC1 protein binds to CDH1 promoter] CTD PMID:23518002 Hdac1 Rat ciprofibrate increases expression ISO Hdac1 (Mus musculus) 6480464 ciprofibrate results in increased expression of HDAC1 mRNA CTD PMID:12771043 Hdac1 Rat cisplatin multiple interactions ISO HDAC1 (Homo sapiens) 6480464 Cisplatin inhibits the reaction [[HDAC1 protein co-treated with TP63 protein modified form] binds to BBC3 promoter] CTD PMID:21527555 Hdac1 Rat citalopram decreases expression EXP 6480464 Citalopram results in decreased expression of HDAC1 mRNA CTD PMID:28467792 Hdac1 Rat cobalt dichloride multiple interactions ISO HDAC1 (Homo sapiens) 6480464 cobaltous chloride inhibits the reaction [HDAC1 protein binds to HIF1A promoter] CTD PMID:19714248 Hdac1 Rat copper atom multiple interactions ISO HDAC1 (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in decreased expression of HDAC1 mRNA CTD PMID:30911355 Hdac1 Rat copper(0) multiple interactions ISO HDAC1 (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in decreased expression of HDAC1 mRNA CTD PMID:30911355 Hdac1 Rat cortisol increases expression ISO HDAC1 (Homo sapiens) 6480464 Hydrocortisone results in increased expression of HDAC1 mRNA CTD PMID:34454011 Hdac1 Rat cortisol multiple interactions ISO HDAC1 (Homo sapiens) 6480464 HDAC1 protein affects the reaction [Hydrocortisone results in decreased expression of CYP11A1 mRNA] and SF1 protein inhibits the reaction [Hydrocortisone results in increased expression of HDAC1 mRNA] CTD PMID:34454011 Hdac1 Rat coumarin increases phosphorylation ISO HDAC1 (Homo sapiens) 6480464 coumarin results in increased phosphorylation of HDAC1 protein CTD PMID:35688186 Hdac1 Rat CU-O LINKAGE decreases phosphorylation ISO HDAC1 (Homo sapiens) 6480464 cupric oxide results in decreased phosphorylation of HDAC1 protein CTD PMID:25470785 Hdac1 Rat curcumin decreases expression ISO HDAC1 (Homo sapiens) 6480464 Curcumin analog results in decreased expression of HDAC1 mRNA more ... CTD PMID:17927689 more ... Hdac1 Rat curcumin decreases expression ISO Hdac1 (Mus musculus) 6480464 Curcumin analog results in decreased expression of HDAC1 protein CTD PMID:29228771 Hdac1 Rat curcumin affects localization ISO HDAC1 (Homo sapiens) 6480464 Curcumin affects the localization of HDAC1 protein CTD PMID:17927689 Hdac1 Rat curcumin multiple interactions ISO HDAC1 (Homo sapiens) 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde inhibits the reaction [Curcumin affects the localization of HDAC1 protein] more ... CTD PMID:17927689 Hdac1 Rat cyclosporin A decreases expression ISO HDAC1 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of HDAC1 mRNA CTD PMID:20106945 and PMID:25562108 Hdac1 Rat cyhalothrin multiple interactions EXP 6480464 [Allethrins co-treated with cyhalothrin co-treated with cypermethrin co-treated with decamethrin co-treated with fenvalerate] affects the expression of HDAC1 mRNA more ... CTD PMID:33051911 more ... Hdac1 Rat cypermethrin multiple interactions EXP 6480464 [Allethrins co-treated with cyhalothrin co-treated with cypermethrin co-treated with decamethrin co-treated with fenvalerate] affects the expression of HDAC1 mRNA more ... CTD PMID:33051911 more ... Hdac1 Rat D-glucose multiple interactions ISO Hdac1 (Mus musculus) 6480464 Glucose promotes the reaction [HDAC1 protein binds to TUG1 promoter] CTD PMID:32467232 Hdac1 Rat decabromodiphenyl ether increases expression ISO HDAC1 (Homo sapiens) 6480464 decabromobiphenyl ether results in increased expression of HDAC1 protein CTD PMID:31675489 Hdac1 Rat deoxynivalenol affects phosphorylation ISO Hdac1 (Mus musculus) 6480464 deoxynivalenol affects the phosphorylation of HDAC1 protein CTD PMID:23352502 Hdac1 Rat dexamethasone multiple interactions EXP 6480464 HDAC1 protein inhibits the reaction [Dexamethasone results in increased expression of UCP3 mRNA] CTD PMID:17884810 Hdac1 Rat dexamethasone multiple interactions ISO Hdac1 (Mus musculus) 6480464 [HDAC1 protein co-treated with HDAC2 protein] affects the reaction [Dexamethasone results in decreased expression of CDON mRNA] more ... CTD PMID:27645313 Hdac1 Rat diarsenic trioxide multiple interactions ISO HDAC1 (Homo sapiens) 6480464 [[Arsenic Trioxide results in increased phosphorylation of JUN protein] which binds to HDAC1 protein] which binds to CDKN1A promoter more ... CTD PMID:18210215 more ... Hdac1 Rat dibenz[a,h]anthracene increases expression ISO Hdac1 (Mus musculus) 6480464 1 more ... CTD PMID:26377693 Hdac1 Rat Dibutyl phosphate affects expression ISO HDAC1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of HDAC1 mRNA CTD PMID:37042841 Hdac1 Rat dibutyl phthalate decreases expression ISO Hdac1 (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of HDAC1 mRNA CTD PMID:17361019 and PMID:21266533 Hdac1 Rat dioxygen increases expression EXP 6480464 Oxygen deficiency results in increased expression of HDAC1 protein CTD PMID:22711276 Hdac1 Rat dioxygen multiple interactions EXP 6480464 Valproic Acid inhibits the reaction [Oxygen deficiency results in increased expression of HDAC1 protein] and vorinostat inhibits the reaction [Oxygen deficiency results in increased expression of HDAC1 protein] CTD PMID:22711276 Hdac1 Rat doxorubicin multiple interactions ISO HDAC1 (Homo sapiens) 6480464 Doxorubicin promotes the reaction [HDAC1 protein binds to BIRC5 promoter] CTD PMID:17124180 Hdac1 Rat doxorubicin decreases expression ISO HDAC1 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of HDAC1 mRNA CTD PMID:29803840 Hdac1 Rat doxorubicin increases expression EXP 6480464 Doxorubicin results in increased expression of HDAC1 mRNA CTD PMID:28865727 Hdac1 Rat endosulfan increases expression ISO HDAC1 (Homo sapiens) 6480464 Endosulfan results in increased expression of HDAC1 mRNA and Endosulfan results in increased expression of HDAC1 protein CTD PMID:29054638 Hdac1 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of HDAC1 mRNA CTD PMID:29391264 Hdac1 Rat entinostat increases expression ISO HDAC1 (Homo sapiens) 6480464 entinostat results in increased expression of HDAC1 mRNA CTD PMID:27188386 Hdac1 Rat enzyme inhibitor multiple interactions ISO HDAC1 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of HDAC1 protein CTD PMID:23301498 Hdac1 Rat ethanol multiple interactions EXP 598092506 ethanol inhibits the reaction [LPS decreases expression of Hdac1 protein in hypothalamic microglia] RGD Hdac1 Rat ethanol increases expression EXP 6480464 Ethanol results in increased expression of HDAC1 mRNA CTD PMID:34454011 Hdac1 Rat ethylene glycol multiple interactions EXP 6480464 [Ethylene Glycol co-treated with Calcium Oxalate] results in increased expression of HDAC1 mRNA and Butyric Acid inhibits the reaction [[Ethylene Glycol co-treated with Calcium Oxalate] results in increased expression of HDAC1 mRNA] CTD PMID:37414240 Hdac1 Rat fenvalerate multiple interactions EXP 6480464 [Allethrins co-treated with cyhalothrin co-treated with cypermethrin co-treated with decamethrin co-treated with fenvalerate] affects the expression of HDAC1 mRNA