Symbol:
HDAC1
Name:
histone deacetylase 1
RGD ID:
1320330
HGNC Page
HGNC:4852
Description:
Enables several functions, including NF-kappaB binding activity; RNA polymerase II transcription regulatory region sequence-specific DNA binding activity; and histone deacetylase binding activity. Contributes to nucleosomal DNA binding activity. Involved in several processes, including DNA methylation-dependent constitutive heterochromatin formation; negative regulation of signal transduction; and regulation of transcription by RNA polymerase II. Located in chromatin; cytosol; and nucleoplasm. Part of NuRD complex and Sin3-type complex. Biomarker of several diseases, including autoimmune disease (multiple); cervix uteri carcinoma in situ; pancreatic ductal carcinoma; prostate carcinoma in situ; and pulmonary hypertension.
Type:
protein-coding
RefSeq Status:
REVIEWED
Previously known as:
DKFZp686H12203; GON-10; HD1; KDAC1; reduced potassium dependency, yeast homolog-like 1; RPD3; RPD3L1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Mus musculus (house mouse):
Hdac1 (histone deacetylase 1) HGNC
Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Hdac1 (histone deacetylase 1) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Treefam
Chinchilla lanigera (long-tailed chinchilla):
Hdac1 (histone deacetylase 1) NCBI
Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):
HDAC1 (histone deacetylase 1) NCBI
Ortholog
Canis lupus familiaris (dog):
HDAC1 (histone deacetylase 1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Hdac1 (histone deacetylase 1) NCBI
Ortholog
Sus scrofa (pig):
HDAC1 (histone deacetylase 1) HGNC
Ensembl, NCBI, OMA, OrthoDB, Panther, Treefam
Chlorocebus sabaeus (green monkey):
HDAC1 (histone deacetylase 1) NCBI
Ortholog
Heterocephalus glaber (naked mole-rat):
Hdac1 (histone deacetylase 1) NCBI
Ortholog
Other homologs 2
Rattus norvegicus (Norway rat):
Hdac1l (histone deacetylase 1-like) HGNC
Ensembl, OrthoDB, Panther, Treefam
Mus musculus (house mouse):
Hdac2 (histone deacetylase 2) HGNC
OrthoMCL
Mus musculus (house mouse):
Hdac1-ps (histone deacetylase 1, pseudogene) HGNC
OrthoMCL
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Hdac1l (histone deacetylase 1-like)
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER|PhylomeDB)
Rattus norvegicus (Norway rat):
Hdac1 (histone deacetylase 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Hdac1 (histone deacetylase 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
hdac1 (histone deacetylase 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Caenorhabditis elegans (roundworm):
hda-1
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
HDAC1
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
RPD3
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
hda-3
Alliance
DIOPT (OMA|OrthoFinder|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
hdac1
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Xenopus laevis (African clawed frog):
hdac1.L
Alliance
DIOPT (Xenbase)
Xenopus laevis (African clawed frog):
hdac1.S
Alliance
DIOPT (Xenbase)
Related Pseudogenes:
HDAC1P1
HDAC1P2
Allele / Splice:
See ClinVar data
Latest Assembly:
GRCh38 - Human Genome Assembly GRCh38
Position:
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 32,292,083 - 32,333,626 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 32,292,083 - 32,333,635 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 32,757,684 - 32,799,227 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 32,530,295 - 32,571,811 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 32,426,800 - 32,468,317 NCBI Celera 1 31,028,175 - 31,069,691 (+) NCBI Celera Cytogenetic Map 1 p35.2-p35.1 NCBI HuRef 1 30,873,184 - 30,914,532 (+) NCBI HuRef CHM1_1 1 32,873,153 - 32,914,668 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 32,150,000 - 32,191,544 (+) NCBI T2T-CHM13v2.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
HDAC1 Human (20S)-ginsenoside Rh2 decreases expression EXP 6480464 ginsenoside Rh2 results in decreased expression of HDAC1 protein CTD PMID:26482938 HDAC1 Human (S)-nicotine increases expression EXP 6480464 Nicotine results in increased expression of HDAC1 mRNA CTD PMID:24709674 HDAC1 Human (S)-nicotine increases expression ISO RGD:1309799 6480464 Nicotine results in increased expression of HDAC1 mRNA; Nicotine results in increased expression of HDAC1 more ... CTD PMID:34245815 HDAC1 Human (S)-nicotine multiple interactions ISO RGD:1309799 6480464 SNAI1 protein affects the reaction [Nicotine results in increased expression of HDAC1 mRNA]; SNAI1 protein more ... CTD PMID:34245815 HDAC1 Human 1,2-dimethylhydrazine decreases expression ISO RGD:1320331 6480464 1,2-Dimethylhydrazine results in decreased expression of HDAC1 mRNA CTD PMID:22206623 HDAC1 Human 1-[3-(dimethylamino)propyl]-1-(4-fluorophenyl)-1,3-dihydro-2-benzofuran-5-carbonitrile decreases expression ISO RGD:1309799 6480464 Citalopram results in decreased expression of HDAC1 mRNA CTD PMID:28467792 HDAC1 Human 15-deoxy-Delta(12,14)-prostaglandin J2 decreases expression EXP 6480464 15-deoxy-delta(12,14)-prostaglandin J2 results in decreased expression of HDAC1 mRNA CTD PMID:21957481 HDAC1 Human 17alpha-ethynylestradiol increases expression ISO RGD:1320331 6480464 Ethinyl Estradiol results in increased expression of HDAC1 mRNA CTD PMID:17942748 HDAC1 Human 17alpha-ethynylestradiol multiple interactions ISO RGD:1320331 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of HDAC1 mRNA CTD PMID:17942748 HDAC1 Human 17beta-estradiol multiple interactions EXP 6480464 [Tetrachlorodibenzodioxin co-treated with Estradiol] promotes the reaction [HDAC1 protein binds to BRCA1 promoter]; Estradiol inhibits more ... CTD PMID:16489025|PMID:22952798|PMID:30684530 HDAC1 Human 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of HDAC1 mRNA CTD PMID:16029874|PMID:23373633 HDAC1 Human 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of HDAC1 mRNA CTD PMID:22952798|PMID:30684530 HDAC1 Human 2,2'-Methylenebis(4-methyl-6-tert-butylphenol) multiple interactions EXP 6480464 [CYP3A4 protein affects the susceptibility to 2,2'-methylenebis(4-methyl-6-tert-butylphenol)] which affects the expression of HDAC1 mRNA CTD PMID:38160208 HDAC1 Human 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:1320331 6480464 Tetrachlorodibenzodioxin results in decreased expression of HDAC1 mRNA CTD PMID:24058054 HDAC1 Human 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:1309799 6480464 Tetrachlorodibenzodioxin results in increased expression of HDAC1 mRNA CTD PMID:22493514|PMID:34747641 HDAC1 Human 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:1320331 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of HDAC1 mRNA; Tetrachlorodibenzodioxin affects the more ... CTD PMID:17652329|PMID:17942748 HDAC1 Human 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 [IL1B protein co-treated with Tetrachlorodibenzodioxin] inhibits the reaction [HDAC1 protein binds to IL6 promoter]; [Tetrachlorodibenzodioxin more ... CTD PMID:16489025|PMID:20511231 HDAC1 Human 2,4,6-tribromophenol increases expression EXP 6480464 2,4,6-tribromophenol results in increased expression of HDAC1 mRNA CTD PMID:31675489 HDAC1 Human 3,3',4,4',5-pentachlorobiphenyl affects expression ISO RGD:1320331 6480464 3,4,5,3',4'-pentachlorobiphenyl affects the expression of HDAC1 mRNA CTD PMID:37080397 HDAC1 Human 3,3'-diindolylmethane multiple interactions ISO RGD:1320331 6480464 3,3'-diindolylmethane inhibits the reaction [enterotoxin B, staphylococcal results in increased expression of HDAC1 mRNA] CTD PMID:24200994 HDAC1 Human 3,4-methylenedioxymethamphetamine increases expression ISO RGD:1320331 6480464 N-Methyl-3,4-methylenedioxyamphetamine results in increased expression of HDAC1 mRNA CTD PMID:20188158 HDAC1 Human 4-phenylbutyric acid multiple interactions EXP 6480464 [4-phenylbutyric acid affects the acetylation of HDAC1 protein] which affects the expression of TUBB3 protein CTD PMID:18497984 HDAC1 Human 5-aza-2'-deoxycytidine multiple interactions EXP 6480464 Decitabine inhibits the reaction [HDAC1 protein binds to ABCG2 promoter]; Decitabine inhibits the reaction [HDAC1 more ... CTD PMID:16043219|PMID:16954373|PMID:17464181 HDAC1 Human 5-fluorouracil multiple interactions ISO RGD:1320331 6480464 [HDAC1 protein co-treated with HDAC2 protein] promotes the reaction [TCF7L2 protein inhibits the reaction [Fluorouracil more ... CTD PMID:25178657 HDAC1 Human 6-propyl-2-thiouracil increases expression ISO RGD:1309799 6480464 Propylthiouracil results in increased expression of HDAC1 mRNA CTD PMID:30047161 HDAC1 Human 7,12-dimethyltetraphene increases expression ISO RGD:1320331 6480464 9,10-Dimethyl-1,2-benzanthracene results in increased expression of HDAC1 mRNA; 9,10-Dimethyl-1,2-benzanthracene results in increased expression of HDAC1 more ... CTD PMID:24792773 HDAC1 Human 7,12-dimethyltetraphene multiple interactions ISO RGD:1320331 6480464 Butyric Acid affects the reaction [9,10-Dimethyl-1,2-benzanthracene results in increased expression of HDAC1 mRNA]; Butyric Acid more ... CTD PMID:24792773 HDAC1 Human acetylsalicylic acid increases expression EXP 6480464 Aspirin results in increased expression of HDAC1 mRNA CTD PMID:15456535 HDAC1 Human acrylamide affects expression ISO RGD:1309799 6480464 Acrylamide affects the expression of HDAC1 mRNA CTD PMID:28959563 HDAC1 Human aldehydo-D-glucose multiple interactions ISO RGD:1320331 6480464 Glucose promotes the reaction [HDAC1 protein binds to TUG1 promoter] CTD PMID:32467232 HDAC1 Human all-trans-retinoic acid multiple interactions EXP 6480464 Thiophenes analog promotes the reaction [Tretinoin results in increased expression of HDAC1 mRNA] CTD PMID:16140955 HDAC1 Human all-trans-retinoic acid increases expression EXP 6480464 Tretinoin results in increased expression of HDAC1 mRNA CTD PMID:16140955 HDAC1 Human allethrin multiple interactions ISO RGD:1309799 6480464 [Allethrins co-treated with cyhalothrin co-treated with cypermethrin co-treated with decamethrin co-treated with fenvalerate] affects the more ... CTD PMID:33051911|PMID:33396045|PMID:34896426 HDAC1 Human alpha-mangostin increases expression EXP 6480464 mangostin results in increased expression of HDAC1 protein CTD PMID:30502394 HDAC1 Human amitrole increases expression ISO RGD:1309799 6480464 Amitrole results in increased expression of HDAC1 mRNA CTD PMID:30047161 HDAC1 Human ammonium chloride increases expression ISO RGD:1309799 6480464 Ammonium Chloride results in increased expression of HDAC1 protein CTD PMID:16483693 HDAC1 Human ammonium chloride affects expression ISO RGD:1309799 6480464 Ammonium Chloride affects the expression of HDAC1 mRNA CTD PMID:16483693 HDAC1 Human amphetamine multiple interactions ISO RGD:1309799 6480464 Amphetamine promotes the reaction [HDAC1 protein binds to FOS promoter] CTD PMID:18632938 HDAC1 Human amphetamine multiple interactions ISO RGD:1320331 6480464 HDAC1 gene mutant form promotes the reaction [Amphetamine results in increased expression of FOS mRNA] CTD PMID:18632938 HDAC1 Human andrographolide decreases expression EXP 6480464 andrographolide results in decreased expression of HDAC1 protein CTD PMID:28651835 HDAC1 Human antirheumatic drug decreases expression EXP 6480464 Antirheumatic Agents results in decreased expression of HDAC1 mRNA CTD PMID:24449571 HDAC1 Human arsenous acid multiple interactions EXP 6480464 [[Arsenic Trioxide results in increased phosphorylation of JUN protein] which binds to HDAC1 protein] which more ... CTD PMID:18210215|PMID:20074581|PMID:25815518 HDAC1 Human aspartame multiple interactions ISO RGD:1320331 6480464 [Fats, Unsaturated co-treated with Sodium Glutamate co-treated with Aspartame] affects the expression of HDAC1 mRNA CTD PMID:23783067 HDAC1 Human benomyl decreases activity EXP 6480464 Benomyl results in decreased activity of HDAC1 protein CTD PMID:25543211 HDAC1 Human benzamide decreases activity EXP 6480464 benzamide analog results in decreased activity of HDAC1 