Symbol:
Hspa4
Name:
heat shock protein family A (Hsp70) member 4
RGD ID:
628878
Description:
Enables RNA polymerase II-specific DNA-binding transcription factor binding activity. Involved in several processes, including negative regulation of macromolecule metabolic process; positive regulation of angiogenesis; and regulation of microglial cell activation. Located in lipid droplet. Used to study adult respiratory distress syndrome and middle cerebral artery infarction. Biomarker of Parkinson's disease and liver benign neoplasm. Human ortholog(s) of this gene implicated in Chagas disease. Orthologous to human HSPA4 (heat shock protein family A (Hsp70) member 4); PARTICIPATES IN cortisol signaling pathway; estrogen signaling pathway; antigen processing and presentation pathway; INTERACTS WITH (+)-schisandrin B; 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane; 17alpha-ethynylestradiol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
heat shock 70 kDa protein 4; heat shock protein 4; heat shock protein family A member 4; Hsp110; Hsp70; irp94; ischemia responsive 94 kDa protein
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 37,908,866 - 37,951,994 (-) NCBI GRCr8 mRatBN7.2 10 37,408,025 - 37,449,080 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 37,408,025 - 37,449,001 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 42,101,220 - 42,141,891 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 41,591,248 - 41,631,920 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 37,094,962 - 37,135,636 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 38,601,624 - 38,642,397 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 38,601,624 - 38,642,397 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 38,383,101 - 38,424,016 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 38,705,629 - 38,749,058 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 38,712,058 - 38,755,488 (-) NCBI Celera 10 36,756,477 - 36,796,741 (-) NCBI Celera Cytogenetic Map 10 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Hspa4 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of HSPA4 mRNA] CTD PMID:31150632 Hspa4 Rat (-)-epigallocatechin 3-gallate increases expression ISO HSPA4 (Homo sapiens) 6480464 epigallocatechin gallate results in increased expression of HSPA4 protein CTD PMID:31195006 Hspa4 Rat 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane increases expression ISO Hspa4 (Mus musculus) 6480464 o and p'-DDT results in increased expression of HSPA4 mRNA CTD PMID:24096037 Hspa4 Rat 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane increases expression EXP 6480464 o more ... CTD PMID:22937105 and PMID:24096037 Hspa4 Rat 1,2-dichloroethane increases expression ISO Hspa4 (Mus musculus) 6480464 ethylene dichloride results in increased expression of HSPA4 mRNA CTD PMID:28189721 and PMID:28960355 Hspa4 Rat 1,2-dimethylhydrazine multiple interactions ISO Hspa4 (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of HSPA4 mRNA] CTD PMID:22206623 Hspa4 Rat 1,2-dimethylhydrazine increases expression ISO Hspa4 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of HSPA4 mRNA CTD PMID:22206623 Hspa4 Rat 1-naphthyl isothiocyanate increases expression ISO Hspa4 (Mus musculus) 6480464 1-Naphthylisothiocyanate results in increased expression of HSPA4 mRNA CTD PMID:15913567 Hspa4 Rat 1-naphthyl isothiocyanate multiple interactions ISO Hspa4 (Mus musculus) 6480464 O(2)-vinyl-1-(pyrrolidin-1-yl)diazen-1-ium-1 and 2-diolate inhibits the reaction [1-Naphthylisothiocyanate results in increased expression of HSPA4 mRNA] CTD PMID:15913567 Hspa4 Rat 17alpha-ethynylestradiol affects expression ISO Hspa4 (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of HSPA4 mRNA CTD PMID:17555576 Hspa4 Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of HSPA4 mRNA CTD PMID:16174780 and PMID:24096037 Hspa4 Rat 17alpha-ethynylestradiol increases expression ISO Hspa4 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of HSPA4 mRNA CTD PMID:16174780 more ... Hspa4 Rat 17alpha-ethynylestradiol multiple interactions ISO Hspa4 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of HSPA4 mRNA CTD PMID:17942748 Hspa4 Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of HSPA4 