more ... CTD PMID:33051911 more ... Hdac1 Rat fingolimod hydrochloride affects binding ISO HDAC1 (Homo sapiens) 6480464 Fingolimod Hydrochloride metabolite binds to HDAC1 protein CTD PMID:24859201 Hdac1 Rat fingolimod hydrochloride multiple interactions ISO HDAC1 (Homo sapiens) 6480464 Fingolimod Hydrochloride metabolite inhibits the reaction [S1PR1 protein binds to HDAC1 protein] and SPHK2 protein promotes the reaction [Fingolimod Hydrochloride metabolite binds to HDAC1 protein] CTD PMID:24859201 Hdac1 Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of HDAC1 mRNA CTD PMID:24793618 Hdac1 Rat folic acid multiple interactions ISO Hdac1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of HDAC1 gene CTD PMID:20938992 Hdac1 Rat folic acid decreases expression ISO Hdac1 (Mus musculus) 6480464 Folic Acid results in decreased expression of HDAC1 mRNA CTD PMID:25629700 Hdac1 Rat FR900359 affects phosphorylation ISO HDAC1 (Homo sapiens) 6480464 FR900359 affects the phosphorylation of HDAC1 protein CTD PMID:37730182 Hdac1 Rat furan increases methylation EXP 6480464 furan results in increased methylation of HDAC1 gene CTD PMID:22079235 Hdac1 Rat genistein decreases expression ISO HDAC1 (Homo sapiens) 6480464 Genistein results in decreased expression of HDAC1 protein CTD PMID:23593078 Hdac1 Rat genistein multiple interactions ISO HDAC1 (Homo sapiens) 6480464 Genistein promotes the reaction [HDAC1 protein binds to COMT promoter] and sulforaphane inhibits the reaction [Genistein promotes the reaction [HDAC1 protein binds to COMT promoter]] CTD PMID:30684530 Hdac1 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of HDAC1 mRNA CTD PMID:22061828 Hdac1 Rat gentamycin increases expression ISO Hdac1 (Mus musculus) 6480464 Gentamicins results in increased expression of HDAC1 protein CTD PMID:19141081 and PMID:23558232 Hdac1 Rat glucaric acid multiple interactions ISO Hdac1 (Mus musculus) 6480464 Glucaric Acid affects the reaction [9 more ... CTD PMID:24792773 Hdac1 Rat glucose multiple interactions ISO Hdac1 (Mus musculus) 6480464 Glucose promotes the reaction [HDAC1 protein binds to TUG1 promoter] CTD PMID:32467232 Hdac1 Rat glyphosate decreases expression ISO HDAC1 (Homo sapiens) 6480464 Glyphosate results in decreased expression of HDAC1 mRNA CTD PMID:31295307 Hdac1 Rat guggulsterone decreases expression ISO HDAC1 (Homo sapiens) 6480464 pregna-4 more ... CTD PMID:23593078 Hdac1 Rat hesperidin multiple interactions ISO HDAC1 (Homo sapiens) 6480464 Hesperidin inhibits the reaction [[manganese chloride results in increased abundance of Manganese] promotes the reaction [YY1 protein binds to HDAC1 protein]] CTD PMID:34800614 Hdac1 Rat Honokiol multiple interactions ISO HDAC1 (Homo sapiens) 6480464 honokiol binds to and results in decreased activity of HDAC1 protein CTD PMID:34973135 Hdac1 Rat hydrogen peroxide decreases expression ISO HDAC1 (Homo sapiens) 6480464 Hydrogen Peroxide results in decreased expression of HDAC1 mRNA CTD PMID:12419474 Hdac1 Rat hydrogen peroxide increases expression ISO HDAC1 (Homo sapiens) 6480464 Hydrogen Peroxide results in increased expression of HDAC1 mRNA and Hydrogen Peroxide results in increased expression of HDAC1 protein CTD PMID:27655674 Hdac1 Rat hydrogen peroxide multiple interactions ISO Hdac1 (Mus musculus) 6480464 Hydrogen Peroxide promotes the reaction [[HDAC1 protein binds to CTCF promoter] which results in decreased expression of CTCF] and Hydrogen Peroxide promotes the reaction [HDAC1 protein binds to CTCF promoter] CTD PMID:24558376 Hdac1 Rat hydroquinone increases expression ISO HDAC1 (Homo sapiens) 6480464 hydroquinone results in increased expression of HDAC1 mRNA and hydroquinone results in increased expression of HDAC1 protein CTD PMID:27220438 and PMID:30448557 Hdac1 Rat hydroquinone multiple interactions ISO HDAC1 (Homo sapiens) 6480464 trichostatin A inhibits the reaction [hydroquinone results in increased expression of HDAC1 mRNA] CTD PMID:27220438 Hdac1 Rat indirubin multiple interactions ISO Hdac1 (Mus musculus) 6480464 [tanshinone co-treated with indirubin] inhibits the reaction [RARB protein binds to HDAC1 protein] more ... CTD PMID:18344322 Hdac1 Rat indole-3-methanol multiple interactions ISO Hdac1 (Mus musculus) 6480464 indole-3-carbinol inhibits the reaction [enterotoxin B and staphylococcal results in increased expression of HDAC1 mRNA] CTD PMID:24200994 Hdac1 Rat ivermectin decreases expression ISO HDAC1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of HDAC1 protein CTD PMID:32959892 Hdac1 Rat L-methionine multiple interactions ISO Hdac1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of HDAC1 gene CTD PMID:20938992 Hdac1 Rat lead(0) affects expression ISO HDAC1 (Homo sapiens) 6480464 Lead affects the expression of HDAC1 mRNA CTD PMID:28903495 Hdac1 Rat lead(0) multiple interactions EXP 6480464 [HDAC1 protein co-treated with HDAC2 protein] inhibits the reaction [Lead results in decreased expression of NOTCH2 protein] and Lead promotes the reaction [HDAC1 protein binds to HDAC2 protein] CTD PMID:29301062 Hdac1 Rat lipopolysaccharide multiple interactions ISO Hdac1 (Mus musculus) 6480464 Lipopolysaccharides inhibits the reaction [HDAC1 protein binds to CCL20 promoter] and Lipopolysaccharides inhibits the reaction [HDAC1 protein binds to CYP1A1 promoter] CTD PMID:26259605 Hdac1 Rat lipopolysaccharide increases expression EXP 598092506 LPS increases expression of Hda1c protein in hypothalamic microglia RGD Hdac1 Rat lithium chloride multiple interactions ISO Hdac1 (Mus musculus) 6480464 Lithium Chloride inhibits the reaction [HDAC1 protein binds to GCG promoter] and Lithium Chloride inhibits the reaction [HDAC1 protein binds to GIP promoter] CTD PMID:19582394 Hdac1 Rat lovastatin increases expression ISO Hdac1 (Mus musculus) 6480464 Lovastatin results in increased expression of HDAC1 mRNA CTD PMID:20493250 Hdac1 Rat manganese atom multiple interactions EXP 6480464 Manganese promotes the reaction [RELA protein binds to HDAC1 protein] and Manganese promotes the reaction [YY1 protein binds to HDAC1 protein] CTD PMID:24469401 Hdac1 Rat manganese atom multiple interactions ISO HDAC1 (Homo sapiens) 6480464 [manganese chloride results in increased abundance of Manganese] promotes the reaction [YY1 protein binds to HDAC1 protein] and Hesperidin inhibits the reaction [[manganese chloride results in increased abundance of Manganese] promotes the reaction [YY1 protein binds to HDAC1 protein]] CTD PMID:34800614 Hdac1 Rat manganese(0) multiple interactions EXP 6480464 Manganese promotes the reaction [RELA protein binds to HDAC1 protein] and Manganese promotes the reaction [YY1 protein binds to HDAC1 protein] CTD PMID:24469401 Hdac1 Rat manganese(0) multiple interactions ISO HDAC1 (Homo sapiens) 6480464 [manganese chloride results in increased abundance of Manganese] promotes the reaction [YY1 protein binds to HDAC1 protein] and Hesperidin inhibits the reaction [[manganese chloride results in increased abundance of Manganese] promotes the reaction [YY1 