protein CTD PMID:19362838 HDAC1 Human benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of HDAC1 mRNA CTD PMID:16269432 HDAC1 Human benzo[a]pyrene decreases expression ISO RGD:1309799 6480464 Benzo(a)pyrene results in decreased expression of HDAC1 protein CTD PMID:26358852 HDAC1 Human benzo[a]pyrene multiple interactions ISO RGD:1320331 6480464 Benzo(a)pyrene inhibits the reaction [[DNMT1 protein binds to HDAC1 protein] which binds to CYP1A1 promoter]; more ... CTD PMID:14625279|PMID:17682057 HDAC1 Human benzo[b]fluoranthene decreases expression EXP 6480464 benzo(b)fluoranthene results in decreased expression of HDAC1 mRNA CTD PMID:16269432 HDAC1 Human beta-naphthoflavone increases expression ISO RGD:1309799 6480464 beta-Naphthoflavone results in increased expression of HDAC1 protein CTD PMID:19389873 HDAC1 Human bisphenol A multiple interactions ISO RGD:1309799 6480464 HDAC1 mutant form inhibits the reaction [bisphenol A results in decreased expression of SLC12A5 mRNA] CTD PMID:23440186 HDAC1 Human bisphenol A affects splicing EXP 6480464 bisphenol A affects the splicing of HDAC1 mRNA CTD PMID:33670352 HDAC1 Human bisphenol A decreases expression ISO RGD:1309799 6480464 bisphenol A results in decreased expression of HDAC1 mRNA CTD PMID:30816183|PMID:32528016|PMID:34947998 HDAC1 Human bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of HDAC1 mRNA CTD PMID:30903817 HDAC1 Human bisphenol A affects methylation ISO RGD:1320331 6480464 bisphenol A affects the methylation of HDAC1 promoter CTD PMID:27334623 HDAC1 Human bisphenol A increases expression ISO RGD:1309799 6480464 bisphenol A results in increased expression of HDAC1 mRNA CTD PMID:25181051|PMID:26898831|PMID:27697584|PMID:32145629|PMID:34838597 HDAC1 Human butyric acid multiple interactions ISO RGD:1320331 6480464 Butyric Acid affects the reaction [9,10-Dimethyl-1,2-benzanthracene results in increased expression of HDAC1 mRNA]; Butyric Acid more ... CTD PMID:24792773 HDAC1 Human butyric acid multiple interactions ISO RGD:1309799 6480464 Butyric Acid inhibits the reaction [[Ethylene Glycol co-treated with Calcium Oxalate] results in increased expression more ... CTD PMID:37414240 HDAC1 Human butyric acid multiple interactions EXP 6480464 Butyric Acid inhibits the reaction [HDAC1 protein binds to CYP1A1 enhancer]; Butyric Acid inhibits the more ... CTD PMID:27830268|PMID:37414240 HDAC1 Human C.I. Natural Red 20 multiple interactions EXP 6480464 [shikonin results in increased acetylation of HDAC1 protein] which results in increased expression of ATF3 more ... CTD PMID:37268198 HDAC1 Human C60 fullerene decreases expression ISO RGD:1309799 6480464 fullerene C60 results in decreased expression of HDAC1 mRNA CTD PMID:19167457 HDAC1 Human cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of HDAC1 mRNA CTD PMID:38568856 HDAC1 Human caffeine increases expression ISO RGD:1309799 6480464 Caffeine results in increased expression of HDAC1 mRNA CTD PMID:24717552 HDAC1 Human calcium oxalate multiple interactions ISO RGD:1309799 6480464 [Ethylene Glycol co-treated with Calcium Oxalate] results in increased expression of HDAC1 mRNA; Butyric Acid more ... CTD PMID:37414240 HDAC1 Human captan increases expression ISO RGD:1320331 6480464 Captan results in increased expression of HDAC1 mRNA CTD PMID:31558096 HDAC1 Human carbamazepine affects expression EXP 6480464 Carbamazepine affects the expression of HDAC1 mRNA CTD PMID:25979313 HDAC1 Human Chlamydocin decreases activity EXP 6480464 chlamydocin analog results in decreased activity of HDAC1 protein CTD PMID:16439135 HDAC1 Human chlorpyrifos decreases methylation ISO RGD:1309799 6480464 Chlorpyrifos results in decreased methylation of HDAC1 gene CTD PMID:32905263 HDAC1 Human chlorpyrifos increases expression ISO RGD:1309799 6480464 Chlorpyrifos results in increased expression of HDAC1 mRNA CTD PMID:30290214 HDAC1 Human choline multiple interactions ISO RGD:1320331 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation more ... CTD PMID:20938992 HDAC1 Human chromium atom multiple interactions ISO RGD:1320331 6480464 Chromium inhibits the reaction [Benzo(a)pyrene inhibits the reaction [HDAC1 protein binds to CYP1A1 promoter]]; Chromium more ... CTD PMID:14625279|PMID:17682057 HDAC1 Human chromium(6+) multiple interactions EXP 6480464 chromium hexavalent ion promotes the reaction [HDAC1 protein binds to CDH1 promoter] CTD PMID:23518002 HDAC1 Human ciprofibrate increases expression ISO RGD:1320331 6480464 ciprofibrate results in increased expression of HDAC1 mRNA CTD PMID:12771043 HDAC1 Human cisplatin multiple interactions EXP 6480464 Cisplatin inhibits the reaction [[HDAC1 protein co-treated with TP63 protein modified form] binds to BBC3 more ... CTD PMID:21527555 HDAC1 Human citalopram decreases expression ISO RGD:1309799 6480464 Citalopram results in decreased expression of HDAC1 mRNA CTD PMID:28467792 HDAC1 Human cobalt dichloride multiple interactions EXP 6480464 cobaltous chloride inhibits the reaction [HDAC1 protein binds to HIF1A promoter] CTD PMID:19714248 HDAC1 Human copper atom multiple interactions EXP 6480464 [Chelating Agents binds to Copper] which results in decreased expression of HDAC1 mRNA CTD PMID:30911355 HDAC1 Human copper(0) multiple interactions EXP 6480464 [Chelating Agents binds to Copper] which results in decreased expression of HDAC1 mRNA CTD PMID:30911355 HDAC1 Human cortisol increases expression EXP 6480464 Hydrocortisone results in increased expression of HDAC1 mRNA CTD PMID:34454011 HDAC1 Human cortisol multiple interactions EXP 6480464 HDAC1 protein affects the reaction [Hydrocortisone results in decreased expression of CYP11A1 mRNA]; SF1 protein more ... CTD PMID:34454011 HDAC1 Human coumarin increases phosphorylation EXP 6480464 coumarin results in increased phosphorylation of HDAC1 protein CTD PMID:35688186 HDAC1 Human CU-O LINKAGE decreases phosphorylation EXP 6480464 cupric oxide results in decreased phosphorylation of HDAC1 protein CTD PMID:25470785 HDAC1 Human curcumin decreases expression EXP 6480464 Curcumin analog results in decreased expression of HDAC1 mRNA; Curcumin results in decreased expression of more ... CTD PMID:17927689|PMID:18161303|PMID:23593078|PMID:26409325 HDAC1 Human curcumin decreases expression ISO RGD:1320331 6480464 Curcumin analog results in decreased expression of HDAC1 protein CTD PMID:29228771 HDAC1 Human curcumin affects localization EXP 6480464 Curcumin affects the localization of HDAC1 protein CTD PMID:17927689 HDAC1 Human curcumin multiple interactions EXP 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde inhibits the reaction [Curcumin affects the localization of HDAC1 protein]; benzyloxycarbonylleucyl-leucyl-leucine aldehyde inhibits more ... CTD PMID:17927689 HDAC1 Human cyclosporin A decreases expression EXP 6480464 Cyclosporine results in decreased expression of HDAC1 mRNA CTD PMID:20106945|PMID:25562108 HDAC1 Human cyhalothrin multiple interactions ISO RGD:1309799 6480464 [Allethrins co-treated with cyhalothrin co-treated with cypermethrin co-treated with decamethrin co-treated with fenvalerate] affects the more ... CTD PMID:33051911|PMID:33396045|PMID:34896426 HDAC1 Human cypermethrin multiple interactions ISO RGD:1309799 6480464 [Allethrins co-treated with cyhalothrin co-treated with cypermethrin co-treated with decamethrin co-treated with fenvalerate] affects the more ... CTD PMID:33051911|PMID:33396045|PMID:34896426 HDAC1 Human D-glucose multiple interactions ISO RGD:1320331 6480464 Glucose promotes the reaction [HDAC1 protein binds to TUG1 promoter] CTD PMID:32467232 HDAC1 Human decabromodiphenyl ether increases expression EXP 6480464 decabromobiphenyl ether results in increased expression of HDAC1 protein CTD PMID:31675489 HDAC1 Human deoxynivalenol affects phosphorylation ISO RGD:1320331 6480464 deoxynivalenol affects the phosphorylation of HDAC1 protein CTD PMID:23352502 HDAC1 Human dexamethasone multiple interactions ISO RGD:1309799 6480464 HDAC1 protein inhibits the reaction [Dexamethasone results in increased expression of UCP3 mRNA] CTD PMID:17884810 HDAC1 Human dexamethasone multiple interactions ISO RGD:1320331 6480464 [HDAC1 protein co-treated with HDAC2 protein] affects the reaction [Dexamethasone results in decreased expression of more ... CTD PMID:27645313 HDAC1 Human diarsenic trioxide multiple interactions EXP 6480464 [[Arsenic Trioxide results in increased phosphorylation of JUN protein] which binds to HDAC1 protein] which more ... CTD PMID:18210215|PMID:20074581|PMID:25815518 HDAC1 Human dibenz[a,h]anthracene increases expression ISO RGD:1320331 6480464 1,2,5,6-dibenzanthracene results in increased expression of HDAC1 mRNA CTD PMID:26377693 HDAC1 Human Dibutyl phosphate affects expression EXP 6480464 di-n-butylphosphoric acid affects the expression of HDAC1 mRNA CTD PMID:37042841 HDAC1 Human dibutyl phthalate decreases expression ISO RGD:1320331 6480464 Dibutyl Phthalate results in decreased expression of HDAC1 mRNA CTD PMID:17361019|PMID:21266533 HDAC1 Human dioxygen increases expression ISO RGD:1309799 6480464 Oxygen deficiency results in increased expression of HDAC1 protein CTD PMID:22711276 HDAC1 Human dioxygen multiple interactions ISO RGD:1309799 6480464 Valproic Acid inhibits the reaction [Oxygen deficiency results in increased expression of HDAC1 protein]; vorinostat more ... CTD PMID:22711276 HDAC1 Human doxorubicin multiple interactions EXP 6480464 Doxorubicin promotes the reaction [HDAC1 protein binds to BIRC5 promoter] CTD PMID:17124180 HDAC1 Human doxorubicin decreases expression EXP 6480464 Doxorubicin results in decreased expression of HDAC1 mRNA CTD PMID:29803840 HDAC1 Human doxorubicin increases expression ISO RGD:1309799 6480464 Doxorubicin results in increased expression of HDAC1 mRNA CTD PMID:28865727 HDAC1 Human endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of HDAC1 mRNA; Endosulfan results in increased expression of HDAC1 more ... CTD PMID:29054638 HDAC1 Human endosulfan decreases expression ISO RGD:1309799 6480464 Endosulfan results in decreased expression of HDAC1 mRNA CTD PMID:29391264 HDAC1 Human entinostat increases expression EXP 6480464 entinostat results in increased expression of HDAC1 mRNA CTD PMID:27188386 HDAC1 Human enzyme inhibitor multiple interactions EXP 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation more ... CTD PMID:23301498 HDAC1 Human ethanol multiple interactions ISO RGD:1309799 598092506 ethanol inhibits the reaction [LPS decreases expression of Hdac1 protein in hypothalamic microglia] RGD HDAC1 Human ethanol increases expression ISO RGD:1309799 6480464 Ethanol results in increased expression of HDAC1 mRNA CTD PMID:34454011 HDAC1 Human ethylene glycol multiple interactions ISO RGD:1309799 6480464 [Ethylene Glycol co-treated with Calcium Oxalate] results in increased expression of HDAC1 mRNA; Butyric Acid more ... CTD PMID:37414240 HDAC1 Human fenvalerate multiple interactions ISO RGD:1309799 6480464 [Allethrins co-treated with cyhalothrin co-treated with cypermethrin co-treated with decamethrin co-treated with fenvalerate] affects the more ... CTD PMID:33051911|PMID:33396045|PMID:34896426 HDAC1 Human fingolimod hydrochloride affects binding EXP 6480464 Fingolimod Hydrochloride metabolite binds to HDAC1 protein CTD PMID:24859201 HDAC1 Human fingolimod hydrochloride multiple interactions EXP 6480464 Fingolimod Hydrochloride metabolite inhibits the reaction [S1PR1 protein binds to HDAC1 protein]; SPHK2 protein promotes more ... CTD PMID:24859201 HDAC1 Human flutamide decreases expression ISO RGD:1309799 6480464 Flutamide results in decreased expression of HDAC1 mRNA CTD PMID:24793618 HDAC1 Human folic acid multiple interactions ISO RGD:1320331 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation more ... CTD PMID:20938992 HDAC1 Human folic acid decreases expression ISO RGD:1320331 6480464 Folic Acid results in decreased expression of HDAC1 mRNA CTD PMID:25629700 HDAC1 Human FR900359 affects phosphorylation EXP 