mRNA CTD PMID:20068009 Hspa4 Rat 17beta-estradiol increases expression ISO Hspa4 (Mus musculus) 6480464 Estradiol results in increased expression of HSPA4 mRNA CTD PMID:14664709 and PMID:39298647 Hspa4 Rat 17beta-estradiol increases expression ISO HSPA4 (Homo sapiens) 6480464 Estradiol results in increased expression of HSPA4 mRNA CTD PMID:16514628 and PMID:31614463 Hspa4 Rat 1H-pyrazole increases expression ISO Hspa4 (Mus musculus) 6480464 pyrazole results in increased expression of HSPA4 mRNA CTD PMID:17945193 Hspa4 Rat 2,2',5,5'-tetrachlorobiphenyl increases expression EXP 6480464 2 more ... CTD PMID:23829299 Hspa4 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO HSPA4 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of HSPA4 mRNA CTD PMID:12377990 Hspa4 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Hspa4 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of HSPA4 mRNA CTD PMID:21570461 Hspa4 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Hspa4 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of HSPA4 mRNA CTD PMID:20159946 Hspa4 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Hspa4 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of HSPA4 mRNA CTD PMID:17942748 Hspa4 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether decreases expression EXP 6480464 2 more ... CTD PMID:19954255 Hspa4 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether increases expression EXP 6480464 2 more ... CTD PMID:19954255 Hspa4 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether increases expression ISO Hspa4 (Mus musculus) 6480464 2 more ... CTD PMID:18550172 Hspa4 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of HSPA4 mRNA CTD PMID:21346803 Hspa4 Rat 2,6-dimethoxyphenol multiple interactions ISO HSPA4 (Homo sapiens) 6480464 [Sodium Chloride co-treated with pyrogallol 1 and 3-dimethyl ether] results in decreased expression of and affects the localization of HSPA4 protein CTD PMID:38598786 Hspa4 Rat 3,3'-Dichlorobenzidine affects expression ISO HSPA4 (Homo sapiens) 6480464 3 and 3'-Dichlorobenzidine affects the expression of HSPA4 protein CTD PMID:24604609 Hspa4 Rat 3H-1,2-dithiole-3-thione decreases expression EXP 6480464 1 and 2-dithiol-3-thione results in decreased expression of HSPA4 mRNA CTD PMID:19162173 Hspa4 Rat 4,4'-diaminodiphenylmethane increases expression ISO Hspa4 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of HSPA4 mRNA CTD PMID:18648102 Hspa4 Rat 4,4'-sulfonyldiphenol increases expression ISO Hspa4 (Mus musculus) 6480464 bisphenol S results in increased expression of HSPA4 mRNA CTD PMID:39298647 Hspa4 Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of HSPA4 mRNA CTD PMID:36041667 Hspa4 Rat 4-(ethoxymethylene)-2-phenyloxazol-5-one increases expression ISO Hspa4 (Mus musculus) 6480464 Oxazolone results in increased expression of HSPA4 mRNA CTD PMID:11379042 Hspa4 Rat 5-fluorouracil decreases expression ISO HSPA4 (Homo sapiens) 6480464 Fluorouracil results in decreased expression of HSPA4 protein CTD PMID:15352031 Hspa4 Rat 5-fluorouracil affects response to substance ISO HSPA4 (Homo sapiens) 6480464 HSPA4 protein affects the susceptibility to Fluorouracil CTD PMID:15352031 Hspa4 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of HSPA4 mRNA CTD PMID:30047161 Hspa4 Rat acrylamide increases expression ISO HSPA4 (Homo sapiens) 6480464 Acrylamide results in increased expression of HSPA4 mRNA CTD PMID:32763439 Hspa4 Rat afimoxifene decreases expression ISO HSPA4 (Homo sapiens) 6480464 afimoxifene results in decreased expression of HSPA4 mRNA CTD PMID:16514628 Hspa4 Rat aflatoxin B1 increases expression ISO HSPA4 (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of HSPA4 mRNA CTD PMID:27153756 Hspa4 Rat albendazole multiple interactions ISO HSPA4 (Homo sapiens) 6480464 [Ivermectin co-treated with Albendazole] results in increased expression of HSPA4 mRNA CTD PMID:16861626 Hspa4 Rat all-trans-retinoic acid decreases expression ISO HSPA4 (Homo sapiens) 6480464 Tretinoin results in decreased expression of HSPA4 mRNA CTD PMID:33167477 Hspa4 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of HSPA4 mRNA CTD PMID:30047161 Hspa4 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of HSPA4 mRNA CTD PMID:16483693 