protein binds to HDAC1 protein]] CTD PMID:34800614 Hdac1 Rat manganese(II) chloride multiple interactions ISO HDAC1 (Homo sapiens) 6480464 [manganese chloride results in increased abundance of Manganese] promotes the reaction [YY1 protein binds to HDAC1 protein] and Hesperidin inhibits the reaction [[manganese chloride results in increased abundance of Manganese] promotes the reaction [YY1 protein binds to HDAC1 protein]] CTD PMID:34800614 Hdac1 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of HDAC1 mRNA CTD PMID:30047161 Hdac1 Rat methotrexate decreases expression ISO HDAC1 (Homo sapiens) 6480464 Methotrexate results in decreased expression of HDAC1 mRNA CTD PMID:24449571 Hdac1 Rat methoxyacetic acid decreases activity ISO HDAC1 (Homo sapiens) 6480464 methoxyacetic acid results in decreased activity of HDAC1 protein CTD PMID:15103026 Hdac1 Rat methoxyacetic acid decreases activity ISO Hdac1 (Mus musculus) 6480464 methoxyacetic acid results in decreased activity of HDAC1 protein CTD PMID:32496642 Hdac1 Rat methylmercury chloride decreases expression ISO Hdac1 (Mus musculus) 6480464 methylmercuric chloride results in decreased expression of HDAC1 mRNA CTD PMID:20061341 Hdac1 Rat mocetinostat decreases expression ISO HDAC1 (Homo sapiens) 6480464 mocetinostat results in decreased expression of HDAC1 protein CTD PMID:26378038 Hdac1 Rat monosodium L-glutamate multiple interactions ISO Hdac1 (Mus musculus) 6480464 [Fats and Unsaturated co-treated with Sodium Glutamate co-treated with Aspartame] affects the expression of HDAC1 mRNA CTD PMID:23783067 Hdac1 Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal multiple interactions ISO HDAC1 (Homo sapiens) 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde inhibits the reaction [Curcumin affects the localization of HDAC1 protein] more ... CTD PMID:17395887 and PMID:17927689 Hdac1 Rat N-ethyl-N-nitrosourea increases expression ISO Hdac1 (Mus musculus) 6480464 Ethylnitrosourea results in increased expression of HDAC1 CTD PMID:21154115 Hdac1 Rat N-nitrosodiethylamine multiple interactions ISO Hdac1 (Mus musculus) 6480464 AHR protein inhibits the reaction [Diethylnitrosamine results in decreased expression of HDAC1 mRNA] CTD PMID:19996281 Hdac1 Rat N-nitrosodiethylamine increases expression ISO Hdac1 (Mus musculus) 6480464 Diethylnitrosamine results in increased expression of HDAC1 mRNA CTD PMID:12771043 Hdac1 Rat N-nitrosodiethylamine decreases expression ISO Hdac1 (Mus musculus) 6480464 Diethylnitrosamine results in decreased expression of HDAC1 mRNA CTD PMID:19996281 Hdac1 Rat N-Vinyl-2-pyrrolidone multiple interactions EXP 6480464 [N-vinyl-2-pyrrolidinone binds to N-vinyl-2-pyrrolidinone] which affects the expression of HDAC1 mRNA CTD PMID:22037397 Hdac1 Rat nicotinamide multiple interactions ISO Hdac1 (Mus musculus) 6480464 Niacinamide affects the reaction [9 more ... CTD PMID:24792773 Hdac1 Rat nicotine increases expression ISO HDAC1 (Homo sapiens) 6480464 Nicotine results in increased expression of HDAC1 mRNA CTD PMID:24709674 Hdac1 Rat nicotine multiple interactions EXP 6480464 SNAI1 protein affects the reaction [Nicotine results in increased expression of HDAC1 mRNA] and SNAI1 protein affects the reaction [Nicotine results in increased expression of HDAC1 protein] CTD PMID:34245815 Hdac1 Rat nicotine increases expression EXP 6480464 Nicotine results in increased expression of HDAC1 mRNA and Nicotine results in increased expression of HDAC1 protein CTD PMID:34245815 Hdac1 Rat nitrates multiple interactions ISO Hdac1 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of HDAC1 mRNA CTD PMID:35964746 Hdac1 Rat oleanolic acid decreases expression ISO HDAC1 (Homo sapiens) 6480464 Oleanolic Acid results in decreased expression of HDAC1 protein CTD PMID:20726234 Hdac1 Rat oxalic acid increases expression ISO HDAC1 (Homo sapiens) 6480464 Oxalic Acid results in increased expression of HDAC1 mRNA CTD PMID:37414240 Hdac1 Rat oxalic acid multiple interactions ISO HDAC1 (Homo sapiens) 6480464 Butyric Acid inhibits the reaction [Oxalic Acid results in increased expression of HDAC1 mRNA] CTD PMID:37414240 Hdac1 Rat oxybenzone increases expression EXP 6480464 oxybenzone results in increased expression of HDAC1 protein CTD PMID:31368502 Hdac1 Rat paracetamol decreases expression ISO HDAC1 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of HDAC1 mRNA CTD PMID:21420995 Hdac1 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of HDAC1 mRNA CTD PMID:33387578 Hdac1 Rat pelargonidin decreases expression ISO Hdac1 (Mus musculus) 6480464 pelargonidin results in decreased expression of HDAC1 protein CTD PMID:31181187 Hdac1 Rat pentachlorophenol increases expression ISO Hdac1 (Mus musculus) 6480464 Pentachlorophenol results in increased expression of HDAC1 mRNA CTD PMID:23892564 Hdac1 Rat phenethyl isothiocyanate multiple interactions EXP 6480464 phenethyl isothiocyanate inhibits the reaction [Freund's Adjuvant results in increased expression of HDAC1 protein] CTD PMID:32289289 Hdac1 Rat potassium chloride multiple interactions ISO Hdac1 (Mus musculus) 6480464 Potassium Chloride inhibits the reaction [HDAC1 protein binds to BDNF promoter] CTD PMID:14593183 Hdac1 Rat pregnenolone 16alpha-carbonitrile increases expression EXP 6480464 Pregnenolone Carbonitrile results in increased expression of HDAC1 mRNA CTD PMID:30047161 Hdac1 Rat progesterone decreases expression ISO HDAC1 (Homo sapiens) 6480464 Progesterone results in decreased expression of HDAC1 mRNA CTD PMID:18037150 Hdac1 Rat pyrethrins increases expression EXP 6480464 Pyrethrins results in increased expression of HDAC1 mRNA CTD PMID:34896426 Hdac1 Rat resveratrol decreases expression ISO HDAC1 (Homo sapiens) 6480464 resveratrol results in decreased expression of HDAC1 protein CTD PMID:23593078 Hdac1 Rat resveratrol multiple interactions ISO HDAC1 (Homo sapiens) 6480464 [[resveratrol results in decreased expression of MTA1 protein] inhibits the reaction [MTA1 protein binds to HDAC1 protein]] which results in increased acetylation of and results in increased activity of TP53 protein more ... CTD PMID:19810103 and PMID:25875864 Hdac1 Rat resveratrol increases expression ISO Hdac1 (Mus musculus) 6480464 resveratrol results in increased expression of HDAC1 mRNA CTD PMID:22610192 Hdac1 Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of HDAC1 protein CTD PMID:35544339 Hdac1 Rat Shikonin multiple interactions ISO HDAC1 (Homo sapiens) 6480464 [shikonin results in increased acetylation of HDAC1 protein] which results in increased expression of ATF3 protein and shikonin promotes the reaction [HDAC1 protein binds to ATF3 promoter] CTD PMID:37268198 Hdac1 Rat sodium arsenate increases expression ISO Hdac1 (Mus musculus) 6480464 sodium arsenate results in increased expression of HDAC1 protein CTD PMID:26193056 Hdac1 Rat sodium arsenite multiple interactions ISO HDAC1 (Homo sapiens) 6480464 Estradiol inhibits the reaction [sodium arsenite results in increased expression of HDAC1 mRNA] and sodium arsenite inhibits the