6480464 FR900359 affects the phosphorylation of HDAC1 protein CTD PMID:37730182 HDAC1 Human furan increases methylation ISO RGD:1309799 6480464 furan results in increased methylation of HDAC1 gene CTD PMID:22079235 HDAC1 Human genistein decreases expression EXP 6480464 Genistein results in decreased expression of HDAC1 protein CTD PMID:23593078 HDAC1 Human genistein multiple interactions EXP 6480464 Genistein promotes the reaction [HDAC1 protein binds to COMT promoter]; sulforaphane inhibits the reaction [Genistein more ... CTD PMID:30684530 HDAC1 Human gentamycin increases expression ISO RGD:1309799 6480464 Gentamicins results in increased expression of HDAC1 mRNA CTD PMID:22061828 HDAC1 Human gentamycin increases expression ISO RGD:1320331 6480464 Gentamicins results in increased expression of HDAC1 protein CTD PMID:19141081|PMID:23558232 HDAC1 Human glucaric acid multiple interactions ISO RGD:1320331 6480464 Glucaric Acid affects the reaction [9,10-Dimethyl-1,2-benzanthracene results in increased expression of HDAC1 mRNA]; Glucaric Acid more ... CTD PMID:24792773 HDAC1 Human glucose multiple interactions ISO RGD:1320331 6480464 Glucose promotes the reaction [HDAC1 protein binds to TUG1 promoter] CTD PMID:32467232 HDAC1 Human glyphosate decreases expression EXP 6480464 Glyphosate results in decreased expression of HDAC1 mRNA CTD PMID:31295307 HDAC1 Human guggulsterone decreases expression EXP 6480464 pregna-4,17-diene-3,16-dione results in decreased expression of HDAC1 protein CTD PMID:23593078 HDAC1 Human hesperidin multiple interactions EXP 6480464 Hesperidin inhibits the reaction [[manganese chloride results in increased abundance of Manganese] promotes the reaction more ... CTD PMID:34800614 HDAC1 Human Honokiol multiple interactions EXP 6480464 honokiol binds to and results in decreased activity of HDAC1 protein CTD PMID:34973135 HDAC1 Human hydrogen peroxide decreases expression EXP 6480464 Hydrogen Peroxide results in decreased expression of HDAC1 mRNA CTD PMID:12419474 HDAC1 Human hydrogen peroxide increases expression EXP 6480464 Hydrogen Peroxide results in increased expression of HDAC1 mRNA; Hydrogen Peroxide results in increased expression more ... CTD PMID:27655674 HDAC1 Human hydrogen peroxide multiple interactions ISO RGD:1320331 6480464 Hydrogen Peroxide promotes the reaction [[HDAC1 protein binds to CTCF promoter] which results in decreased more ... CTD PMID:24558376 HDAC1 Human hydroquinone increases expression EXP 6480464 hydroquinone results in increased expression of HDAC1 mRNA; hydroquinone results in increased expression of HDAC1 more ... CTD PMID:27220438|PMID:30448557 HDAC1 Human hydroquinone multiple interactions EXP 6480464 trichostatin A inhibits the reaction [hydroquinone results in increased expression of HDAC1 mRNA] CTD PMID:27220438 HDAC1 Human indirubin multiple interactions ISO RGD:1320331 6480464 [tanshinone co-treated with indirubin] inhibits the reaction [RARB protein binds to HDAC1 protein]; indirubin promotes more ... CTD PMID:18344322 HDAC1 Human indole-3-methanol multiple interactions ISO RGD:1320331 6480464 indole-3-carbinol inhibits the reaction [enterotoxin B, staphylococcal results in increased expression of HDAC1 mRNA] CTD PMID:24200994 HDAC1 Human isoprenaline increases expression ISO RGD:1309799 6480464 Isoproterenol results in increased expression of HDAC1 mRNA; Isoproterenol results in increased expression of HDAC1 more ... CTD PMID:38735590 HDAC1 Human isoprenaline increases expression ISO RGD:1320331 6480464 Isoproterenol results in increased expression of HDAC1 mRNA; Isoproterenol results in increased expression of HDAC1 more ... CTD PMID:38735590 HDAC1 Human isoprenaline multiple interactions ISO RGD:1309799 6480464 Vorinostat analog inhibits the reaction [Isoproterenol results in increased expression of HDAC1 mRNA]; Vorinostat analog more ... CTD PMID:38735590 HDAC1 Human isoprenaline multiple interactions ISO RGD:1320331 6480464 Vorinostat analog inhibits the reaction [Isoproterenol results in increased expression of HDAC1 mRNA]; Vorinostat analog more ... CTD PMID:38735590 HDAC1 Human ivermectin decreases expression EXP 6480464 Ivermectin results in decreased expression of HDAC1 protein CTD PMID:32959892 HDAC1 Human L-methionine multiple interactions ISO RGD:1320331 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation more ... CTD PMID:20938992 HDAC1 Human lead(0) affects expression EXP 6480464 Lead affects the expression of HDAC1 mRNA CTD PMID:28903495 HDAC1 Human lead(0) multiple interactions ISO RGD:1309799 6480464 [HDAC1 protein co-treated with HDAC2 protein] inhibits the reaction [Lead results in decreased expression of more ... CTD PMID:29301062 HDAC1 Human lipopolysaccharide multiple interactions ISO RGD:1320331 6480464 Lipopolysaccharides inhibits the reaction [HDAC1 protein binds to CCL20 promoter]; Lipopolysaccharides inhibits the reaction [HDAC1 more ... CTD PMID:26259605 HDAC1 Human lipopolysaccharide increases expression ISO RGD:1309799 598092506 LPS increases expression of Hda1c protein in hypothalamic microglia RGD HDAC1 Human lithium chloride multiple interactions ISO RGD:1320331 6480464 Lithium Chloride inhibits the reaction [HDAC1 protein binds to GCG promoter]; Lithium Chloride inhibits the more ... CTD PMID:19582394 HDAC1 Human lovastatin increases expression ISO RGD:1320331 6480464 Lovastatin results in increased expression of HDAC1 mRNA CTD PMID:20493250 HDAC1 Human manganese atom multiple interactions ISO RGD:1309799 6480464 Manganese promotes the reaction [RELA protein binds to HDAC1 protein]; Manganese promotes the reaction [YY1 more ... CTD PMID:24469401 HDAC1 Human manganese atom multiple interactions EXP 6480464 [manganese chloride results in increased abundance of Manganese] promotes the reaction [YY1 protein binds to more ... CTD PMID:34800614 HDAC1 Human manganese(0) multiple interactions ISO RGD:1309799 6480464 Manganese promotes the reaction [RELA protein binds to HDAC1 protein]; Manganese promotes the reaction [YY1 more ... CTD PMID:24469401 HDAC1 Human manganese(0) multiple interactions EXP 6480464 [manganese chloride results in increased abundance of Manganese] promotes the reaction [YY1 protein binds to more ... CTD PMID:34800614 HDAC1 Human manganese(II) chloride multiple interactions EXP 6480464 [manganese chloride results in increased abundance of Manganese] promotes the reaction [YY1 protein binds to more ... CTD PMID:34800614 HDAC1 Human methimazole increases expression ISO RGD:1309799 6480464 Methimazole results in increased expression of HDAC1 mRNA CTD PMID:30047161 HDAC1 Human methotrexate decreases expression EXP 6480464 Methotrexate results in decreased expression of HDAC1 mRNA CTD PMID:24449571 HDAC1 Human methoxyacetic acid decreases activity EXP 6480464 methoxyacetic acid results in decreased activity of HDAC1 protein CTD PMID:15103026 HDAC1 Human methoxyacetic acid decreases activity ISO RGD:1320331 6480464 methoxyacetic acid results in decreased activity of HDAC1 protein CTD PMID:32496642 HDAC1 Human methylmercury chloride decreases expression ISO RGD:1320331 6480464 methylmercuric chloride results in decreased expression of HDAC1 mRNA CTD PMID:20061341 HDAC1 Human mocetinostat decreases expression EXP 6480464 mocetinostat results in decreased expression of HDAC1 protein CTD PMID:26378038 HDAC1 Human monosodium L-glutamate multiple interactions ISO RGD:1320331 6480464 [Fats, Unsaturated co-treated with Sodium Glutamate co-treated with Aspartame] affects the expression of HDAC1 mRNA CTD PMID:23783067 HDAC1 Human N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal multiple interactions EXP 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde inhibits the reaction [Curcumin affects the localization of HDAC1 protein]; benzyloxycarbonylleucyl-leucyl-leucine aldehyde inhibits more ... CTD PMID:17395887|PMID:17927689 HDAC1 Human N-ethyl-N-nitrosourea increases expression ISO RGD:1320331 6480464 Ethylnitrosourea results in increased expression of HDAC1 CTD PMID:21154115 HDAC1 Human N-nitrosodiethylamine multiple interactions ISO RGD:1320331 6480464 AHR protein inhibits the reaction [Diethylnitrosamine results in decreased expression of HDAC1 mRNA] CTD PMID:19996281 HDAC1 Human N-nitrosodiethylamine increases expression ISO RGD:1320331 6480464 Diethylnitrosamine results in increased expression of HDAC1 mRNA CTD PMID:12771043 HDAC1 Human N-nitrosodiethylamine decreases expression ISO RGD:1320331 6480464 Diethylnitrosamine results in decreased expression of HDAC1 mRNA CTD PMID:19996281 HDAC1 Human N-Vinyl-2-pyrrolidone multiple interactions ISO RGD:1309799 6480464 [N-vinyl-2-pyrrolidinone binds to N-vinyl-2-pyrrolidinone] which affects the expression of HDAC1 mRNA CTD PMID:22037397 HDAC1 Human nicotinamide multiple interactions ISO RGD:1320331 6480464 Niacinamide affects the reaction [9,10-Dimethyl-1,2-benzanthracene results in increased expression of HDAC1 mRNA]; Niacinamide affects the more ... CTD PMID:24792773 HDAC1 Human nicotine increases expression EXP 6480464 Nicotine results in increased expression of HDAC1 mRNA CTD PMID:24709674 HDAC1 Human nicotine multiple interactions ISO RGD:1309799 6480464 SNAI1 protein affects the reaction [Nicotine results in increased expression of HDAC1 mRNA]; SNAI1 protein more ... CTD PMID:34245815 HDAC1 Human nicotine increases expression ISO RGD:1309799 6480464 Nicotine results in increased expression of HDAC1 mRNA; Nicotine results in increased expression of HDAC1 more ... CTD PMID:34245815 HDAC1 Human nitrates multiple interactions ISO RGD:1320331 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of HDAC1 more ... CTD PMID:35964746 HDAC1 Human oleanolic acid decreases expression EXP 6480464 Oleanolic Acid results in decreased expression of HDAC1 protein CTD PMID:20726234 HDAC1 Human oxalic acid multiple interactions EXP 6480464 Butyric Acid inhibits the reaction [Oxalic Acid results in increased expression of HDAC1 mRNA] CTD PMID:37414240 HDAC1 Human oxalic acid increases expression EXP 6480464 Oxalic Acid results in increased expression of HDAC1 mRNA CTD PMID:37414240 HDAC1 Human oxybenzone increases expression ISO RGD:1309799 6480464 oxybenzone results in increased expression of HDAC1 protein CTD PMID:31368502 HDAC1 Human paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of HDAC1 mRNA CTD PMID:21420995 HDAC1 Human paracetamol decreases expression ISO RGD:1309799 6480464 Acetaminophen results in decreased expression of HDAC1 mRNA CTD PMID:33387578 HDAC1 Human pelargonidin decreases expression ISO RGD:1320331 6480464 pelargonidin results in decreased expression of HDAC1 protein CTD PMID:31181187 HDAC1 Human pentachlorophenol increases expression ISO RGD:1320331 6480464 Pentachlorophenol results in increased expression of HDAC1 mRNA CTD PMID:23892564 HDAC1 Human phenethyl isothiocyanate multiple interactions ISO RGD:1309799 6480464 phenethyl isothiocyanate inhibits the reaction [Freund's Adjuvant results in increased expression of HDAC1 protein] CTD PMID:32289289 HDAC1 Human potassium chloride multiple interactions ISO RGD:1320331 6480464 Potassium Chloride inhibits the reaction [HDAC1 protein binds to BDNF promoter] CTD PMID:14593183 HDAC1 Human pregnenolone 16alpha-carbonitrile increases expression ISO RGD:1309799 6480464 Pregnenolone Carbonitrile results in increased expression of HDAC1 mRNA CTD PMID:30047161 HDAC1 Human progesterone decreases expression EXP 6480464 Progesterone results in decreased expression of HDAC1 mRNA CTD PMID:18037150 HDAC1 Human pyrethrins increases expression ISO RGD:1309799 6480464 Pyrethrins results in increased expression of HDAC1 mRNA CTD PMID:34896426 HDAC1 Human resveratrol decreases expression EXP 6480464 resveratrol results in decreased expression of HDAC1 protein CTD PMID:23593078 HDAC1 Human resveratrol multiple interactions EXP 6480464 [[resveratrol results in decreased expression of MTA1 protein] inhibits the reaction [MTA1 protein binds to more ... CTD PMID:19810103|PMID:25875864 