Hspa4 Rat amphibole asbestos increases expression ISO HSPA4 (Homo sapiens) 6480464 Asbestos and Amphibole results in increased expression of HSPA4 protein CTD PMID:20855422 Hspa4 Rat aristolochic acid A increases expression ISO HSPA4 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of HSPA4 protein CTD PMID:33212167 Hspa4 Rat Aroclor 1254 decreases expression ISO Hspa4 (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of HSPA4 mRNA CTD PMID:23650126 Hspa4 Rat Aroclor 1254 increases expression EXP 6480464 Chlorodiphenyl (54% Chlorine) results in increased expression of HSPA4 protein CTD PMID:21791222 Hspa4 Rat arsane multiple interactions ISO HSPA4 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of HSPA4 mRNA CTD PMID:39836092 Hspa4 Rat arsenic atom multiple interactions ISO HSPA4 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of HSPA4 mRNA CTD PMID:39836092 Hspa4 Rat arsenous acid multiple interactions ISO HSPA4 (Homo sapiens) 6480464 Atrazine inhibits the reaction [Arsenic Trioxide results in increased expression of HSPA4 mRNA] CTD PMID:11678611 Hspa4 Rat arsenous acid increases expression ISO HSPA4 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of HSPA4 mRNA and Arsenic Trioxide results in increased expression of HSPA4 protein CTD PMID:11678611 more ... Hspa4 Rat atrazine multiple interactions ISO HSPA4 (Homo sapiens) 6480464 Atrazine inhibits the reaction [arsenic trioxide results in increased expression of HSPA4 mRNA] CTD PMID:11678611 Hspa4 Rat atrazine decreases expression ISO HSPA4 (Homo sapiens) 6480464 Atrazine results in decreased expression of HSPA4 mRNA CTD PMID:22378314 Hspa4 Rat atrazine increases expression ISO HSPA4 (Homo sapiens) 6480464 Atrazine results in increased expression of HSPA4 protein CTD PMID:25275270 Hspa4 Rat benzo[a]pyrene increases expression ISO Hspa4 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of HSPA4 mRNA CTD PMID:22228805 Hspa4 Rat benzo[a]pyrene decreases methylation ISO HSPA4 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of HSPA4 promoter CTD PMID:27901495 Hspa4 Rat benzo[a]pyrene multiple interactions ISO HSPA4 (Homo sapiens) 6480464 [Soot co-treated with Benzo(a)pyrene] results in increased expression of HSPA4 protein modified form CTD PMID:24464499 Hspa4 Rat benzo[a]pyrene diol epoxide I decreases expression ISO HSPA4 (Homo sapiens) 6480464 7 more ... CTD PMID:20018196 Hspa4 Rat bexarotene decreases expression EXP 6480464 bexarotene results in decreased expression of HSPA4 mRNA CTD PMID:16648578 Hspa4 Rat bis(2-chloroethyl) sulfide increases expression ISO Hspa4 (Mus musculus) 6480464 Mustard Gas results in increased expression of HSPA4 mRNA CTD PMID:15674844 Hspa4 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Hspa4 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of HSPA4 mRNA CTD PMID:33754040 Hspa4 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of HSPA4 mRNA CTD PMID:25181051 Hspa4 Rat bisphenol A decreases expression ISO HSPA4 (Homo sapiens) 6480464 bisphenol A results in decreased expression of HSPA4 protein CTD PMID:37567409 Hspa4 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of HSPA4 mRNA CTD PMID:36041667 Hspa4 Rat bisphenol A decreases expression ISO Hspa4 (Mus musculus) 6480464 bisphenol A results in decreased expression of HSPA4 mRNA CTD PMID:33221593 Hspa4 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of HSPA4 mRNA CTD PMID:34947998 Hspa4 Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of HSPA4 mRNA CTD PMID:36041667 Hspa4 Rat cadmium atom increases expression ISO HSPA4 (Homo sapiens) 6480464 Cadmium results in increased expression of HSPA4 protein CTD PMID:16959797 Hspa4 Rat cadmium dichloride increases expression ISO HSPA4 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of HSPA4 protein CTD PMID:16959797 Hspa4 Rat cadmium dichloride multiple interactions ISO Hspa4 (Mus musculus) 6480464 MT1 affects the reaction [Cadmium Chloride results in increased expression of HSPA4 mRNA] and MT2 affects the reaction [Cadmium Chloride results in increased expression of HSPA4 mRNA] CTD PMID:11958953 Hspa4 Rat cadmium dichloride increases expression ISO Hspa4 (Mus musculus) 6480464 Cadmium Chloride results in increased expression of HSPA4 mRNA CTD PMID:11958953 