reaction [Estradiol results in increased expression of HDAC1 mRNA] CTD PMID:22952798 Hdac1 Rat sodium arsenite decreases expression ISO HDAC1 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of HDAC1 mRNA CTD PMID:38568856 Hdac1 Rat sodium arsenite increases expression ISO HDAC1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of HDAC1 mRNA CTD PMID:22952798 and PMID:34032870 Hdac1 Rat Soman increases expression EXP 6480464 Soman results in increased expression of HDAC1 mRNA CTD PMID:19281266 Hdac1 Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of HDAC1 mRNA CTD PMID:30047161 Hdac1 Rat sulforaphane multiple interactions ISO HDAC1 (Homo sapiens) 6480464 sulforaphane inhibits the reaction [Estradiol promotes the reaction [HDAC1 protein binds to COMT promoter]] more ... CTD PMID:30684530 Hdac1 Rat sulforaphane decreases expression ISO HDAC1 (Homo sapiens) 6480464 sulforaphane results in decreased expression of HDAC1 mRNA CTD PMID:30684530 Hdac1 Rat sulindac sulfide decreases expression ISO HDAC1 (Homo sapiens) 6480464 sulindac sulfide results in decreased expression of HDAC1 mRNA CTD PMID:16184548 Hdac1 Rat sunitinib decreases expression ISO HDAC1 (Homo sapiens) 6480464 Sunitinib results in decreased expression of HDAC1 mRNA CTD PMID:31533062 Hdac1 Rat taiwanin C decreases expression ISO HDAC1 (Homo sapiens) 153305910 taiwanin C decreases expression of HDAC1 protein in Chondrocyte Cells RGD Hdac1 Rat tamoxifen multiple interactions ISO HDAC1 (Homo sapiens) 6480464 Tamoxifen promotes the reaction [HDAC1 protein binds to FOXM1 promoter] CTD PMID:20208560 Hdac1 Rat tangeretin decreases expression ISO Hdac1 (Mus musculus) 6480464 tangeretin metabolite results in decreased expression of HDAC1 protein and tangeretin results in decreased expression of HDAC1 protein CTD PMID:37517432 Hdac1 Rat Tanshinone I multiple interactions ISO Hdac1 (Mus musculus) 6480464 [tanshinone co-treated with indirubin] inhibits the reaction [RARB protein binds to HDAC1 protein] more ... CTD PMID:18344322 Hdac1 Rat temozolomide increases expression ISO HDAC1 (Homo sapiens) 6480464 Temozolomide results in increased expression of HDAC1 mRNA CTD PMID:31758290 Hdac1 Rat tert-butyl hydroperoxide decreases expression ISO HDAC1 (Homo sapiens) 6480464 tert-Butylhydroperoxide results in decreased expression of HDAC1 mRNA CTD PMID:12419474 Hdac1 Rat tetrachloromethane increases expression ISO Hdac1 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of HDAC1 mRNA CTD PMID:27396813 Hdac1 Rat theophylline increases activity ISO HDAC1 (Homo sapiens) 6480464 Theophylline results in increased activity of HDAC1 protein CTD PMID:12070353 Hdac1 Rat theophylline increases expression ISO HDAC1 (Homo sapiens) 6480464 Theophylline results in increased expression of HDAC1 protein CTD PMID:12070353 and PMID:15337792 Hdac1 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of HDAC1 mRNA CTD PMID:34492290 Hdac1 Rat thiophenes multiple interactions ISO HDAC1 (Homo sapiens) 6480464 Thiophenes analog promotes the reaction [Tretinoin results in increased expression of HDAC1 mRNA] CTD PMID:16140955 Hdac1 Rat thiram decreases expression ISO HDAC1 (Homo sapiens) 6480464 Thiram results in decreased expression of HDAC1 mRNA CTD PMID:38568856 Hdac1 Rat titanium dioxide decreases methylation ISO Hdac1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of HDAC1 gene CTD PMID:35295148 Hdac1 Rat Trapoxin B decreases activity ISO HDAC1 (Homo sapiens) 6480464 trapoxin B results in decreased activity of HDAC1 protein CTD PMID:15930892 Hdac1 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of HDAC1 mRNA CTD PMID:33387578 Hdac1 Rat trichostatin A decreases activity ISO HDAC1 (Homo sapiens) 6480464 trichostatin A results in decreased activity of HDAC1 protein CTD PMID:15103026 more ... Hdac1 Rat trichostatin A decreases activity ISO Hdac1 (Mus musculus) 6480464 trichostatin A results in decreased activity of HDAC1 protein CTD PMID:32496642 Hdac1 Rat trichostatin A multiple interactions ISO HDAC1 (Homo sapiens) 6480464 trichostatin A inhibits the reaction [hydroquinone results in increased expression of HDAC1 mRNA] CTD PMID:27220438 Hdac1 Rat trichostatin A decreases expression ISO HDAC1 (Homo sapiens) 6480464 trichostatin A results in decreased expression of HDAC1 protein CTD PMID:23285096 Hdac1 Rat Triptolide increases expression EXP 6480464 triptolide results in increased expression of HDAC1 mRNA CTD PMID:23639586 Hdac1 Rat triptonide increases expression ISO Hdac1 (Mus musculus) 6480464 triptonide results in increased expression of HDAC1 mRNA CTD PMID:33045310 Hdac1 Rat valproic acid decreases activity ISO HDAC1 (Homo sapiens) 6480464 Valproic Acid results in decreased activity of HDAC1 protein CTD PMID:15103026 Hdac1 Rat valproic acid decreases activity ISO Hdac1 (Mus musculus) 6480464 Valproic Acid results in decreased activity of HDAC1 protein CTD PMID:32496642 Hdac1 Rat valproic acid decreases methylation ISO HDAC1 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of HDAC1 gene CTD PMID:29501571 Hdac1 Rat valproic acid decreases expression ISO Hdac1 (Mus musculus) 6480464 Valproic Acid results in decreased expression of HDAC1 mRNA CTD PMID:31445079 Hdac1 Rat valproic acid multiple interactions EXP 6480464 Valproic Acid inhibits the reaction [Oxygen deficiency results in increased expression of HDAC1 protein] CTD PMID:22711276 Hdac1 Rat valproic acid increases expression ISO HDAC1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of HDAC1 mRNA CTD PMID:23179753 more ... Hdac1 Rat valproic acid affects expression ISO HDAC1 (Homo sapiens) 6480464 Valproic Acid affects the expression of HDAC1 mRNA CTD PMID:25979313 Hdac1 Rat valproic acid multiple interactions ISO HDAC1 (Homo sapiens) 6480464 [Valproic Acid co-treated with arsenic trioxide] results in decreased expression of HDAC1 mRNA CTD PMID:25815518 Hdac1 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of HDAC1 mRNA CTD PMID:18042343 and PMID:23555832 Hdac1 Rat vincristine decreases expression EXP 6480464 Vincristine results in decreased expression of HDAC1 protein CTD PMID:27474498 Hdac1 Rat vitamin E increases expression ISO HDAC1 (Homo sapiens) 6480464 Vitamin E results in increased expression of HDAC1 mRNA CTD PMID:19244175 Hdac1 Rat vorinostat multiple interactions ISO HDAC1 (Homo sapiens) 6480464 vorinostat inhibits the reaction [monomethylarsonous acid results in increased expression of HDAC1 mRNA] CTD PMID:23891734 Hdac1 Rat vorinostat decreases expression ISO HDAC1 (Homo sapiens) 6480464 Vorinostat results in decreased expression of HDAC1 mRNA and Vorinostat results in decreased expression of HDAC1 protein CTD PMID:28963909 Hdac1 Rat vorinostat multiple interactions EXP 6480464 vorinostat inhibits the reaction [Oxygen deficiency results in increased expression of HDAC1 protein] CTD PMID:22711276 Hdac1 Rat vorinostat decreases activity ISO HDAC1 (Homo sapiens) 6480464 vorinostat results in decreased activity of HDAC1 protein CTD PMID:15930892 Hdac1 Rat warfarin increases expression ISO