HDAC1 Human resveratrol increases expression ISO RGD:1320331 6480464 resveratrol results in increased expression of HDAC1 mRNA CTD PMID:22610192 HDAC1 Human rotenone decreases expression ISO RGD:1309799 6480464 Rotenone results in decreased expression of HDAC1 protein CTD PMID:35544339 HDAC1 Human Shikonin multiple interactions EXP 6480464 [shikonin results in increased acetylation of HDAC1 protein] which results in increased expression of ATF3 more ... CTD PMID:37268198 HDAC1 Human sodium arsenate increases expression ISO RGD:1320331 6480464 sodium arsenate results in increased expression of HDAC1 protein CTD PMID:26193056 HDAC1 Human sodium arsenite multiple interactions EXP 6480464 Estradiol inhibits the reaction [sodium arsenite results in increased expression of HDAC1 mRNA]; sodium arsenite more ... CTD PMID:22952798 HDAC1 Human sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of HDAC1 mRNA CTD PMID:38568856 HDAC1 Human sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of HDAC1 mRNA CTD PMID:22952798|PMID:34032870 HDAC1 Human Soman increases expression ISO RGD:1309799 6480464 Soman results in increased expression of HDAC1 mRNA CTD PMID:19281266 HDAC1 Human sulfadimethoxine increases expression ISO RGD:1309799 6480464 Sulfadimethoxine results in increased expression of HDAC1 mRNA CTD PMID:30047161 HDAC1 Human sulforaphane multiple interactions EXP 6480464 sulforaphane inhibits the reaction [Estradiol promotes the reaction [HDAC1 protein binds to COMT promoter]]; sulforaphane more ... CTD PMID:30684530 HDAC1 Human sulforaphane decreases expression EXP 6480464 sulforaphane results in decreased expression of HDAC1 mRNA CTD PMID:30684530 HDAC1 Human sulindac sulfide decreases expression EXP 6480464 sulindac sulfide results in decreased expression of HDAC1 mRNA CTD PMID:16184548 HDAC1 Human sunitinib decreases expression EXP 6480464 Sunitinib results in decreased expression of HDAC1 mRNA CTD PMID:31533062 HDAC1 Human taiwanin C decreases expression EXP 153305910 taiwanin C decreases expression of HDAC1 protein in Chondrocyte Cells RGD HDAC1 Human tamoxifen multiple interactions EXP 6480464 Tamoxifen promotes the reaction [HDAC1 protein binds to FOXM1 promoter] CTD PMID:20208560 HDAC1 Human tangeretin decreases expression ISO RGD:1320331 6480464 tangeretin metabolite results in decreased expression of HDAC1 protein; tangeretin results in decreased expression of more ... CTD PMID:37517432 HDAC1 Human Tanshinone I multiple interactions ISO RGD:1320331 6480464 [tanshinone co-treated with indirubin] inhibits the reaction [RARB protein binds to HDAC1 protein]; [tetraarsenic tetrasulfide more ... CTD PMID:18344322 HDAC1 Human temozolomide increases expression EXP 6480464 Temozolomide results in increased expression of HDAC1 mRNA CTD PMID:31758290 HDAC1 Human tert-butyl hydroperoxide decreases expression EXP 6480464 tert-Butylhydroperoxide results in decreased expression of HDAC1 mRNA CTD PMID:12419474 HDAC1 Human tetrachloromethane increases expression ISO RGD:1320331 6480464 Carbon Tetrachloride results in increased expression of HDAC1 mRNA CTD PMID:27396813 HDAC1 Human theophylline increases activity EXP 6480464 Theophylline results in increased activity of HDAC1 protein CTD PMID:12070353 HDAC1 Human theophylline increases expression EXP 6480464 Theophylline results in increased expression of HDAC1 protein CTD PMID:12070353|PMID:15337792 HDAC1 Human thioacetamide increases expression ISO RGD:1309799 6480464 Thioacetamide results in increased expression of HDAC1 mRNA CTD PMID:34492290 HDAC1 Human thiophenes multiple interactions EXP 6480464 Thiophenes analog promotes the reaction [Tretinoin results in increased expression of HDAC1 mRNA] CTD PMID:16140955 HDAC1 Human thiram decreases expression EXP 6480464 Thiram results in decreased expression of HDAC1 mRNA CTD PMID:38568856 HDAC1 Human titanium dioxide decreases methylation ISO RGD:1320331 6480464 titanium dioxide results in decreased methylation of HDAC1 gene CTD PMID:35295148 HDAC1 Human Trapoxin B decreases activity EXP 6480464 trapoxin B results in decreased activity of HDAC1 protein CTD PMID:15930892 HDAC1 Human trichloroethene decreases expression ISO RGD:1309799 6480464 Trichloroethylene results in decreased expression of HDAC1 mRNA CTD PMID:33387578 HDAC1 Human trichostatin A decreases activity EXP 6480464 trichostatin A results in decreased activity of HDAC1 protein CTD PMID:15103026|PMID:15927959|PMID:15930892|PMID:34973135 HDAC1 Human trichostatin A decreases activity ISO RGD:1320331 6480464 trichostatin A results in decreased activity of HDAC1 protein CTD PMID:32496642 HDAC1 Human trichostatin A multiple interactions EXP 6480464 trichostatin A inhibits the reaction [hydroquinone results in increased expression of HDAC1 mRNA] CTD PMID:27220438 HDAC1 Human trichostatin A decreases expression EXP 6480464 trichostatin A results in decreased expression of HDAC1 protein CTD PMID:23285096 HDAC1 Human Triptolide increases expression ISO RGD:1309799 6480464 triptolide results in increased expression of HDAC1 mRNA CTD PMID:23639586 HDAC1 Human triptonide increases expression ISO RGD:1320331 6480464 triptonide results in increased expression of HDAC1 mRNA CTD PMID:33045310 HDAC1 Human valproic acid decreases activity EXP 6480464 Valproic Acid results in decreased activity of HDAC1 protein CTD PMID:15103026 HDAC1 Human valproic acid decreases activity ISO RGD:1320331 6480464 Valproic Acid results in decreased activity of HDAC1 protein CTD PMID:32496642 HDAC1 Human valproic acid decreases methylation EXP 6480464 Valproic Acid results in decreased methylation of HDAC1 gene CTD PMID:29501571 HDAC1 Human valproic acid decreases expression ISO RGD:1320331 6480464 Valproic Acid results in decreased expression of HDAC1 mRNA CTD PMID:31445079 HDAC1 Human valproic acid multiple interactions ISO RGD:1309799 6480464 Valproic Acid inhibits the reaction [Oxygen deficiency results in increased expression of HDAC1 protein] CTD PMID:22711276 HDAC1 Human valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of HDAC1 mRNA CTD PMID:23179753|PMID:24935251|PMID:29154799|PMID:29501571 HDAC1 Human valproic acid affects expression EXP 6480464 Valproic Acid affects the expression of HDAC1 mRNA CTD PMID:25979313 HDAC1 Human valproic acid multiple interactions EXP 6480464 [Valproic Acid co-treated with arsenic trioxide] results in decreased expression of HDAC1 mRNA CTD PMID:25815518 HDAC1 Human vinclozolin decreases expression ISO RGD:1309799 6480464 vinclozolin results in decreased expression of HDAC1 mRNA CTD PMID:18042343|PMID:23555832 HDAC1 Human vincristine decreases expression ISO RGD:1309799 6480464 Vincristine results in decreased expression of HDAC1 protein CTD PMID:27474498 HDAC1 Human vitamin E increases expression EXP 6480464 Vitamin E results in increased expression of HDAC1 mRNA CTD PMID:19244175 HDAC1 Human vorinostat multiple interactions EXP 6480464 vorinostat inhibits the reaction [monomethylarsonous acid results in increased expression of HDAC1 mRNA] CTD PMID:23891734 HDAC1 Human vorinostat multiple interactions ISO RGD:1320331 6480464 Vorinostat analog inhibits the reaction [Isoproterenol results in increased expression of HDAC1 mRNA]; Vorinostat analog more ... CTD PMID:38735590 HDAC1 Human vorinostat decreases expression EXP 6480464 Vorinostat results in decreased expression of HDAC1 mRNA; Vorinostat results in decreased expression of HDAC1 more ... CTD PMID:28963909 HDAC1 Human vorinostat multiple interactions ISO RGD:1309799 6480464 Vorinostat analog inhibits the reaction [Isoproterenol results in increased expression of HDAC1 mRNA]; Vorinostat analog more ... CTD PMID:22711276|PMID:38735590 HDAC1 Human vorinostat decreases activity EXP 6480464 vorinostat results in decreased activity of HDAC1 protein CTD PMID:15930892 HDAC1 Human warfarin increases expression ISO RGD:1320331 6480464 Warfarin results in increased expression of HDAC1 mRNA CTD PMID:20493250 HDAC1 Human withaferin A decreases expression EXP 6480464 withaferin A results in decreased expression of HDAC1 protein CTD PMID:23593078 HDAC1 Human zileuton decreases expression ISO RGD:1309799 6480464 zileuton results in decreased expression of HDAC1 mRNA CTD PMID:12883083 HDAC1 Human zinc atom multiple interactions EXP 6480464 Zinc binds to and results in increased activity of HDAC1 protein CTD PMID:16439135 HDAC1 Human zinc atom multiple interactions ISO RGD:1320331 6480464 [zinc chloride results in increased abundance of Zinc] which results in decreased expression of HDAC1 more ... CTD PMID:31588059 HDAC1 Human zinc dichloride multiple interactions ISO RGD:1320331 6480464 [zinc chloride results in increased abundance of Zinc] which results in decreased expression of HDAC1 more ... CTD PMID:31588059 HDAC1 Human zinc(0) multiple interactions EXP 6480464 Zinc binds to and results in increased activity of HDAC1 protein CTD PMID:16439135 HDAC1 Human zinc(0) multiple interactions ISO RGD:1320331 6480464 [zinc chloride results in increased abundance of Zinc] which results in decreased expression of HDAC1 more ... CTD PMID:31588059
Cellular Component
Only show annotations with direct experimental evidence (0 objects hidden)
HDAC1 Human chromatin ISO RGD:1309799 9068941 RGD PMID:18271930|REF_RGD_ID:2306213 HDAC1 Human chromatin located_in HDA 150520179 PMID:16217013 UniProt PMID:16217013 HDAC1 Human chromatin located_in IEA UniProtKB:O09106|ensembl:ENSMUSP00000099657 150520179 Ensembl GO_REF:0000107 HDAC1 Human chromatin located_in IDA 150520179 PMID:16731528, PMID:22926524, PMID:23629966, PMID:23770133 CAFA PMID:16731528|PMID:22926524|PMID:23629966|PMID:23770133 HDAC1 Human cytoplasm located_in TAS 150520179 PMID:12711221 UniProt PMID:12711221 HDAC1 Human cytosol located_in IDA 150520179 PMID:18326024 UniProt PMID:18326024 HDAC1 Human heterochromatin located_in IEA UniProtKB:O09106|ensembl:ENSMUSP00000099657 150520179 Ensembl GO_REF:0000107 HDAC1 Human histone deacetylase complex part_of IDA 150520179 PMID:9651585 UniProt PMID:9651585 HDAC1 Human histone deacetylase complex part_of TAS 150520179 PMID:12711221 UniProt PMID:12711221 HDAC1 Human histone deacetylase complex part_of IEA UniProtKB:O09106|ensembl:ENSMUSP00000099657 150520179 Ensembl GO_REF:0000107 HDAC1 Human neuronal cell body located_in IEA UniProtKB:O09106|ensembl:ENSMUSP00000099657 150520179 Ensembl GO_REF:0000107 HDAC1 Human nucleoplasm located_in IDA 150520179 PMID:22720776, PMID:22926524 HPA GO_REF:0000052|PMID:22720776|PMID:22926524 HDAC1 Human nucleoplasm located_in TAS 150520179 Reactome Reactome:R-HSA-1227670|Reactome:R-HSA-1227671|Reactome:R-HSA-2186607|Reactome:R-HSA-2220982|Reactome:R-HSA-3299569|Reactome:R-HSA-3361751|Reactome:R-HSA-350058|Reactome:R-HSA-3769447|Reactome:R-HSA-4615889|Reactome:R-HSA-6805650|Reactome:R-HSA-8935730|Reactome:R-HSA-8935732|Reactome:R-HSA-8936584|Reactome:R-HSA-8936599|Reactome:R-HSA-8936608|Reactome:R-HSA-8936989|Reactome:R-HSA-8937022|Reactome:R-HSA-8937113|Reactome:R-HSA-8937118|Reactome:R-HSA-8943780|Reactome:R-HSA-9005995|Reactome:R-HSA-9009065|Reactome:R-HSA-9023461|Reactome:R-HSA-9679787|Reactome:R-HSA-9701565|Reactome:R-HSA-9825754|Reactome:R-HSA-9851071|Reactome:R-HSA-9858647|Reactome:R-HSA-996727|Reactome:R-NUL-3299567 HDAC1 Human nucleus located_in IDA 150520179 PMID:10846170, PMID:18347167, PMID:18936100, PMID:20523938, PMID:28977666, PMID:33283408, PMID:9651585 UniProt PMID:10846170|PMID:18347167|PMID:18936100|PMID:20523938|PMID:28977666|PMID:33283408|PMID:9651585 HDAC1 Human nucleus located_in NAS 150520179 PMID:28554894 ComplexPortal PMID:28554894 HDAC1 Human nucleus located_in IEA UniProtKB:O09106|ensembl:ENSMUSP00000099657 150520179 Ensembl GO_REF:0000107 HDAC1 Human nucleus located_in IEA UniProtKB-KW:KW-0539 150520179 UniProt GO_REF:0000043 HDAC1 Human nucleus ISO RGD:1309799 9068941 RGD PMID:19765194|REF_RGD_ID:2316171 HDAC1 Human nucleus located_in IEA UniProtKB-SubCell:SL-0191 150520179 UniProt GO_REF:0000044 HDAC1 Human NuRD complex part_of NAS 150520179 PMID:16428440 ComplexPortal PMID:16428440 HDAC1 Human NuRD complex part_of IDA 150520179 PMID:17827154, PMID:19644445, PMID:22926524, PMID:33283408 BHF-UCL PMID:17827154|PMID:19644445|PMID:22926524|PMID:33283408 HDAC1 Human NuRD complex part_of IEA UniProtKB:O09106|ensembl:ENSMUSP00000099657 150520179 Ensembl GO_REF:0000107 HDAC1 Human NuRD complex part_of IBA FB:FBgn0015805|MGI:108086|PANTHER:PTN000835547|UniProtKB:Q13547|UniProtKB:Q92769|WB:WBGene00001834 150520179 GO_Central GO_REF:0000033 HDAC1 Human perinuclear region of cytoplasm ISO RGD:1309799 9068941 RGD PMID:20037577|REF_RGD_ID:9590131 HDAC1 Human protein-containing complex ISO RGD:1309799 9068941 RGD PMID:10491605|REF_RGD_ID:2306469 HDAC1 Human protein-containing complex part_of IDA 150520179 PMID:28046085 UniProt PMID:28046085 HDAC1 Human protein-containing complex part_of HDA 150520179 PMID:16217013 UniProt PMID:16217013 HDAC1 Human protein-containing complex part_of IEA UniProtKB:O09106|ensembl:ENSMUSP00000099657 150520179 Ensembl GO_REF:0000107 HDAC1 Human Sin3-type complex part_of NAS 150520179 PMID:28554894 ComplexPortal PMID:28554894 HDAC1 Human Sin3-type complex part_of IDA 150520179 PMID:17827154 BHF-UCL PMID:17827154 HDAC1 Human transcription regulator complex part_of IEA UniProtKB:O09106|ensembl:ENSMUSP00000099657 150520179 Ensembl GO_REF:0000107 HDAC1 Human transcription repressor complex part_of IEA UniProtKB:O09106|ensembl:ENSMUSP00000099657 150520179 Ensembl GO_REF:0000107