Hspa4 Rat caffeine increases expression ISO HSPA4 (Homo sapiens) 6480464 Caffeine results in increased expression of HSPA4 protein CTD PMID:31195006 Hspa4 Rat caffeine increases phosphorylation ISO HSPA4 (Homo sapiens) 6480464 Caffeine results in increased phosphorylation of HSPA4 protein CTD PMID:35688186 Hspa4 Rat calciol increases expression ISO Hspa4 (Mus musculus) 6480464 Cholecalciferol results in increased expression of HSPA4 mRNA CTD PMID:16508948 Hspa4 Rat cannabidiol multiple interactions ISO HSPA4 (Homo sapiens) 6480464 [Cannabidiol co-treated with moringin] results in increased expression of HSPA4 mRNA CTD PMID:30096889 Hspa4 Rat cannabidiol increases expression ISO HSPA4 (Homo sapiens) 6480464 Cannabidiol results in increased expression of HSPA4 mRNA CTD PMID:28025562 Hspa4 Rat carbon nanotube decreases expression ISO Hspa4 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25620056 Hspa4 Rat carbon nanotube increases expression ISO Hspa4 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Hspa4 Rat carbonyl cyanide p-trifluoromethoxyphenylhydrazone decreases expression ISO HSPA4 (Homo sapiens) 6480464 Carbonyl Cyanide p-Trifluoromethoxyphenylhydrazone results in decreased expression of HSPA4 mRNA CTD PMID:16039398 Hspa4 Rat casticin decreases expression ISO Hspa4 (Mus musculus) 6480464 casticin results in decreased expression of HSPA4 mRNA CTD PMID:28444820 Hspa4 Rat chloropicrin increases expression ISO HSPA4 (Homo sapiens) 6480464 chloropicrin results in increased expression of HSPA4 mRNA CTD PMID:26352163 Hspa4 Rat chlorpyrifos increases expression ISO Hspa4 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of HSPA4 mRNA CTD PMID:29156651 Hspa4 Rat chlorpyrifos decreases expression ISO Hspa4 (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of HSPA4 mRNA CTD PMID:37019170 Hspa4 Rat clofibrate increases expression ISO Hspa4 (Mus musculus) 6480464 Clofibrate results in increased expression of HSPA4 mRNA CTD PMID:23811191 Hspa4 Rat clotrimazole increases expression EXP 6480464 Clotrimazole results in increased expression of HSPA4 mRNA CTD PMID:30047161 Hspa4 Rat cobalt dichloride increases expression ISO HSPA4 (Homo sapiens) 6480464 cobaltous chloride results in increased expression of HSPA4 mRNA CTD PMID:19376846 Hspa4 Rat copper atom multiple interactions ISO HSPA4 (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in decreased expression of HSPA4 mRNA and [NSC 689534 binds to Copper] which results in decreased expression of HSPA4 mRNA CTD PMID:20971185 and PMID:24690739 Hspa4 Rat copper(0) multiple interactions ISO HSPA4 (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in decreased expression of HSPA4 mRNA and [NSC 689534 binds to Copper] which results in decreased expression of HSPA4 mRNA CTD PMID:20971185 and PMID:24690739 Hspa4 Rat curcumin increases expression ISO HSPA4 (Homo sapiens) 6480464 Curcumin results in increased expression of HSPA4 mRNA and Curcumin results in increased expression of HSPA4 protein CTD PMID:11322385 Hspa4 Rat cyclosporin A increases expression ISO HSPA4 (Homo sapiens) 6480464 Cyclosporine results in increased expression of HSPA4 mRNA CTD PMID:20106945 and PMID:25562108 Hspa4 Rat DDT decreases expression EXP 6480464 DDT results in decreased expression of HSPA4 mRNA CTD PMID:19797855 Hspa4 Rat deguelin increases expression ISO HSPA4 (Homo sapiens) 6480464 deguelin results in increased expression of HSPA4 mRNA CTD PMID:33512557 Hspa4 Rat diarsenic trioxide multiple interactions ISO HSPA4 (Homo sapiens) 6480464 Atrazine inhibits the reaction [Arsenic Trioxide results in increased expression of HSPA4 mRNA] CTD PMID:11678611 Hspa4 Rat diarsenic trioxide increases expression ISO HSPA4 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of HSPA4 mRNA and Arsenic Trioxide results in increased expression of HSPA4 protein CTD PMID:11678611 more ... Hspa4 Rat Dibutyl phosphate affects expression ISO HSPA4 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of HSPA4 mRNA CTD PMID:37042841 Hspa4 Rat disulfiram multiple interactions ISO HSPA4 (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in decreased expression of HSPA4 mRNA CTD PMID:24690739 Hspa4 Rat dorsomorphin multiple interactions ISO HSPA4 (Homo sapiens) 