Hdac1 (Mus musculus) 6480464 Warfarin results in increased expression of HDAC1 mRNA CTD PMID:20493250 Hdac1 Rat withaferin A decreases expression ISO HDAC1 (Homo sapiens) 6480464 withaferin A results in decreased expression of HDAC1 protein CTD PMID:23593078 Hdac1 Rat zileuton decreases expression EXP 6480464 zileuton results in decreased expression of HDAC1 mRNA CTD PMID:12883083 Hdac1 Rat zinc atom multiple interactions ISO HDAC1 (Homo sapiens) 6480464 Zinc binds to and results in increased activity of HDAC1 protein CTD PMID:16439135 Hdac1 Rat zinc atom multiple interactions ISO Hdac1 (Mus musculus) 6480464 [zinc chloride results in increased abundance of Zinc] which results in decreased expression of HDAC1 mRNA CTD PMID:31588059 Hdac1 Rat zinc dichloride multiple interactions ISO Hdac1 (Mus musculus) 6480464 [zinc chloride results in increased abundance of Zinc] which results in decreased expression of HDAC1 mRNA CTD PMID:31588059 Hdac1 Rat zinc(0) multiple interactions ISO HDAC1 (Homo sapiens) 6480464 Zinc binds to and results in increased activity of HDAC1 protein CTD PMID:16439135 Hdac1 Rat zinc(0) multiple interactions ISO Hdac1 (Mus musculus) 6480464 [zinc chloride results in increased abundance of Zinc] which results in decreased expression of HDAC1 mRNA CTD PMID:31588059
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(20S)-ginsenoside Rh2 (ISO) (S)-nicotine (EXP,ISO) 1,2-dimethylhydrazine (ISO) 1-[3-(dimethylamino)propyl]-1-(4-fluorophenyl)-1,3-dihydro-2-benzofuran-5-carbonitrile (EXP) 15-deoxy-Delta(12,14)-prostaglandin J2 (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-tribromophenol (ISO) 3,3',4,4',5-pentachlorobiphenyl (ISO) 3,3'-diindolylmethane (ISO) 3,4-methylenedioxymethamphetamine (ISO) 4-phenylbutyric acid (ISO) 5-aza-2'-deoxycytidine (ISO) 5-fluorouracil (ISO) 6-propyl-2-thiouracil (EXP) 7,12-dimethyltetraphene (ISO) acetylsalicylic acid (ISO) acrylamide (EXP) aldehydo-D-glucose (ISO) all-trans-retinoic acid (ISO) allethrin (EXP) alpha-mangostin (ISO) amitrole (EXP) ammonium chloride (EXP) amphetamine (EXP,ISO) andrographolide (ISO) antirheumatic drug (ISO) arsenous acid (ISO) aspartame (ISO) benomyl (ISO) benzamide (ISO) benzo[a]pyrene (EXP,ISO) benzo[b]fluoranthene (ISO) beta-naphthoflavone (EXP) bisphenol A (EXP,ISO) butyric acid (EXP,ISO) C.I. Natural Red 20 (ISO) C60 fullerene (EXP) cadmium dichloride (ISO) caffeine (EXP) calcium oxalate (EXP) captan (ISO) carbamazepine (ISO) Chlamydocin (ISO) chlorpyrifos (EXP) choline (ISO) chromium atom (ISO) chromium(6+) (ISO) ciprofibrate (ISO) cisplatin (ISO) citalopram (EXP) cobalt dichloride (ISO) copper atom (ISO) copper(0) (ISO) cortisol (ISO) coumarin (ISO) CU-O LINKAGE (ISO) curcumin (ISO) cyclosporin A (ISO) cyhalothrin (EXP) cypermethrin (EXP) D-glucose (ISO) decabromodiphenyl ether (ISO) deoxynivalenol (ISO) dexamethasone (EXP,ISO) diarsenic trioxide (ISO) dibenz[a,h]anthracene (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (ISO) dioxygen (EXP) doxorubicin (EXP,ISO) endosulfan (EXP,ISO) entinostat (ISO) enzyme inhibitor (ISO) ethanol (EXP) ethylene glycol (EXP) fenvalerate (EXP) fingolimod hydrochloride (ISO) flutamide (EXP) folic acid (ISO) FR900359 (ISO) furan (EXP) genistein (ISO) gentamycin (EXP,ISO) glucaric acid (ISO) glucose (ISO) glyphosate (ISO) guggulsterone (ISO) hesperidin (ISO) Honokiol (ISO) hydrogen peroxide (ISO) hydroquinone (ISO) indirubin (ISO) indole-3-methanol (ISO) ivermectin (ISO) L-methionine (ISO) lead(0) (EXP,ISO) lipopolysaccharide (EXP,ISO) lithium chloride (ISO) lovastatin (ISO) manganese atom (EXP,ISO) manganese(0) (EXP,ISO) manganese(II) chloride (ISO) methimazole (EXP) methotrexate (ISO) methoxyacetic acid (ISO) methylmercury chloride (ISO) mocetinostat (ISO) monosodium L-glutamate (ISO) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO) N-ethyl-N-nitrosourea (ISO) N-nitrosodiethylamine (ISO) N-Vinyl-2-pyrrolidone (EXP) nicotinamide (ISO) nicotine (EXP,ISO) nitrates (ISO) oleanolic acid (ISO) oxalic acid (ISO) oxybenzone (EXP) paracetamol (EXP,ISO) pelargonidin (ISO) pentachlorophenol (ISO) phenethyl isothiocyanate (EXP) potassium chloride (ISO) pregnenolone 16alpha-carbonitrile (EXP) progesterone (ISO) pyrethrins (EXP) resveratrol (ISO) rotenone (EXP) Shikonin (ISO) sodium arsenate (ISO) sodium arsenite (ISO) Soman (EXP) sulfadimethoxine (EXP) sulforaphane (ISO) sulindac sulfide (ISO) sunitinib (ISO) taiwanin C (ISO) tamoxifen (ISO) tangeretin (ISO) Tanshinone I (ISO) temozolomide (ISO) tert-butyl hydroperoxide (ISO) tetrachloromethane (ISO) theophylline (ISO) thioacetamide (EXP) thiophenes (ISO) thiram (ISO) titanium dioxide (ISO) Trapoxin B (ISO) trichloroethene (EXP) trichostatin A (ISO) Triptolide (EXP) triptonide (ISO) valproic acid (EXP,ISO) vinclozolin (EXP) vincristine (EXP) vitamin E (ISO) vorinostat (EXP,ISO) warfarin (ISO) withaferin A (ISO) zileuton (EXP) zinc atom (ISO) zinc dichloride (ISO) zinc(0) (ISO)
Molecular Function
chromatin binding (IDA,ISO) core promoter sequence-specific DNA binding (ISO) deacetylase activity (IDA) DNA binding (ISO) DNA-binding transcription factor binding (IPI,ISO) E-box binding (ISO) enzyme binding (ISO) histone deacetylase activity (IBA,IEA,ISO,ISS) histone deacetylase activity, hydrolytic mechanism (IEA) histone deacetylase binding (ISO) histone decrotonylase activity (ISO,ISS) hydrolase activity (IEA) Krueppel-associated box domain binding (ISO) metal ion binding (IEA) NF-kappaB binding (ISO) p53 binding (ISO) promoter-specific chromatin binding (ISO) protein binding (IPI,ISO) protein decrotonylase activity (IEA) protein lysine deacetylase activity (IEA,ISO) protein lysine delactylase activity (IEA,ISO,ISS) protein-containing complex binding (IDA) RNA polymerase II cis-regulatory region sequence-specific DNA binding (ISO) RNA polymerase II core promoter sequence-specific DNA binding (ISO) RNA polymerase II-specific DNA-binding transcription factor binding (ISO) transcription cis-regulatory region binding (ISO) transcription corepressor activity (ISO) transcription corepressor binding (ISO) transcription factor binding (IPI)
1.
Histone deacetylase-1 (HDAC1) is a molecular switch between neuronal survival and death.
Bardai FH, etal., J Biol Chem. 2012 Oct 12;287(42):35444-53. doi: 10.1074/jbc.M112.394544. Epub 2012 Aug 23.
2.
The nucleosome remodeling and deacetylase complex in development and disease.
Basta J and Rauchman M, Transl Res. 2014 May 10. pii: S1931-5244(14)00166-2. doi: 10.1016/j.trsl.2014.05.003.
3.
Lipopolysaccharide induces epididymal and testicular antimicrobial gene expression in vitro: insights into the epigenetic regulation of sperm-associated antigen 11e gene.
Biswas B and Yenugu S, Immunogenetics. 2013 Apr;65(4):239-53. doi: 10.1007/s00251-012-0674-5. Epub 2012 Dec 28.
4.
Exposure to caregiver maltreatment alters expression levels of epigenetic regulators in the medial prefrontal cortex.
Blaze J and Roth TL, Int J Dev Neurosci. 2013 Dec;31(8):804-10. doi: 10.1016/j.ijdevneu.2013.10.001. Epub 2013 Oct 10.