Molecular Function
Only show annotations with direct experimental evidence (0 objects hidden)
HDAC1 Human chromatin binding ISO RGD:1309799 9068941 RGD PMID:23671328|REF_RGD_ID:9590112 HDAC1 Human chromatin binding enables IEA UniProtKB:O09106|ensembl:ENSMUSP00000099657 150520179 Ensembl GO_REF:0000107 HDAC1 Human core promoter sequence-specific DNA binding enables IDA 150520179 PMID:23629966 CAFA PMID:23629966 HDAC1 Human deacetylase activity ISO RGD:1309799 9068941 RGD PMID:23868068|REF_RGD_ID:9681716 HDAC1 Human DNA binding enables IEA UniProtKB:O09106|ensembl:ENSMUSP00000099657 150520179 Ensembl GO_REF:0000107 HDAC1 Human DNA-binding transcription factor binding enables IEA UniProtKB:O09106|ensembl:ENSMUSP00000099657 150520179 Ensembl GO_REF:0000107 HDAC1 Human DNA-binding transcription factor binding enables IPI UniProtKB:P23246 150520179 PMID:16731528 ParkinsonsUK-UCL PMID:16731528 HDAC1 Human DNA-binding transcription factor binding enables IPI UniProtKB:Q02078|UniProtKB:Q14814 150520179 PMID:20590529 UniProt PMID:20590529 HDAC1 Human DNA-binding transcription factor binding enables IPI UniProtKB:Q99801 150520179 PMID:18974119 UniProt PMID:18974119 HDAC1 Human DNA-binding transcription factor binding enables TAS 150520179 PMID:12711221 UniProt PMID:12711221 HDAC1 Human DNA-binding transcription factor binding enables IPI UniProtKB:P35680-1 150520179 PMID:15509593 UniProt PMID:15509593 HDAC1 Human E-box binding enables IEA UniProtKB:O09106|ensembl:ENSMUSP00000099657 150520179 Ensembl GO_REF:0000107 HDAC1 Human enzyme binding enables IPI UniProtKB:Q9NWT6 150520179 PMID:11641274 UniProt PMID:11641274 HDAC1 Human enzyme binding enables IPI UniProtKB:P11388|UniProtKB:Q02880 150520179 PMID:11062478, PMID:11136718 UniProt PMID:11062478|PMID:11136718 HDAC1 Human histone deacetylase activity enables IEA InterPro:IPR003084 150520179 InterPro GO_REF:0000002 HDAC1 Human histone deacetylase activity enables IBA FB:FBgn0015805|FB:FBgn0025825|FB:FBgn0026428|FB:FBgn0041210|MGI:108086|MGI:1097691|MGI:1333752|MGI:1333784|MGI:1343091|MGI:1891835|PANTHER:PTN008143312|PomBase:SPAC3G9.07c|PomBase:SPBC36.05c|PomBase:SPBC800.03|SGD:S000003162|SGD:S000005274|TAIR:locus:2095087|TAIR:locus:2120948|TAIR:locus:2159446|TAIR:locus:2159461|TAIR:locus:2162017|UniProtKB:C8V606|UniProtKB:D6XGM6|UniProtKB:G5EB64|UniProtKB:O15379|UniProtKB:P56524|UniProtKB:Q13547|UniProtKB:Q586J9|UniProtKB:Q92769|UniProtKB:Q969S8|UniProtKB:Q96DB2|UniProtKB:Q9BY41|UniProtKB:Q9UBN7|UniProtKB:Q9UKV0|UniProtKB:Q9UQL6|WB:WBGene00001834|dictyBase:DDB_G0270338 150520179 GO_Central GO_REF:0000033 HDAC1 Human histone deacetylase activity enables TAS 150520179 PMID:12711221 UniProt PMID:12711221 HDAC1 Human histone deacetylase activity enables IEA UniProtKB:O09106|ensembl:ENSMUSP00000099657 150520179 Ensembl GO_REF:0000107 HDAC1 Human histone deacetylase activity enables IMP 150520179 PMID:17996965, PMID:19182791 UniProt PMID:17996965|PMID:19182791 HDAC1 Human histone deacetylase activity enables IDA 150520179 PMID:12590135, PMID:16762839, PMID:28497810 BHF-UCL PMID:12590135|PMID:16762839|PMID:28497810 HDAC1 Human histone deacetylase activity, hydrolytic mechanism enables IEA EC:3.5.1.98 150520179 UniProt GO_REF:0000003 HDAC1 Human histone deacetylase activity, hydrolytic mechanism enables IEA RHEA:58196 150520179 RHEA GO_REF:0000116 HDAC1 Human histone deacetylase binding enables IPI UniProtKB:Q9UKV0 150520179 PMID:12590135 BHF-UCL PMID:12590135 HDAC1 Human histone deacetylase binding enables IPI UniProtKB:Q8N108|UniProtKB:Q8N344 150520179 PMID:28046085 UniProt PMID:28046085 HDAC1 Human histone decrotonylase activity enables IEA UniProtKB:O09106|ensembl:ENSMUSP00000099657 150520179 Ensembl GO_REF:0000107 HDAC1 Human histone decrotonylase activity enables IDA 150520179 PMID:28497810 UniProt PMID:28497810 HDAC1 Human hydrolase activity enables IEA UniProtKB-KW:KW-0378 150520179 UniProt GO_REF:0000043 HDAC1 Human Krueppel-associated box domain binding enables IEA UniProtKB:O09106|ensembl:ENSMUSP00000099657 150520179 Ensembl GO_REF:0000107 HDAC1 Human metal ion binding enables IEA UniProtKB-KW:KW-0479 150520179 UniProt GO_REF:0000043 HDAC1 Human NF-kappaB binding enables IPI UniProtKB:Q04206 150520179 PMID:11931769, PMID:17785205 UniProt PMID:11931769|PMID:17785205 HDAC1 Human nucleosomal DNA binding contributes_to HDA 150520179 PMID:16217013 UniProt PMID:16217013 HDAC1 Human p53 binding enables IPI UniProtKB:P04637 150520179 PMID:23629966 CAFA PMID:23629966 HDAC1 Human promoter-specific chromatin binding enables IEA UniProtKB:O09106|ensembl:ENSMUSP00000099657 150520179 Ensembl GO_REF:0000107 HDAC1 Human protein binding enables IPI UniProtKB:Q99986 150520179 PMID:37179361 UniProt PMID:37179361 HDAC1 Human protein binding enables IDA 150520179 PMID:17150957 MGI PMID:17150957 HDAC1 Human protein binding enables IPI UniProtKB:P68400 150520179 PMID:22113938, PMID:32707033 IntAct PMID:22113938|PMID:32707033 HDAC1 Human protein binding enables IPI UniProtKB:Q9Y618 150520179 PMID:11013263 IntAct PMID:11013263 HDAC1 Human protein binding enables IPI UniProtKB:P04637 150520179 PMID:16959611, PMID:20075864 IntAct PMID:16959611|PMID:20075864 HDAC1 Human protein binding enables IPI UniProtKB:Q6KC79 150520179 PMID:18854353 BHF-UCL PMID:18854353 HDAC1 Human protein binding enables IPI UniProtKB:Q6BDS2 150520179 PMID:15361834 BHF-UCL PMID:15361834 HDAC1 Human protein binding enables IPI UniProtKB:P35222|UniProtKB:Q8NEU8|UniProtKB:Q92769|UniProtKB:Q9UKG1 150520179 PMID:19433865 UniProt PMID:19433865 HDAC1 Human protein binding enables IPI UniProtKB:Q9HCU9 150520179 PMID:16919237, PMID:17000776 UniProt PMID:16919237|PMID:17000776 HDAC1 Human protein binding enables IPI UniProtKB:P08047 150520179 PMID:12847090, PMID:18003922 IntAct PMID:12847090|PMID:18003922 HDAC1 Human protein binding enables IPI UniProtKB:Q9UKT9 150520179 PMID:17646674 UniProt PMID:17646674 HDAC1 Human protein binding enables IPI UniProtKB:Q8IYR2 150520179 PMID:30110327 UniProt PMID:30110327 HDAC1 Human protein binding enables IPI UniProtKB:Q9UJW3 150520179 PMID:12202768 IntAct PMID:12202768 HDAC1 Human protein binding enables IPI UniProtKB:O35437 150520179 PMID:15919722 BHF-UCL PMID:15919722 HDAC1 Human protein binding enables IPI UniProtKB:Q04206 150520179 PMID:16291753 IntAct PMID:16291753 HDAC1 Human protein binding enables IPI UniProtKB:Q02447 150520179 PMID:12176973 UniProt PMID:12176973 HDAC1 Human protein binding enables IPI UniProtKB:Q92769 150520179 PMID:22416134 IntAct PMID:22416134 HDAC1 Human protein binding enables IPI UniProtKB:Q03468 150520179 PMID:26030138 UniProt PMID:26030138 HDAC1 Human protein binding enables IPI UniProtKB:Q13227|UniProtKB:Q15466 150520179 PMID:17895379 IntAct PMID:17895379 HDAC1 Human protein binding enables IPI UniProtKB:P33568|UniProtKB:Q8K1P7 150520179 PMID:19081374 UniProt PMID:19081374 HDAC1 Human protein binding enables IPI UniProtKB:O95863 150520179 PMID:20562920 IntAct PMID:20562920 HDAC1 Human protein binding enables IPI UniProtKB:O94776|UniProtKB:O95983|UniProtKB:P62805|UniProtKB:Q13330|UniProtKB:Q14865|UniProtKB:Q16576|UniProtKB:Q92769|UniProtKB:Q96N64|UniProtKB:Q96ST3|UniProtKB:Q9NP50|UniProtKB:Q9UKL0 150520179 PMID:26496610 IntAct PMID:26496610 HDAC1 Human protein binding enables IPI UniProtKB:P84022|UniProtKB:Q9HAZ2 150520179 PMID:19049980 UniProt PMID:19049980 HDAC1 Human protein binding enables IPI UniProtKB:Q9H2U1 150520179 PMID:18279852 UniProt PMID:18279852 HDAC1 Human protein binding enables IPI UniProtKB:O94776|UniProtKB:O95983|UniProtKB:Q09028|UniProtKB:Q13330|UniProtKB:Q14839|UniProtKB:Q16576|UniProtKB:Q8N108|UniProtKB:Q92769|UniProtKB:Q96ST3|UniProtKB:Q9HCU9|UniProtKB:Q9UKL0 150520179 PMID:21258344 IntAct PMID:21258344 HDAC1 Human protein binding enables IPI UniProtKB:O00422|UniProtKB:Q09028|UniProtKB:Q16576|UniProtKB:Q92769 150520179 PMID:9150135 IntAct PMID:9150135 HDAC1 Human protein binding enables IPI UniProtKB:Q13330 150520179 PMID:16511565 IntAct PMID:16511565 HDAC1 Human protein binding enables IPI UniProtKB:P06400 150520179 PMID:10779361, PMID:16766265, PMID:22366686, PMID:22615382 IntAct PMID:10779361|PMID:16766265|PMID:22366686|PMID:22615382 HDAC1 Human protein binding enables IPI UniProtKB:P40337 150520179 PMID:11641274 UniProt PMID:11641274 HDAC1 Human protein binding enables IPI UniProtKB:P17844|UniProtKB:Q92841-4 150520179 PMID:15298701 IntAct PMID:15298701 HDAC1 Human protein binding enables IPI UniProtKB:Q86VP3 150520179 PMID:29656858 UniProt PMID:29656858 HDAC1 Human protein binding enables IPI UniProtKB:P62805|UniProtKB:Q09028|UniProtKB:Q14839|UniProtKB:Q96ST3 150520179 PMID:10220385 IntAct PMID:10220385 HDAC1 Human protein binding enables IPI UniProtKB:Q92769,UniProtKB:Q96ST3,UniProtKB:Q9NRA0,UniProtKB:Q9UBB5 150520179 PMID:19729656 UniProt PMID:19729656 HDAC1 Human protein binding enables IPI UniProtKB:O35129 150520179 PMID:15140878 UniProt PMID:15140878 HDAC1 Human protein binding enables IPI UniProtKB:O94776|UniProtKB:Q09028|UniProtKB:Q16576|UniProtKB:Q92769|UniProtKB:Q9UKL0 150520179 PMID:19703393 IntAct PMID:19703393 HDAC1 Human protein binding enables IPI UniProtKB:Q09028|UniProtKB:Q16576 150520179 PMID:27705803 IntAct PMID:27705803 HDAC1 Human protein binding enables IPI UniProtKB:Q9UKL0 150520179 PMID:12192000, PMID:17939992, PMID:19497860 IntAct PMID:12192000|PMID:17939992|PMID:19497860 HDAC1 Human protein binding enables IPI UniProtKB:Q14995 150520179 PMID:17996965 UniProt PMID:17996965 HDAC1 Human protein binding enables IPI UniProtKB:Q96KQ7|UniProtKB:Q99684 150520179 PMID:16287849 IntAct PMID:16287849 HDAC1 Human protein binding enables IPI UniProtKB:Q09028|UniProtKB:Q92769 150520179 PMID:24981860 IntAct PMID:24981860 HDAC1 Human protein binding enables IPI UniProtKB:O43809 150520179 PMID:17172643 UniProt PMID:17172643 HDAC1 Human protein binding enables IPI UniProtKB:P17542 150520179 PMID:19497860 BHF-UCL PMID:19497860 HDAC1 Human protein binding enables IPI UniProtKB:P62805 150520179 PMID:21983900 IntAct PMID:21983900 HDAC1 Human protein binding enables IPI UniProtKB:Q92769|UniProtKB:Q9Y618 150520179 PMID:11739383 IntAct PMID:11739383 HDAC1 Human protein binding enables IPI UniProtKB:O75446 150520179 PMID:9651585 UniProt PMID:9651585 HDAC1 Human protein binding enables IPI UniProtKB:O94776|UniProtKB:Q92769|UniProtKB:Q96ST3|UniProtKB:Q9UKL0 150520179 PMID:17956988 IntAct PMID:17956988 HDAC1 Human protein binding enables IPI UniProtKB:P19838|UniProtKB:Q04206 150520179 PMID:11931769 IntAct PMID:11931769 HDAC1 Human protein binding enables IPI