5.
Satb2 is a postmitotic determinant for upper-layer neuron specification in the neocortex.
Britanova O, etal., Neuron. 2008 Feb 7;57(3):378-92. doi: 10.1016/j.neuron.2007.12.028.
6.
CHIP attenuates lipopolysaccharide-induced cardiac hypertrophy and apoptosis by promoting NFATc3 proteasomal degradation.
Chao CN, etal., J Cell Physiol. 2019 Nov;234(11):20128-20138. doi: 10.1002/jcp.28614. Epub 2019 Apr 13.
7.
Early life alcohol exposure primes hypothalamic microglia to later-life hypersensitivity to immune stress: possible epigenetic mechanism.
Chastain LG, etal., Neuropsychopharmacology. 2019 Aug;44(9):1579-1588. doi: 10.1038/s41386-019-0326-7. Epub 2019 Jan 30.
8.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
9.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
10.
The expression of histone deacetylase 4 is associated with prednisone poor-response in childhood acute lymphoblastic leukemia.
Gruhn B, etal., Leuk Res. 2013 Oct;37(10):1200-7. doi: 10.1016/j.leukres.2013.07.016. Epub 2013 Aug 12.
11.
HDAC4 and PCAF bind to cardiac sarcomeres and play a role in regulating myofilament contractile activity.
Gupta MP, etal., J Biol Chem. 2008 Apr 11;283(15):10135-46. Epub 2008 Feb 4.
12.
Upregulation and nuclear recruitment of HDAC1 in hormone refractory prostate cancer.
Halkidou K, etal., Prostate. 2004 May 1;59(2):177-89.
13.
Down-regulation of β-catenin and the associated migration ability by Taiwanin C in arecoline and 4-NQO-induced oral cancer cells via GSK-3β activation.
Hsieh CH, etal., Mol Carcinog. 2017 Mar;56(3):1055-1067. doi: 10.1002/mc.22570. Epub 2016 Oct 4.
14.
Transcriptional repression by REST: recruitment of Sin3A and histone deacetylase to neuronal genes.
Huang Y, etal., Nat Neurosci. 1999 Oct;2(10):867-72.
15.
Selective histone deacetylase (HDAC) inhibition imparts beneficial effects in Huntington's disease mice: implications for the ubiquitin-proteasomal and autophagy systems.
Jia H, etal., Hum Mol Genet. 2012 Dec 15;21(24):5280-93. doi: 10.1093/hmg/dds379. Epub 2012 Sep 10.
16.
Histone deacetylase expression in white matter oligodendrocytes after stroke.
Kassis H, etal., Neurochem Int. 2014 Nov;77:17-23. doi: 10.1016/j.neuint.2014.03.006. Epub 2014 Mar 19.
17.
Oxidative stress regulates IGF1R expression in vascular smooth-muscle cells via p53 and HDAC recruitment.
Kavurma MM, etal., Biochem J. 2007 Oct 1;407(1):79-87.
18.
Uteroplacental insufficiency affects epigenetic determinants of chromatin structure in brains of neonatal and juvenile IUGR rats.
Ke X, etal., Physiol Genomics. 2006 Mar 13;25(1):16-28. Epub 2005 Dec 27.
19.
HDAC inhibition suppresses cardiac hypertrophy and fibrosis in DOCA-salt hypertensive rats via regulation of HDAC6/HDAC8 enzyme activity.
Kee HJ, etal., Kidney Blood Press Res. 2013;37(4-5):229-39. doi: 10.1159/000350148. Epub 2013 Jul 8.
20.
Drug-induced inactivation or gene silencing of class I histone deacetylases suppresses ovarian cancer cell growth: implications for therapy.
Khabele D, etal., Cancer Biol Ther. 2007 May;6(5):795-801. Epub 2007 Feb 14.
21.
Clinically relevant concentrations of valproic acid modulate melatonin MT(1) receptor, HDAC and MeCP2 mRNA expression in C6 glioma cells.
Kim B, etal., Eur J Pharmacol. 2008 Jul 28;589(1-3):45-8. Epub 2008 May 7.
22.
HDAC1 nuclear export induced by pathological conditions is essential for the onset of axonal damage.
Kim JY, etal., Nat Neurosci. 2010 Feb;13(2):180-9. doi: 10.1038/nn.2471. Epub 2009 Dec 27.
23.
Modes of p53 regulation.
Kruse JP and Gu W, Cell. 2009 May 15;137(4):609-22. doi: 10.1016/j.cell.2009.04.050.
24.
Members of the NuRD chromatin remodeling complex interact with AUF1 in developing cortical neurons.
Lee C, etal., Cereb Cortex. 2008 Dec;18(12):2909-19. doi: 10.1093/cercor/bhn051. Epub 2008 Apr 15.
25.
Activation of PPARγ inhibits HDAC1-mediated pulmonary arterial smooth muscle cell proliferation and its potential mechanisms.
Li F, etal., Eur J Pharmacol. 2017 Nov 5;814:324-334. doi: 10.1016/j.ejphar.2017.08.045. Epub 2017 Sep 1.
26.
Combination of proteasome and HDAC inhibitors for uterine cervical cancer treatment.
Lin Z, etal., Clin Cancer Res. 2009 Jan 15;15(2):570-7.
27.
Regulation of neuron survival and death by p130 and associated chromatin modifiers.
Liu DX, etal., Genes Dev. 2005 Mar 15;19(6):719-32.
28.
Histone deacetylase-1 is enriched at the platelet-derived growth factor-D promoter in response to interleukin-1beta and forms a cytokine-inducible gene-silencing complex with NF-kappab p65 and interferon regulatory factor-1.
Liu MY and Khachigian LM, J Biol Chem. 2009 Dec 11;284(50):35101-12. Epub 2009 Oct 20.
29.
Histone deacetylases 1 and 3 but not 2 mediate cytokine-induced beta cell apoptosis in INS-1 cells and dispersed primary islets from rats and are differentially regulated in the islets of type 1 diabetic children.
Lundh M, etal., Diabetologia. 2012 Sep;55(9):2421-31. doi: 10.1007/s00125-012-2615-0. Epub 2012 Jul 7.
30.
Valproic acid induces functional heat-shock protein 70 via Class I histone deacetylase inhibition in cortical neurons: a potential role of Sp1 acetylation.
Marinova Z, etal., J Neurochem. 2009 Nov;111(4):976-87. Epub 2009 Sep 18.
31.
Induction of a novel histone deacetylase 1/c-Myc/Mnt/Max complex formation is implicated in parity-induced refractoriness to mammary carcinogenesis.
Matsuoka Y, etal., Cancer Sci. 2008 Feb;99(2):309-15.
32.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
33.
Lipopolysaccharide induces up-regulation of TGF-alpha through HDAC2 in a rat model of bronchopulmonary dysplasia.
Ni W, etal., PLoS One. 2014 Mar 4;9(3):e91083. doi: 10.1371/journal.pone.0091083. eCollection 2014.
34.
Histone deacetylase-2 is a key regulator of diabetes- and transforming growth factor-beta1-induced renal injury.
Noh H, etal., Am J Physiol Renal Physiol. 2009 Sep;297(3):F729-39. doi: 10.1152/ajprenal.00086.2009. Epub 2009 Jun 24.
35.
Histone deacetylase 1/2 mediates proliferation of renal interstitial fibroblasts and expression of cell cycle proteins.
Pang M, etal., J Cell Biochem. 2011 Aug;112(8):2138-48. doi: 10.1002/jcb.23135.
36.
Development of type 2 diabetes following intrauterine growth retardation in rats is associated with progressive epigenetic silencing of Pdx1.
Park JH, etal., J Clin Invest. 2008 Jun;118(6):2316-24.
37.
Physical and functional HAT/HDAC interplay regulates protein acetylation balance.
Peserico A and Simone C, J Biomed Biotechnol. 2011;2011:371832. doi: 10.1155/2011/371832. Epub 2010 Dec 5.
38.
Prenatal caffeine ingestion induces aberrant DNA methylation and histone acetylation of steroidogenic factor 1 and inhibits fetal adrenal steroidogenesis.
Ping J, etal., Toxicology. 2014 Jul 3;321:53-61. doi: 10.1016/j.tox.2014.03.011. Epub 2014 Apr 6.