UniProtKB:O94776|UniProtKB:O95983|UniProtKB:P06400|UniProtKB:P68400|UniProtKB:Q09028|UniProtKB:Q13330|UniProtKB:Q14839|UniProtKB:Q14865|UniProtKB:Q16576|UniProtKB:Q6PH81|UniProtKB:Q8N108|UniProtKB:Q92618|UniProtKB:Q92769|UniProtKB:Q96KQ7|UniProtKB:Q96N64|UniProtKB:Q96ST3|UniProtKB:Q9C0K0|UniProtKB:Q9HCU9|UniProtKB:Q9NP50|UniProtKB:Q9UKL0 150520179 PMID:23752268 IntAct PMID:23752268 HDAC1 Human protein binding enables IPI UniProtKB:P04637|UniProtKB:P19838|UniProtKB:Q92769 150520179 PMID:25241761 IntAct PMID:25241761 HDAC1 Human protein binding enables IPI UniProtKB:Q9H4L7 150520179 PMID:21549307 UniProt PMID:21549307 HDAC1 Human protein binding enables IPI UniProtKB:O75381 150520179 PMID:11863372 UniProt PMID:11863372 HDAC1 Human protein binding enables IPI UniProtKB:Q8IXJ6 150520179 PMID:18722353 UniProt PMID:18722353 HDAC1 Human protein binding enables IPI UniProtKB:P06748 150520179 PMID:17318229 IntAct PMID:17318229 HDAC1 Human protein binding enables IPI UniProtKB:Q8N163 150520179 PMID:21030595 UniProt PMID:21030595 HDAC1 Human protein binding enables IPI UniProtKB:O94776 150520179 PMID:28179136, PMID:31980649 IntAct PMID:28179136|PMID:31980649 HDAC1 Human protein binding enables IPI UniProtKB:Q9BQA5 150520179 PMID:11553631 UniProt PMID:11553631 HDAC1 Human protein binding enables IPI UniProtKB:P43246 150520179 PMID:26221039 UniProt PMID:26221039 HDAC1 Human protein binding enables IPI UniProtKB:Q66K89 150520179 PMID:12730668, PMID:21666599 IntAct PMID:12730668|PMID:21666599 HDAC1 Human protein binding enables IPI UniProtKB:P29590|UniProtKB:P29590-5 150520179 PMID:11259576 UniProt PMID:11259576 HDAC1 Human protein binding enables IPI UniProtKB:O95365 150520179 PMID:24514149, PMID:26816381 IntAct PMID:24514149|PMID:26816381 HDAC1 Human protein binding enables IPI UniProtKB:P35638 150520179 PMID:17872950 UniProt PMID:17872950 HDAC1 Human protein binding enables IPI UniProtKB:Q13330|UniProtKB:Q96KQ7 150520179 PMID:26028330 IntAct PMID:26028330 HDAC1 Human protein binding enables IPI UniProtKB:O60921|UniProtKB:Q99638 150520179 PMID:10846170 UniProt PMID:10846170 HDAC1 Human protein binding enables IPI UniProtKB:Q01664 150520179 PMID:16540471, PMID:19505873 UniProt PMID:16540471|PMID:19505873 HDAC1 Human protein binding enables IPI UniProtKB:Q9UER7 150520179 PMID:12529400 IntAct PMID:12529400 HDAC1 Human protein binding enables IPI UniProtKB:Q12800|UniProtKB:Q86UQ8|UniProtKB:Q92831 150520179 PMID:15273251 UniProt PMID:15273251 HDAC1 Human protein binding enables IPI UniProtKB:Q92618 150520179 PMID:28947780 IntAct PMID:28947780 HDAC1 Human protein binding enables IPI UniProtKB:P29128 150520179 PMID:11559788 AgBase PMID:11559788 HDAC1 Human protein binding enables IPI UniProtKB:Q9NYF0 150520179 PMID:18936100 ParkinsonsUK-UCL PMID:18936100 HDAC1 Human protein binding enables IPI UniProtKB:O94776|UniProtKB:Q13330|UniProtKB:Q8N108 150520179 PMID:18451879 IntAct PMID:18451879 HDAC1 Human protein binding enables IPI UniProtKB:Q9Y4K3 150520179 PMID:18093978 UniProt PMID:18093978 HDAC1 Human protein binding enables IPI UniProtKB:Q9NQX1 150520179 PMID:17636019 IntAct PMID:17636019 HDAC1 Human protein binding enables IPI UniProtKB:Q8IWS0 150520179 PMID:22720776 UniProt PMID:22720776 HDAC1 Human protein binding enables IPI UniProtKB:O88508 150520179 PMID:14752048 UniProt PMID:14752048 HDAC1 Human protein binding enables IPI UniProtKB:O94776|UniProtKB:Q14865|UniProtKB:Q16576|UniProtKB:Q6PH81|UniProtKB:Q8N108|UniProtKB:Q92618|UniProtKB:Q92769|UniProtKB:Q96ST3|UniProtKB:Q9HCU9|UniProtKB:Q9NP50|UniProtKB:Q9UKL0 150520179 PMID:28514442 IntAct PMID:28514442 HDAC1 Human protein binding enables IPI UniProtKB:P06400|UniProtKB:Q01094 150520179 PMID:9468139, PMID:9468140 IntAct PMID:9468139|PMID:9468140 HDAC1 Human protein binding enables IPI UniProtKB:P06400|UniProtKB:Q05516|UniProtKB:Q13330 150520179 PMID:29997244 IntAct PMID:29997244 HDAC1 Human protein binding enables IPI UniProtKB:O94776|UniProtKB:Q09028 150520179 PMID:20127688 IntAct PMID:20127688 HDAC1 Human protein binding enables IPI UniProtKB:Q96D98 150520179 PMID:15970276 IntAct PMID:15970276 HDAC1 Human protein binding enables IPI UniProtKB:Q96EP1 150520179 PMID:19182791 UniProt PMID:19182791 HDAC1 Human protein binding enables IPI UniProtKB:Q14839 150520179 PMID:20693977, PMID:27616479, PMID:28977666 IntAct PMID:20693977|PMID:27616479|PMID:28977666 HDAC1 Human protein binding enables IPI UniProtKB:O43463|UniProtKB:Q9UIS9 150520179 PMID:12711603 IntAct PMID:12711603 HDAC1 Human protein binding enables IPI UniProtKB:P51610 150520179 PMID:12670868 UniProt PMID:12670868 HDAC1 Human protein binding enables IPI UniProtKB:Q8N108 150520179 PMID:12482978 IntAct PMID:12482978 HDAC1 Human protein binding ISO RGD:1316063 9068941 RGD PMID:17353261|REF_RGD_ID:2291838 HDAC1 Human protein binding ISO RGD:620365 9068941 RGD PMID:18413351|REF_RGD_ID:10041067 HDAC1 Human protein binding enables IPI UniProtKB:O94776|UniProtKB:Q13330|UniProtKB:Q14839|UniProtKB:Q92769|UniProtKB:Q96ST3 150520179 PMID:26949739 IntAct PMID:26949739 HDAC1 Human protein binding enables IPI UniProtKB:Q01094 150520179 PMID:17704056 UniProt PMID:17704056 HDAC1 Human protein binding enables IPI UniProtKB:P20749 150520179 PMID:16306601 UniProt PMID:16306601 HDAC1 Human protein binding enables IPI UniProtKB:O15379 150520179 PMID:22918830 IntAct PMID:22918830 HDAC1 Human protein binding enables IPI UniProtKB:O95863|UniProtKB:Q96ST3 150520179 PMID:25314079 IntAct PMID:25314079 HDAC1 Human protein binding enables IPI UniProtKB:O94776|UniProtKB:O95983|UniProtKB:Q09028|UniProtKB:Q13330|UniProtKB:Q14839|UniProtKB:Q14865|UniProtKB:Q16576|UniProtKB:Q6PH81|UniProtKB:Q8N108|UniProtKB:Q92618|UniProtKB:Q92769|UniProtKB:Q96KQ7|UniProtKB:Q96N64|UniProtKB:Q96ST3|UniProtKB:Q9C0K0|UniProtKB:Q9HCU9|UniProtKB:Q9NP50|UniProtKB:Q9UKL0 150520179 PMID:33961781 IntAct PMID:33961781 HDAC1 Human protein binding enables IPI UniProtKB:O94776|UniProtKB:O95983|UniProtKB:P68400|UniProtKB:Q09028|UniProtKB:Q13330|UniProtKB:Q14839|UniProtKB:Q14865|UniProtKB:Q16576|UniProtKB:Q6PH81|UniProtKB:Q8N108|UniProtKB:Q92618|UniProtKB:Q92769|UniProtKB:Q96N64|UniProtKB:Q96ST3|UniProtKB:Q9NP50|UniProtKB:Q9UKL0 150520179 PMID:35271311 IntAct PMID:35271311 HDAC1 Human protein binding enables IPI UniProtKB:Q8CBD1 150520179 PMID:11006275 UniProt PMID:11006275 HDAC1 Human protein binding ISO RGD:3075 9068941 RGD PMID:23671328|REF_RGD_ID:9590112 HDAC1 Human protein binding enables IPI UniProtKB:Q9C0K0 150520179 PMID:17245431 IntAct PMID:17245431 HDAC1 Human protein binding enables IPI UniProtKB:P35232 150520179 PMID:16964284 BHF-UCL PMID:16964284 HDAC1 Human protein binding ISO RGD:2920 9068941 RGD PMID:19843519|REF_RGD_ID:5128776 HDAC1 Human protein binding enables IPI UniProtKB:O95983 150520179 PMID:24048479, PMID:25123934 IntAct PMID:24048479|PMID:25123934 HDAC1 Human protein binding enables IPI UniProtKB:Q01101 150520179 PMID:16569215 UniProt PMID:16569215 HDAC1 Human protein binding enables IPI UniProtKB:Q63HK5 150520179 PMID:19343227 UniProt PMID:19343227 HDAC1 Human protein binding enables IPI UniProtKB:Q05516 150520179 PMID:32814053, PMID:37398436 IntAct PMID:32814053|PMID:37398436 HDAC1 Human protein binding enables IPI UniProtKB:P43355 150520179 PMID:15316101 IntAct PMID:15316101 HDAC1 Human protein decrotonylase activity enables IEA RHEA:69172 150520179 RHEA GO_REF:0000116 HDAC1 Human protein lysine deacetylase activity enables TAS 150520179 Reactome Reactome:R-HSA-9701565 HDAC1 Human protein lysine deacetylase activity enables IEA RHEA:58108 150520179 RHEA GO_REF:0000116 HDAC1 Human protein lysine deacetylase activity enables IDA 150520179 PMID:16285960, PMID:17172643, PMID:23629966 CAFA PMID:16285960|PMID:17172643|PMID:23629966 HDAC1 Human protein lysine deacetylase activity enables IEA ARBA:ARBA00028193 150520179 UniProt GO_REF:0000117 HDAC1 Human protein lysine deacetylase activity enables IMP 150520179 PMID:19182791 UniProt PMID:19182791 HDAC1 Human protein lysine delactylase activity enables IDA 150520179 PMID:35044827 UniProt PMID:35044827 HDAC1 Human protein lysine delactylase activity enables IEA RHEA:81387 150520179 RHEA GO_REF:0000116 HDAC1 Human protein-containing complex binding ISO RGD:1309799 9068941 RGD PMID:18271930|REF_RGD_ID:2306213 HDAC1 Human RNA polymerase II cis-regulatory region sequence-specific DNA binding enables IGI UniProtKB:Q99801 150520179 PMID:18974119 UniProt PMID:18974119 HDAC1 Human RNA polymerase II core promoter sequence-specific DNA binding enables IDA 150520179 PMID:19057576 ARUK-UCL PMID:19057576 HDAC1 Human RNA polymerase II-specific DNA-binding transcription factor binding enables IPI UniProtKB:Q96BF6 150520179 PMID:22926524 BHF-UCL PMID:22926524 HDAC1 Human RNA polymerase II-specific DNA-binding transcription factor binding enables IPI UniProtKB:P08047 150520179 PMID:18850004 BHF-UCL PMID:18850004 HDAC1 Human RNA polymerase II-specific DNA-binding transcription factor binding enables IEA UniProtKB:O09106|ensembl:ENSMUSP00000099657 150520179 Ensembl GO_REF:0000107 HDAC1 Human RNA polymerase II-specific DNA-binding transcription factor binding enables IPI UniProtKB:Q9UJU2 150520179 PMID:18936100 ParkinsonsUK-UCL PMID:18936100 HDAC1 Human transcription cis-regulatory region binding enables IEA UniProtKB:O09106|ensembl:ENSMUSP00000099657 150520179 Ensembl GO_REF:0000107 HDAC1 Human transcription corepressor activity enables IDA 150520179 PMID:15919722, PMID:30599067 BHF-UCL PMID:15919722|PMID:30599067 HDAC1 Human transcription corepressor activity enables IEA UniProtKB:O09106|ensembl:ENSMUSP00000099657 150520179 Ensembl GO_REF:0000107 HDAC1 Human transcription corepressor binding enables IPI UniProtKB:Q6W2J9 150520179 PMID:10898795 UniProt PMID:10898795 HDAC1 Human transcription factor binding ISO RGD:1306743 9068941 RGD PMID:18413351|REF_RGD_ID:10041067 HDAC1 Human transcription factor binding ISO RGD:2741 9068941 RGD PMID:23671328|REF_RGD_ID:9590112
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(20S)-ginsenoside Rh2 (EXP) (S)-nicotine (EXP,ISO) 1,2-dimethylhydrazine (ISO) 1-[3-(dimethylamino)propyl]-1-(4-fluorophenyl)-1,3-dihydro-2-benzofuran-5-carbonitrile (ISO) 15-deoxy-Delta(12,14)-prostaglandin J2 (EXP) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP) 2,2'-Methylenebis(4-methyl-6-tert-butylphenol) (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-tribromophenol (EXP) 3,3',4,4',5-pentachlorobiphenyl (ISO) 3,3'-diindolylmethane (ISO) 3,4-methylenedioxymethamphetamine (ISO) 4-phenylbutyric acid (EXP) 5-aza-2'-deoxycytidine (EXP) 5-fluorouracil (ISO) 6-propyl-2-thiouracil (ISO) 7,12-dimethyltetraphene (ISO) acetylsalicylic acid (EXP) acrylamide (ISO) aldehydo-D-glucose (ISO) all-trans-retinoic acid (EXP) allethrin (ISO) alpha-mangostin (EXP) amitrole (ISO) ammonium chloride (ISO) amphetamine (ISO) andrographolide (EXP) antirheumatic drug (EXP) arsenous acid (EXP) aspartame (ISO) benomyl (EXP) benzamide (EXP) benzo[a]pyrene (EXP,ISO) benzo[b]fluoranthene (EXP) beta-naphthoflavone (ISO) bisphenol A (EXP,ISO) butyric acid (EXP,ISO) C.I. Natural Red 20 (EXP) C60 fullerene (ISO) cadmium dichloride (EXP) caffeine (ISO) calcium oxalate (ISO) captan (ISO) carbamazepine (EXP) Chlamydocin (EXP) chlorpyrifos (ISO) choline (ISO) chromium atom (ISO) chromium(6+) (EXP) ciprofibrate (ISO) cisplatin (EXP) citalopram (ISO) cobalt dichloride (EXP) copper atom (EXP) copper(0) (EXP) cortisol (EXP) coumarin (EXP) CU-O LINKAGE (EXP) curcumin (EXP,ISO) cyclosporin A (EXP) cyhalothrin (ISO) cypermethrin (ISO) D-glucose (ISO) decabromodiphenyl ether (EXP) deoxynivalenol (ISO) dexamethasone (ISO) diarsenic trioxide (EXP) dibenz[a,h]anthracene (ISO) Dibutyl phosphate (EXP) dibutyl phthalate (ISO) dioxygen (ISO) doxorubicin (EXP,ISO) endosulfan (EXP,ISO) entinostat (EXP) enzyme inhibitor (EXP) ethanol (ISO) ethylene glycol (ISO) fenvalerate (ISO) fingolimod hydrochloride (EXP) flutamide (ISO) folic acid (ISO) FR900359 (EXP) furan (ISO) genistein (EXP) gentamycin (ISO) glucaric acid (ISO) glucose (ISO) glyphosate (EXP) guggulsterone (EXP) hesperidin (EXP) Honokiol (EXP) hydrogen peroxide (EXP,ISO) hydroquinone (EXP) indirubin (ISO) indole-3-methanol (ISO) isoprenaline (ISO) ivermectin (EXP) L-methionine (ISO) lead(0) (EXP,ISO) lipopolysaccharide (ISO) lithium chloride (ISO) lovastatin (ISO) manganese atom (EXP,ISO) manganese(0) (EXP,ISO) manganese(II) chloride (EXP) methimazole (ISO) methotrexate (EXP) methoxyacetic acid (EXP,ISO) methylmercury chloride (ISO) mocetinostat (EXP) monosodium L-glutamate (ISO) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (EXP) N-ethyl-N-nitrosourea (ISO) N-nitrosodiethylamine (ISO) N-Vinyl-2-pyrrolidone (ISO) nicotinamide (ISO) nicotine (EXP,ISO) nitrates (ISO) oleanolic acid (EXP) oxalic acid (EXP) oxybenzone (ISO) paracetamol (EXP,ISO) pelargonidin (ISO) pentachlorophenol (ISO) phenethyl isothiocyanate (ISO) potassium chloride (ISO) pregnenolone 16alpha-carbonitrile (ISO) progesterone (EXP) pyrethrins (ISO) resveratrol (EXP,ISO) rotenone (ISO) Shikonin (EXP) sodium arsenate (ISO) sodium arsenite (EXP) Soman (ISO) sulfadimethoxine (ISO) sulforaphane (EXP) sulindac sulfide (EXP) sunitinib (EXP) taiwanin C (EXP) tamoxifen (EXP) tangeretin (ISO) Tanshinone I (ISO) temozolomide (EXP) tert-butyl hydroperoxide (EXP) tetrachloromethane (ISO) theophylline (EXP) thioacetamide (ISO) thiophenes (EXP) thiram (EXP) titanium dioxide (ISO) Trapoxin B (EXP) trichloroethene (ISO) trichostatin A (EXP,ISO) Triptolide (ISO) triptonide (ISO) valproic acid (EXP,ISO) vinclozolin (ISO) vincristine (ISO) vitamin E (EXP) vorinostat (EXP,ISO) warfarin (ISO) withaferin A (EXP) zileuton (ISO) zinc atom (EXP,ISO) zinc dichloride (ISO) zinc(0) (EXP,ISO)
Biological Process
cellular response to oxidative stress (ISO) cellular response to platelet-derived growth factor stimulus (ISS) cellular response to tumor necrosis factor (ISO) chromatin organization (IEA,TAS) chromatin remodeling (HDA,IC,IDA,IEA) circadian regulation of gene expression (IEA,ISS) circadian rhythm (IEA) DNA methylation-dependent constitutive heterochromatin formation (IGI) embryonic digit morphogenesis (IEA,ISS) endoderm development (IEA) epidermal cell differentiation (IEA,ISS) eyelid development in camera-type eye (IEA,ISS) fungiform papilla formation (IEA,ISS) hair follicle placode formation (IEA,ISS) heterochromatin formation (IBA) hippocampus development (IEA) negative regulation of androgen receptor signaling pathway (IDA) negative regulation of apoptotic process (IEA,ISS,TAS) negative regulation of canonical NF-kappaB signal transduction (IEA) negative regulation of canonical Wnt signaling pathway (IEA,IGI) negative regulation of cell migration (NAS) negative regulation of cell population proliferation (ISO) negative regulation of DNA-templated transcription (IEA,IMP,ISO,ISS,NAS) negative regulation of gene expression (IMP) negative regulation of gene expression, epigenetic (IMP) negative regulation of insulin secretion (ISO) negative regulation of intrinsic apoptotic signaling pathway (IEA) negative regulation of myotube differentiation (IMP) negative regulation of neuron apoptotic process (ISO) negative regulation of peptidyl-lysine acetylation (ISO) negative regulation of stem cell population maintenance (NAS) negative regulation of transcription by RNA polymerase II (IDA,IEA,IGI,IMP,NAS) negative regulation of transforming growth factor beta receptor signaling pathway (NAS) neuron differentiation (IEA) odontogenesis of dentin-containing tooth (IEA,ISS) oligodendrocyte differentiation (IEA) positive regulation of cell population proliferation (IEA,IMP,ISO) positive regulation of chemokine (C-X-C motif) ligand 2 production (ISO) positive regulation of DNA-templated transcription (IDA,NAS) positive regulation of gene expression (ISS) positive regulation of interleukin-1 production (ISO) positive regulation of intracellular estrogen receptor signaling pathway (IMP) positive regulation of oligodendrocyte differentiation (IEA,ISO) positive regulation of protein modification process (ISO) positive regulation of smooth muscle cell proliferation (ISS) positive regulation of stem cell population maintenance (NAS) positive regulation of transcription by RNA polymerase II (IDA) positive regulation of tumor necrosis factor production (ISO) positive regulation of type B pancreatic cell apoptotic process (ISO) protein deacetylation (IDA) regulation of cell fate specification (NAS) regulation of stem cell differentiation (NAS) regulation of transcription by RNA polymerase II (IGI) response to amphetamine (ISO) response to caffeine (ISO) response to hyperoxia (ISO) response to lipopolysaccharide (ISO) response to xenobiotic stimulus (ISO) rhythmic process (IEA)
Cellular Component
chromatin (HDA,IDA,IEA,ISO) cytoplasm (TAS) cytosol (IDA) heterochromatin (IEA) histone deacetylase complex (IDA,IEA,TAS) neuronal cell body (IEA) nucleoplasm (IDA,TAS) nucleus (IDA,IEA,ISO,NAS) NuRD complex (IBA,IDA,IEA,NAS) perinuclear region of cytoplasm (ISO) protein-containing complex (HDA,IDA,IEA,ISO) Sin3-type complex (IDA,NAS) transcription regulator complex (IEA) transcription repressor complex (IEA)
Molecular Function
chromatin binding (IEA,ISO) core promoter sequence-specific DNA binding (IDA) deacetylase activity (ISO) DNA binding (IEA) DNA-binding transcription factor binding (IEA,IPI,TAS) E-box binding (IEA) enzyme binding (IPI) histone deacetylase activity (IBA,IDA,IEA,IMP,TAS) histone deacetylase activity, hydrolytic mechanism (IEA) histone deacetylase binding (IPI) histone decrotonylase activity (IDA,IEA) hydrolase activity (IEA) Krueppel-associated box domain binding (IEA) metal ion binding (IEA) NF-kappaB binding (IPI) nucleosomal DNA binding (HDA) p53 binding (IPI) promoter-specific chromatin binding (IEA) protein binding (IDA,IPI,ISO) protein decrotonylase activity (IEA) protein lysine deacetylase activity (IDA,IEA,IMP,TAS) protein lysine delactylase activity (IDA,IEA) protein-containing complex binding (ISO) RNA polymerase II cis-regulatory region sequence-specific DNA binding (IGI) RNA polymerase II core promoter sequence-specific DNA binding (IDA) RNA polymerase II-specific DNA-binding transcription factor binding (IEA,IPI) transcription cis-regulatory region binding (IEA) transcription corepressor activity (IDA,IEA) transcription corepressor binding (IPI) transcription factor binding (ISO)
1.
Histone deacetylase-1 (HDAC1) is a molecular switch between neuronal survival and death.
Bardai FH, etal., J Biol Chem. 2012 Oct 12;287(42):35444-53. doi: 10.1074/jbc.M112.394544. Epub 2012 Aug 23.
2.
The nucleosome remodeling and deacetylase complex in development and disease.
Basta J and Rauchman M, Transl Res. 2014 May 10. pii: S1931-5244(14)00166-2. doi: 10.1016/j.trsl.2014.05.003.
3.
Early life alcohol exposure primes hypothalamic microglia to later-life hypersensitivity to immune stress: possible epigenetic mechanism.
Chastain LG, etal., Neuropsychopharmacology. 2019 Aug;44(9):1579-1588. doi: 10.1038/s41386-019-0326-7. Epub 2019 Jan 30.
4.
GOAs Human GO annotations
GOA_HUMAN data from the GO Consortium
5.
The expression of histone deacetylase 4 is associated with prednisone poor-response in childhood acute lymphoblastic leukemia.
Gruhn B, etal., Leuk Res. 2013 Oct;37(10):1200-7. doi: 10.1016/j.leukres.2013.07.016. Epub 2013 Aug 12.
6.
Upregulation and nuclear recruitment of HDAC1 in hormone refractory prostate cancer.
Halkidou K, etal., Prostate. 2004 May 1;59(2):177-89.
7.
Down-regulation of β-catenin and the associated migration ability by Taiwanin C in arecoline and 4-NQO-induced oral cancer cells via GSK-3β activation.
Hsieh CH, etal., Mol Carcinog. 2017 Mar;56(3):1055-1067. doi: 10.1002/mc.22570. Epub 2016 Oct 4.
8.
Selective histone deacetylase (HDAC) inhibition imparts beneficial effects in Huntington's disease mice: implications for the ubiquitin-proteasomal and autophagy systems.
Jia H, etal., Hum Mol Genet. 2012 Dec 15;21(24):5280-93. doi: 10.1093/hmg/dds379. Epub 2012 Sep 10.
9.
Histone deacetylase expression in white matter oligodendrocytes after stroke.
Kassis H, etal., Neurochem Int. 2014 Nov;77:17-23. doi: 10.1016/j.neuint.2014.03.006. Epub 2014 Mar 19.
10.
Uteroplacental insufficiency affects epigenetic determinants of chromatin structure in brains of neonatal and juvenile IUGR rats.
Ke X, etal., Physiol Genomics. 2006 Mar 13;25(1):16-28. Epub 2005 Dec 27.
11.
Drug-induced inactivation or gene silencing of class I histone deacetylases suppresses ovarian cancer cell growth: implications for therapy.
Khabele D, etal., Cancer Biol Ther. 2007 May;6(5):795-801. Epub 2007 Feb 14.
12.
HDAC1 nuclear export induced by pathological conditions is essential for the onset of axonal damage.
Kim JY, etal., Nat Neurosci. 2010 Feb;13(2):180-9. doi: 10.1038/nn.2471. Epub 2009 Dec 27.
13.
Modes of p53 regulation.
Kruse JP and Gu W, Cell. 2009 May 15;137(4):609-22. doi: 10.1016/j.cell.2009.04.050.
14.
Combination of proteasome and HDAC inhibitors for uterine cervical cancer treatment.
Lin Z, etal., Clin Cancer Res. 2009 Jan 15;15(2):570-7.
15.
Histone deacetylases 1 and 3 but not 2 mediate cytokine-induced beta cell apoptosis in INS-1 cells and dispersed primary islets from rats and are differentially regulated in the islets of type 1 diabetic children.
Lundh M, etal., Diabetologia. 2012 Sep;55(9):2421-31. doi: 10.1007/s00125-012-2615-0. Epub 2012 Jul 7.
16.
Histone deacetylase-2 is a key regulator of diabetes- and transforming growth factor-beta1-induced renal injury.
Noh H, etal., Am J Physiol Renal Physiol. 2009 Sep;297(3):F729-39. doi: 10.1152/ajprenal.00086.2009. Epub 2009 Jun 24.
17.
Development of type 2 diabetes following intrauterine growth retardation in rats is associated with progressive epigenetic silencing of Pdx1.
Park JH, etal., J Clin Invest. 2008 Jun;118(6):2316-24.
18.
Physical and functional HAT/HDAC interplay regulates protein acetylation balance.
Peserico A and Simone C, J Biomed Biotechnol. 2011;2011:371832. doi: 10.1155/2011/371832. Epub 2010 Dec 5.
19.
Prenatal caffeine ingestion induces aberrant DNA methylation and histone acetylation of steroidogenic factor 1 and inhibits fetal adrenal steroidogenesis.
Ping J, etal., Toxicology. 2014 Jul 3;321:53-61. doi: 10.1016/j.tox.2014.03.011. Epub 2014 Apr 6.
20.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
21.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
22.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
23.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
24.
HDAC up-regulation in early colon field carcinogenesis is involved in cell tumorigenicity through regulation of chromatin structure.
Stypula-Cyrus Y, etal., PLoS One. 2013 May 28;8(5):e64600. doi: 10.1371/journal.pone.0064600. Print 2013.
25.
Screening of histone deacetylases (HDAC) expression in human prostate cancer reveals distinct class I HDAC profiles between epithelial and stromal cells.
Waltregny D, etal., Eur J Histochem. 2004 Jul-Sep;48(3):273-90.
26.
Integrated microarray analysis provided novel insights to the pathogenesis of glaucoma.
Wang J, etal., Mol Med Rep. 2017 Dec;16(6):8735-8746. doi: 10.3892/mmr.2017.7711. Epub 2017 Oct 4.
27.
Significance of DNA methyltransferase-1 and histone deacetylase-1 in pancreatic cancer.
Wang W, etal., Oncol Rep. 2009 Jun;21(6):1439-47.
28.
Histone deacetylases 1, 2 and 3 are highly expressed in prostate cancer and HDAC2 expression is associated with shorter PSA relapse time after radical prostatectomy.
Weichert W, etal., Br J Cancer. 2008 Feb 12;98(3):604-10. Epub 2008 Jan 22.
29.
Expression of class I histone deacetylases indicates poor prognosis in endometrioid subtypes of ovarian and endometrial carcinomas.
Weichert W, etal., Neoplasia. 2008 Sep;10(9):1021-7.
30.
Quantitation of HDAC1 mRNA expression in invasive carcinoma of the breast*.
Zhang Z, etal., Breast Cancer Res Treat. 2005 Nov;94(1):11-6.
31.
Histone deacetylation inhibition in pulmonary hypertension: therapeutic potential of valproic acid and suberoylanilide hydroxamic acid.