39.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
40.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
41.
Delta FosB mediates epigenetic desensitization of the c-fos gene after chronic amphetamine exposure.
Renthal W, etal., J Neurosci. 2008 Jul 16;28(29):7344-9. doi: 10.1523/JNEUROSCI.1043-08.2008.
42.
GOA pipeline
RGD automated data pipeline
43.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
44.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
45.
Dexamethasone induces a putative repressor complex and chromatin modifications in the CRH promoter.
Sharma D, etal., Mol Endocrinol. 2013 Jul;27(7):1142-52. doi: 10.1210/me.2013-1079. Epub 2013 May 13.
46.
HDAC up-regulation in early colon field carcinogenesis is involved in cell tumorigenicity through regulation of chromatin structure.
Stypula-Cyrus Y, etal., PLoS One. 2013 May 28;8(5):e64600. doi: 10.1371/journal.pone.0064600. Print 2013.
47.
Screening of histone deacetylases (HDAC) expression in human prostate cancer reveals distinct class I HDAC profiles between epithelial and stromal cells.
Waltregny D, etal., Eur J Histochem. 2004 Jul-Sep;48(3):273-90.
48.
Integrated microarray analysis provided novel insights to the pathogenesis of glaucoma.
Wang J, etal., Mol Med Rep. 2017 Dec;16(6):8735-8746. doi: 10.3892/mmr.2017.7711. Epub 2017 Oct 4.
49.
Significance of DNA methyltransferase-1 and histone deacetylase-1 in pancreatic cancer.
Wang W, etal., Oncol Rep. 2009 Jun;21(6):1439-47.
50.
Histone deacetylases 1, 2 and 3 are highly expressed in prostate cancer and HDAC2 expression is associated with shorter PSA relapse time after radical prostatectomy.
Weichert W, etal., Br J Cancer. 2008 Feb 12;98(3):604-10. Epub 2008 Jan 22.
51.
Expression of class I histone deacetylases indicates poor prognosis in endometrioid subtypes of ovarian and endometrial carcinomas.
Weichert W, etal., Neoplasia. 2008 Sep;10(9):1021-7.
52.
Differential modulation of the oligodendrocyte transcriptome by sonic hedgehog and bone morphogenetic protein 4 via opposing effects on histone acetylation.
Wu M, etal., J Neurosci. 2012 May 9;32(19):6651-64. doi: 10.1523/JNEUROSCI.4876-11.2012.
53.
DeltaNp73 modulates nerve growth factor-mediated neuronal differentiation through repression of TrkA.
Zhang J and Chen X, Mol Cell Biol. 2007 May;27(10):3868-80. Epub 2007 Mar 12.
54.
Quantitation of HDAC1 mRNA expression in invasive carcinoma of the breast*.
Zhang Z, etal., Breast Cancer Res Treat. 2005 Nov;94(1):11-6.
55.
Histone deacetylation inhibition in pulmonary hypertension: therapeutic potential of valproic acid and suberoylanilide hydroxamic acid.
Zhao L, etal., Circulation. 2012 Jul 24;126(4):455-67. doi: 10.1161/CIRCULATIONAHA.112.103176. Epub 2012 Jun 18.
56.
Abnormal epigenetic modifications in peripheral blood mononuclear cells from patients with alopecia areata.
Zhao M, etal., Br J Dermatol. 2012 Feb;166(2):226-73. doi: 10.1111/j.1365-2133.2011.10646.x. Epub 2012 Jan 9.
57.
Hyperoxia arrests alveolar development through suppression of histone deacetylases in neonatal rats.
Zhu L, etal., Pediatr Pulmonol. 2012 Mar;47(3):264-74. doi: 10.1002/ppul.21540. Epub 2011 Sep 8.
Hdac1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 147,138,328 - 147,165,387 (-) NCBI GRCr8 mRatBN7.2 5 141,853,992 - 141,881,057 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 141,853,989 - 141,881,111 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 144,555,355 - 144,582,392 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 146,325,182 - 146,352,217 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 146,321,706 - 146,348,843 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 147,716,664 - 147,743,723 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 147,716,664 - 147,743,723 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 151,445,686 - 151,472,652 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 148,672,515 - 148,699,810 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 148,682,553 - 148,709,849 (-) NCBI Celera 5 140,329,254 - 140,356,320 (-) NCBI Celera Cytogenetic Map 5 q36 NCBI
HDAC1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 32,292,083 - 32,333,626 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 32,292,083 - 32,333,635 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 32,757,684 - 32,799,227 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 32,530,295 - 32,571,811 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 32,426,800 - 32,468,317 NCBI Celera 1 31,028,175 - 31,069,691 (+) NCBI Celera Cytogenetic Map 1 p35.2-p35.1 NCBI HuRef 1 30,873,184 - 30,914,532 (+) NCBI HuRef CHM1_1 1 32,873,153 - 32,914,668 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 32,150,000 - 32,191,544 (+) NCBI T2T-CHM13v2.0
Hdac1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 129,409,897 - 129,436,516 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 129,409,897 - 129,436,506 (-) Ensembl GRCm39 Ensembl GRCm38 4 129,516,104 - 129,542,646 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 129,516,104 - 129,542,713 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 129,193,348 - 129,219,890 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 129,018,408 - 129,044,950 (-) NCBI MGSCv36 mm8 Celera 17 82,795,228 - 82,797,813 (+) NCBI Celera Cytogenetic Map 4 D2.2 NCBI cM Map 4 63.26 NCBI
Hdac1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955452 10,636,366 - 10,670,864 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955452 10,636,366 - 10,668,873 (+) NCBI ChiLan1.0 ChiLan1.0
HDAC1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 194,493,301 - 194,535,079 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 193,614,643 - 193,656,280 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 31,578,373 - 31,619,970 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 32,585,791 - 32,626,408 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 32,585,791 - 32,626,410 (+) Ensembl panpan1.1 panPan2
HDAC1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 2 68,901,339 - 68,936,473 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 2 68,901,651 - 68,936,186 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 2 65,482,127 - 65,517,259 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 2 69,467,855 - 69,503,012 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 2 69,467,851 - 69,502,759 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 2 66,304,797 - 66,339,911 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 2 67,300,918 - 67,335,502 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 2 68,299,008 - 68,334,559 (-) NCBI UU_Cfam_GSD_1.0
Hdac1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 49,495,732 - 49,526,636 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936474 15,320,729 - 15,350,860 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936474 15,320,635 - 15,351,418 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
HDAC1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 88,749,634 - 88,785,411 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 88,749,611 - 88,785,220 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 82,882,080 - 82,907,607 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
HDAC1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 100,529,782 - 100,575,953 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 100,530,369 - 100,558,556 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666033 16,112,046 - 16,155,022 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Hdac1
.
Assembly: Rnor_6.0
Chromosome Start Pos End Pos Reference Nucleotide Variant Nucleotide Variant Type Strain Variant Page
5
147718433
147718434
T
C
snv
CDR View more Information
Predicted Target Of
Count of predictions: 88 Count of miRNA genes: 70 Interacting mature miRNAs: 81 Transcripts: ENSRNOT00000012854 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1331796 Thshl2 Thyroid stimulating hormone level QTL 2 2.3 blood thyroid-stimulating hormone amount (VT:0005119) serum thyroid stimulating hormone level (CMO:0001248) 5 97059760 147465714 Rat 10053720 Scort26 Serum corticosterone level QTL 26 2.06 0.0147 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 5 124965598 166875058 Rat 1549845 Scl44 Serum cholesterol level QTL 44 6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 40128307 148607290 Rat 8552960 Pigfal15 Plasma insulin-like growth factor 1 level QTL 15 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 111416838 156416838 Rat 631562 Apr2 Acute phase response QTL 2 3.7 blood murinoglobulin 1 amount (VT:0010597) plasma murinoglobulin 1 level (CMO:0001931) 5 135927956 166875058 Rat 61444 Strs2 Sensitivity to stroke QTL 2 4.7 cerebrum integrity trait (VT:0010549) post-insult time to onset of cerebrovascular lesion (CMO:0002343) 5 135929696 166875058 Rat 61452 Ciaa5 CIA Autoantibody QTL 5 3.5 blood autoantibody amount (VT:0003725) calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281) 5 94858972 143070159 Rat 70156 Niddm30 Non-insulin dependent diabetes mellitus QTL 30 3.98 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 5 129132447 151006154 Rat 8552908 Pigfal4 Plasma insulin-like growth factor 1 level QTL 4 6.6 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 128506074 166875058 Rat 1331803 Rf32 Renal function QTL 32 2.798 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 5 129132428 143070159 Rat 61393 Bp7 Blood pressure QTL 7 4.5 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 60293434 161481680 Rat 7794791 Mcs33 Mammary carcinoma susceptibility QTL 33 1.93 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 5 131345754 166875058 Rat 7207486 Bss109 Bone structure and strength QTL 109 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 5 106906205 151906205 Rat 7207481 Bss106 Bone structure and strength QTL 106 7.9 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 5 106906205 151906205 Rat 1302790 Scl20 Serum cholesterol level QTL 20 6.4 0.0001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 82394392 166664054 Rat 1598861 Cm64 Cardiac mass QTL 64 2.9 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 127798274 166875058 Rat 1578766 Tcas11 Tongue tumor susceptibility QTL 11 4.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 5 46711509 161317411 Rat 631505 Bp103 Blood pressure QTL 103 3.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 132717196 165560427 Rat 1549838 Bss4 Bone structure and strength QTL 4 9.2 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 5 106906205 151906205 Rat 1641920 Colcs1 Colorectal carcinoma susceptibility QTL 1 2.99 0.0055 intestine integrity trait (VT:0010554) benign colorectal tumor surface area measurement (CMO:0001799) 5 121846814 166846814 Rat 8694169 Bw148 Body weight QTL 148 5 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 128506074 166875058 Rat 8657050 Bw146 Body weight QTL 146 19.84 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 108938288 153938288 Rat 1581510 Cm54 Cardiac mass QTL 54 3.4 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 5 120740824 143608494 Rat 1576314 Eutr1 Estrogen induced uterine response QTL 1 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 2138965 166875058 Rat 2317056 Wbc3 White blood cell count QTL 3 2.51 0.01 leukocyte quantity (VT:0000217) white blood cell count (CMO:0000027) 5 105999803 150999803 Rat 634349 Bp139 Blood pressure QTL 139 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 128924607 166875058 Rat 724525 Bp147 Blood pressure QTL 147 4.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 126424772 166875058 Rat 1598847 Cm62 Cardiac mass QTL 62 3.4 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 108845856 153845856 Rat 2293642 Bss37 Bone structure and strength QTL 37 4.64 0.0001 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 5 120740824 151018848 Rat 1578673 Bmd13 Bone mineral density QTL 13 4.9 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 5 103689353 148689353 Rat 738018 Anxrr4 Anxiety related response QTL 4 5.1 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 5 130130159 166875058 Rat 7207488 Bss110 Bone structure and strength QTL 1 8.4 femur strength trait (VT:0010010) femur stiffness (CMO:0001674) 5 106906205 151906205 Rat 8694441 Bw169 Body weight QTL 169 17.61 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 5 111416838 156416838 Rat 7207491 Bss112 Bone structure and strength QTL 112 7 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 5 106906205 151906205 Rat 8694389 Bw160 Body weight QTL 160 6.17 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 5 111416838 156416838 Rat 61426 Scl2 Serum cholesterol level QTL 2 7.3 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 59793399 143070159 Rat 1354598 Srn6 Serum renin concentration QTL 6 3.8 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 5 69540295 151018848 Rat 8694198 Abfw3 Abdominal fat weight QTL 3 16.13 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 5 111416838 156416838 Rat 1298089 Scl14 Serum cholesterol level QTL 14 5.8 0.0004 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 108845856 153845856 Rat 1598819 Bp292 Blood pressure QTL 292 4.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 127798274 166875058 Rat 1358187 Emca1 Estrogen-induced mammary cancer QTL 1 4.4 mammary gland integrity trait (VT:0010552) post-insult time to mammary tumor formation (CMO:0000345) 5 99216724 148607142 Rat
RH127908
Rat Assembly Chr Position (strand) Source JBrowse Rnor_5.0 5 151,445,233 - 151,445,420 NCBI Rnor5.0 Rnor_5.0 1 86,018,419 - 86,018,606 NCBI Rnor5.0 RGSC_v3.4 5 148,672,112 - 148,672,298 UniSTS RGSC3.4 Celera 5 140,328,851 - 140,329,037 UniSTS Celera 1 79,298,721 - 79,298,907 UniSTS Cytogenetic Map 5 q36 UniSTS
BI274654
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 141,854,353 - 141,854,557 (+) MAPPER mRatBN7.2 Rnor_6.0 5 147,717,026 - 147,717,229 NCBI Rnor6.0 Rnor_5.0 5 151,446,048 - 151,446,251 UniSTS Rnor5.0 RGSC_v3.4 5 148,672,878 - 148,673,081 UniSTS RGSC3.4 Celera 5 140,329,616 - 140,329,819 UniSTS RH 3.4 Map 5 960.01 UniSTS Cytogenetic Map 5 q36 UniSTS
RH125343
Rat Assembly Chr Position (strand) Source JBrowse Rnor_5.0 5 151,445,154 - 151,445,375 NCBI Rnor5.0 Rnor_5.0 1 86,018,464 - 86,018,685 NCBI Rnor5.0 RGSC_v3.4 5 148,672,033 - 148,672,253 UniSTS RGSC3.4 Celera 5 140,328,772 - 140,328,992 UniSTS Celera 1 79,298,642 - 79,298,862 UniSTS Cytogenetic Map 5 q36 UniSTS
Hdac1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 141,855,340 - 141,855,753 (+) MAPPER mRatBN7.2 Rnor_6.0 5 147,718,013 - 147,718,425 NCBI Rnor6.0 Rnor_5.0 5 151,447,035 - 151,447,447 UniSTS Rnor5.0 RGSC_v3.4 5 148,673,865 - 148,674,277 UniSTS RGSC3.4 Celera 5 140,330,603 - 140,331,015 UniSTS Cytogenetic Map 5 q36 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000012854 ⟹ ENSRNOP00000012854
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 141,853,996 - 141,881,111 (-) Ensembl Rnor_6.0 Ensembl 5 147,716,664 - 147,743,723 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000114611 ⟹ ENSRNOP00000093634
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 141,853,989 - 141,881,111 (-) Ensembl
RefSeq Acc Id:
NM_001025409 ⟹ NP_001020580
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 147,138,328 - 147,165,387 (-) NCBI mRatBN7.2 5 141,853,992 - 141,881,057 (-) NCBI Rnor_6.0 5 147,716,664 - 147,743,723 (-) NCBI Rnor_5.0 5 151,445,686 - 151,472,652 (-) NCBI RGSC_v3.4 5 148,672,515 - 148,699,810 (-) RGD Celera 5 140,329,254 - 140,356,320 (-) RGD
Sequence:
GTCCGGGCGGCGAGCAAGATGGCGCAGACTCAGGGCACCAAGAGGAAAGTCTGTTACTACTACGACGGGGATGTTGGAAACTACTATTATGGACAAGGGCACCCAATGAAGCCTCACCGAATCCGAAT
hide sequence
RefSeq Acc Id:
NP_001020580 ⟸ NM_001025409
- UniProtKB:
Q4QQW4 (UniProtKB/Swiss-Prot), A6ISJ4 (UniProtKB/TrEMBL), A0A8I6AG62 (UniProtKB/TrEMBL)
- Sequence:
MAQTQGTKRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQ
hide sequence
Ensembl Acc Id:
ENSRNOP00000012854 ⟸ ENSRNOT00000012854
Ensembl Acc Id:
ENSRNOP00000093634 ⟸ ENSRNOT00000114611
RGD ID: 13694067 Promoter ID: EPDNEW_R4592 Type: single initiation site Name: Hdac1_1 Description: histone deacetylase 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 5 147,743,736 - 147,743,796 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-05-16
Hdac1
histone deacetylase 1
Hdac1_predicted
histone deacetylase 1 (predicted)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-01-12
Hdac1_predicted
histone deacetylase 1 (predicted)
Symbol and Name status set to approved
70820 APPROVED