Zhao L, etal., Circulation. 2012 Jul 24;126(4):455-67. doi: 10.1161/CIRCULATIONAHA.112.103176. Epub 2012 Jun 18.
32.
Abnormal epigenetic modifications in peripheral blood mononuclear cells from patients with alopecia areata.
Zhao M, etal., Br J Dermatol. 2012 Feb;166(2):226-73. doi: 10.1111/j.1365-2133.2011.10646.x. Epub 2012 Jan 9.
HDAC1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 32,292,083 - 32,333,626 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 32,292,083 - 32,333,635 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 32,757,684 - 32,799,227 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 32,530,295 - 32,571,811 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 32,426,800 - 32,468,317 NCBI Celera 1 31,028,175 - 31,069,691 (+) NCBI Celera Cytogenetic Map 1 p35.2-p35.1 NCBI HuRef 1 30,873,184 - 30,914,532 (+) NCBI HuRef CHM1_1 1 32,873,153 - 32,914,668 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 32,150,000 - 32,191,544 (+) NCBI T2T-CHM13v2.0
Hdac1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 129,409,897 - 129,436,516 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 129,409,897 - 129,436,506 (-) Ensembl GRCm39 Ensembl GRCm38 4 129,516,104 - 129,542,646 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 129,516,104 - 129,542,713 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 129,193,348 - 129,219,890 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 129,018,408 - 129,044,950 (-) NCBI MGSCv36 mm8 Celera 17 82,795,228 - 82,797,813 (+) NCBI Celera Cytogenetic Map 4 D2.2 NCBI cM Map 4 63.26 NCBI
Hdac1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 147,138,328 - 147,165,387 (-) NCBI GRCr8 mRatBN7.2 5 141,853,992 - 141,881,057 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 141,853,989 - 141,881,111 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 144,555,355 - 144,582,392 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 146,325,182 - 146,352,217 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 146,321,706 - 146,348,843 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 147,716,664 - 147,743,723 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 147,716,664 - 147,743,723 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 151,445,686 - 151,472,652 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 148,672,515 - 148,699,810 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 148,682,553 - 148,709,849 (-) NCBI Celera 5 140,329,254 - 140,356,320 (-) NCBI Celera Cytogenetic Map 5 q36 NCBI
Hdac1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955452 10,636,366 - 10,670,864 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955452 10,636,366 - 10,668,873 (+) NCBI ChiLan1.0 ChiLan1.0
HDAC1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 194,493,301 - 194,535,079 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 193,614,643 - 193,656,280 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 31,578,373 - 31,619,970 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 32,585,791 - 32,626,408 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 32,585,791 - 32,626,410 (+) Ensembl panpan1.1 panPan2
HDAC1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 2 68,901,339 - 68,936,473 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 2 68,901,651 - 68,936,186 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 2 65,482,127 - 65,517,259 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 2 69,467,855 - 69,503,012 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 2 69,467,851 - 69,502,759 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 2 66,304,797 - 66,339,911 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 2 67,300,918 - 67,335,502 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 2 68,299,008 - 68,334,559 (-) NCBI UU_Cfam_GSD_1.0
Hdac1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 49,495,732 - 49,526,636 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936474 15,320,729 - 15,350,860 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936474 15,320,635 - 15,351,418 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
HDAC1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 88,749,634 - 88,785,411 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 88,749,611 - 88,785,220 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 82,882,080 - 82,907,607 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
HDAC1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 100,529,782 - 100,575,953 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 100,530,369 - 100,558,556 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666033 16,112,046 - 16,155,022 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Hdac1
.
Confirmed Target Of
MIR449A hsa-miR-449a Mirtarbase external_info Luciferase reporter assay//qRT-PCR//Western blot// Functional MTI 19252524 MIR449A hsa-miR-449a Mirtarbase external_info Immunoblot Functional MTI (Weak) 20948989 MIR449A hsa-miR-449a OncomiRDB external_info NA NA 22078727 MIR449A hsa-miR-449a OncomiRDB external_info NA NA 19252524 MIR449B hsa-miR-449b-5p Mirtarbase external_info Luciferase reporter assay//Western blot Functional MTI 21418558 MIR449B hsa-miR-449b-5p OncomiRDB external_info NA NA 22078727
Predicted Target Of
Count of predictions: 2737 Count of miRNA genes: 910 Interacting mature miRNAs: 1097 Transcripts: ENST00000373541, ENST00000373548, ENST00000428704, ENST00000463172, ENST00000471488, ENST00000472928, ENST00000476391, ENST00000481281, ENST00000482310, ENST00000484305, ENST00000490081 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1576329 MYI9_H Myocardial infarction susceptibility QTL 9 (human) 12 Myocardial infarction susceptibility early-onset 1 7585503 33585503 Human 1576325 MYI1_H Myocardial infarction susceptibility QTL 1 (human) 11.68 1e-12 Myocardial infarction susceptibility early-onset 1 7585503 33585503 Human 1643380 BW316_H Body weight QTL 316 (human) 2.62 0.0002 Body weight BMI 1 7585503 33585503 Human
RH80765
Human Assembly Chr Position (strand) Source JBrowse GRCh37 1 32,798,652 - 32,798,885 UniSTS GRCh37 Build 36 1 32,571,239 - 32,571,472 RGD NCBI36 Celera 1 31,069,119 - 31,069,352 RGD Cytogenetic Map 1 p34 UniSTS HuRef 1 30,913,960 - 30,914,193 UniSTS GeneMap99-GB4 RH Map 1 90.73 UniSTS
WI-8367
Human Assembly Chr Position (strand) Source JBrowse GRCh37 1 32,799,026 - 32,799,206 UniSTS GRCh37 Build 36 1 32,571,613 - 32,571,793 RGD NCBI36 Celera 1 31,069,493 - 31,069,673 RGD Cytogenetic Map 1 p34 UniSTS Cytogenetic Map 1 p35.1 UniSTS HuRef 1 30,914,334 - 30,914,514 UniSTS
RH77985
Human Assembly Chr Position (strand) Source JBrowse GRCh37 1 32,799,010 - 32,799,132 UniSTS GRCh37 Build 36 1 32,571,597 - 32,571,719 RGD NCBI36 Celera 1 31,069,477 - 31,069,599 RGD Cytogenetic Map 1 p34 UniSTS Cytogenetic Map 1 p35.1 UniSTS HuRef 1 30,914,318 - 30,914,440 UniSTS GeneMap99-GB4 RH Map 1 94.68 UniSTS
RH70655
Human Assembly Chr Position (strand) Source JBrowse GRCh37 1 32,797,699 - 32,798,646 UniSTS GRCh37 GRCh37 1 217,725,971 - 217,726,223 UniSTS GRCh37 Build 36 1 215,792,594 - 215,792,846 RGD NCBI36 Celera 1 31,068,166 - 31,069,113 UniSTS Celera 1 190,949,751 - 190,950,003 RGD Cytogenetic Map 1 p34 UniSTS Cytogenetic Map 1 q41 UniSTS HuRef 1 30,913,007 - 30,913,954 UniSTS GeneMap99-GB4 RH Map 1 707.33 UniSTS
HDAC1_3209
Human Assembly Chr Position (strand) Source JBrowse GRCh37 1 32,798,696 - 32,799,387 UniSTS GRCh37 Build 36 1 32,571,283 - 32,571,974 RGD NCBI36 Celera 1 31,069,163 - 31,069,854 RGD HuRef 1 30,914,004 - 30,914,695 UniSTS
RH48422
Human Assembly Chr Position (strand) Source JBrowse GRCh37 1 32,796,439 - 32,797,132 UniSTS GRCh37 Celera 1 31,066,906 - 31,067,599 UniSTS Cytogenetic Map 1 p34 UniSTS HuRef 1 30,911,747 - 30,912,440 UniSTS GeneMap99-GB4 RH Map 1 94.68 UniSTS
RH64844
Human Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 1 p34 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
entire extraembryonic component
1204
2439
2788
2253
4974
1726
2351
6
624
1951
465
2270
7306
6472
53
3734
1
852
1744
1617
175
1
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENST00000373548 ⟹ ENSP00000362649
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 32,292,083 - 32,333,626 (+) Ensembl
Ensembl Acc Id:
ENST00000428704 ⟹ ENSP00000407859
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 32,292,140 - 32,329,140 (+) Ensembl
Ensembl Acc Id:
ENST00000463172
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 32,292,137 - 32,327,445 (+) Ensembl
Ensembl Acc Id:
ENST00000471488
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 32,331,536 - 32,333,079 (+) Ensembl
Ensembl Acc Id:
ENST00000472928
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 32,292,161 - 32,327,677 (+) Ensembl
Ensembl Acc Id:
ENST00000476391
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 32,329,480 - 32,333,635 (+) Ensembl
Ensembl Acc Id:
ENST00000481281
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 32,292,135 - 32,333,626 (+) Ensembl
Ensembl Acc Id:
ENST00000482310
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 32,327,274 - 32,331,582 (+) Ensembl
Ensembl Acc Id:
ENST00000484305
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 32,330,149 - 32,330,875 (+) Ensembl
Ensembl Acc Id:
ENST00000490081
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 32,327,189 - 32,331,781 (+) Ensembl
Ensembl Acc Id:
ENST00000718279 ⟹ ENSP00000520717
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 32,292,083 - 32,333,626 (+) Ensembl
RefSeq Acc Id:
NM_004964 ⟹ NP_004955
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 1 32,292,083 - 32,333,626 (+) NCBI GRCh37 1 32,757,708 - 32,799,227 (+) NCBI Build 36 1 32,530,295 - 32,571,811 (+) NCBI Archive HuRef 1 30,873,184 - 30,914,532 (+) ENTREZGENE CHM1_1 1 32,873,153 - 32,914,668 (+) NCBI T2T-CHM13v2.0 1 32,150,000 - 32,191,544 (+) NCBI
Sequence:
CCCCTCCCCCCTGGGTCGGACGCTGAGCGGAGCCGCGGGCGGGAGGGCGGACGGACCGACTGACGGTAGGGACGGGAGGCGAGCAAGATGGCGCAGACGCAGGGCACCCGGAGGAAAGTCTGTTACTA
hide sequence
RefSeq Acc Id:
XM_011541309 ⟹ XP_011539611
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 1 32,327,144 - 32,333,626 (+) NCBI
Sequence:
CGCTGAGCGGAGCCGCGGGCGGGAGGGCGGACGGACCGACTGACGGTAGGGACGGGAGGCGAGCAAGATGGCGCAGACGCAGGGCACCCGGAGGAAAGTCTGTTACTACTACGACGGGGATGTTGGAA
hide sequence
RefSeq Acc Id:
XM_054336203 ⟹ XP_054192178
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 1 32,185,062 - 32,191,544 (+) NCBI
RefSeq Acc Id:
NP_004955 ⟸ NM_004964
- UniProtKB:
Q92534 (UniProtKB/Swiss-Prot), Q13547 (UniProtKB/Swiss-Prot), Q6IT96 (UniProtKB/TrEMBL), D3DPP9 (UniProtKB/TrEMBL), B5BU61 (UniProtKB/TrEMBL)
- Sequence:
MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQ
hide sequence
RefSeq Acc Id:
XP_011539611 ⟸ XM_011541309
- Peptide Label:
isoform X1
- UniProtKB:
B4DRG0 (UniProtKB/TrEMBL)
- Sequence:
MTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALD
hide sequence
Ensembl Acc Id:
ENSP00000362649 ⟸ ENST00000373548
Ensembl Acc Id:
ENSP00000407859 ⟸ ENST00000428704
RefSeq Acc Id:
XP_054192178 ⟸ XM_054336203
- Peptide Label:
isoform X1
- UniProtKB:
B4DRG0 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSP00000520717 ⟸ ENST00000718279
RGD ID: 6854834 Promoter ID: EPDNEW_H582 Type: initiation region Name: HDAC1_1 Description: histone deacetylase 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_H584 EPDNEW_H583 Experiment Methods: Single-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 1 32,292,104 - 32,292,164 EPDNEW
RGD ID: 6854990 Promoter ID: EPDNEW_H583 Type: initiation region Name: HDAC1_3 Description: histone deacetylase 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_H582 EPDNEW_H584 Experiment Methods: Single-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 1 32,292,240 - 32,292,300 EPDNEW
RGD ID: 6854838 Promoter ID: EPDNEW_H584 Type: multiple initiation site Name: HDAC1_2 Description: histone deacetylase 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_H582 EPDNEW_H583 Experiment Methods: Single-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 1 32,329,419 - 32,329,479 EPDNEW
RGD ID: 6785700 Promoter ID: HG_KWN:1820 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: CD4+TCell, CD4+TCell_12Hour, CD4+TCell_2Hour, HeLa_S3, Jurkat, K562, Lymphoblastoid, NB4 Transcripts: ENST00000373541, OTTHUMT00000019815, OTTHUMT00000019817, OTTHUMT00000020042, OTTHUMT00000020043, OTTHUMT00000099439 Position: Human Assembly Chr Position (strand) Source Build 36 1 32,529,666 - 32,530,507 (+) MPROMDB
RGD ID: 6850600 Promoter ID: EP73094 Type: initiation region Name: HS_HDAC1 Description: Histone deacetylase 1. SO ACC ID: SO:0000170 Source: EPD (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: NEDO full length human cDNA sequencing project.; Oligo-capping Position: Human Assembly Chr Position (strand) Source Build 36 1 32,530,428 - 32,530,488 EPD
RGD ID: 6785702 Promoter ID: HG_KWN:1822 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: K562, Lymphoblastoid Transcripts: OTTHUMT00000019819, OTTHUMT00000020044 Position: Human Assembly Chr Position (strand) Source Build 36 1 32,565,369 - 32,565,869 (+) MPROMDB
RGD ID: 6785703 Promoter ID: HG_KWN:1823 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: K562, Lymphoblastoid Transcripts: OTTHUMT00000019816, OTTHUMT00000020045 Position: Human Assembly Chr Position (strand) Source Build 36 1 32,567,001 - 32,568,852 (+) MPROMDB
RGD ID: 6785705 Promoter ID: HG_KWN:1824 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: CD4+TCell_12Hour, Jurkat, K562, Lymphoblastoid Transcripts: OTTHUMT00000020046 Position: Human Assembly Chr Position (strand) Source Build 36 1 32,569,026 - 32,570,052 (+) MPROMDB