6480464 [NOG protein co-treated with methylmercuric chloride co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of HSPA4 mRNA CTD PMID:27188386 Hspa4 Rat doxorubicin multiple interactions ISO HSPA4 (Homo sapiens) 6480464 [geldanamycin results in increased expression of HSPA4 protein] which results in decreased susceptibility to Doxorubicin and [tanespimycin results in increased expression of HSPA4 protein] which results in decreased susceptibility to Doxorubicin CTD PMID:16311509 Hspa4 Rat doxorubicin increases expression ISO HSPA4 (Homo sapiens) 6480464 Doxorubicin results in increased expression of HSPA4 mRNA CTD PMID:29803840 Hspa4 Rat elemental selenium multiple interactions ISO HSPA4 (Homo sapiens) 6480464 [Selenium co-treated with Vitamin E] results in increased expression of HSPA4 mRNA CTD PMID:19244175 Hspa4 Rat enzyme inhibitor multiple interactions ISO HSPA4 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of HSPA4 protein CTD PMID:23301498 Hspa4 Rat ethanol decreases expression EXP 6480464 Ethanol results in decreased expression of HSPA4 protein CTD PMID:23702218 Hspa4 Rat ethanol affects splicing ISO Hspa4 (Mus musculus) 6480464 Ethanol affects the splicing of HSPA4 mRNA CTD PMID:30319688 Hspa4 Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of HSPA4 mRNA CTD PMID:24136188 Hspa4 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of HSPA4 mRNA CTD PMID:24136188 Hspa4 Rat folic acid multiple interactions ISO Hspa4 (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of HSPA4 mRNA] CTD PMID:22206623 Hspa4 Rat formaldehyde decreases expression ISO HSPA4 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of HSPA4 mRNA CTD PMID:23649840 Hspa4 Rat FR900359 increases phosphorylation ISO HSPA4 (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of HSPA4 protein CTD PMID:37730182 Hspa4 Rat fulvestrant decreases expression ISO HSPA4 (Homo sapiens) 6480464 fulvestrant results in decreased expression of HSPA4 mRNA CTD PMID:16514628 Hspa4 Rat furfural multiple interactions ISO HSPA4 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of HSPA4 protein CTD PMID:38598786 Hspa4 Rat gamma-hexachlorocyclohexane increases expression EXP 6480464 Hexachlorocyclohexane results in increased expression of HSPA4 protein CTD PMID:30248393 Hspa4 Rat geldanamycin increases expression ISO HSPA4 (Homo sapiens) 6480464 geldanamycin results in increased expression of HSPA4 mRNA and geldanamycin results in increased expression of HSPA4 protein CTD PMID:16311509 and PMID:26705709 Hspa4 Rat geldanamycin multiple interactions ISO HSPA4 (Homo sapiens) 6480464 [geldanamycin results in increased expression of HSPA4 protein] which results in decreased susceptibility to Doxorubicin CTD PMID:16311509 Hspa4 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of HSPA4 mRNA CTD PMID:33387578 Hspa4 Rat glyphosate decreases expression ISO Hspa4 (Mus musculus) 6480464 Glyphosate results in decreased expression of HSPA4 protein CTD PMID:37208198 Hspa4 Rat gold atom multiple interactions ISO Hspa4 (Mus musculus) 6480464 [Gold co-treated with Polyethylene Glycols] results in decreased expression of HSPA4 mRNA CTD PMID:19695318 Hspa4 Rat gold(0) multiple interactions ISO Hspa4 (Mus musculus) 6480464 [Gold co-treated with Polyethylene Glycols] results in decreased expression of HSPA4 mRNA CTD PMID:19695318 Hspa4 Rat isobutyl nitrite increases expression ISO Hspa4 (Mus musculus) 6480464 isobutyl nitrite results in increased expression of HSPA4 mRNA CTD PMID:16288974 Hspa4 Rat ivermectin multiple interactions ISO HSPA4 (Homo sapiens) 6480464 [Ivermectin co-treated with Albendazole] results in increased expression of HSPA4 mRNA CTD PMID:16861626 Hspa4 Rat ivermectin decreases expression ISO HSPA4 (Homo sapiens) 6480464 Ivermectin results in decreased expression of HSPA4 protein CTD PMID:32959892 Hspa4 Rat linalool increases expression ISO HSPA4 (Homo sapiens) 6480464 linalool results in increased expression of HSPA4 mRNA CTD PMID:19922762 Hspa4 Rat lycopene multiple interactions EXP 6480464 lycopene inhibits the reaction [decamethrin results in increased expression of HSPA4 mRNA] CTD PMID:23076637 Hspa4 Rat manganese(II) sulfate increases expression EXP 6480464 manganese sulfate results in increased expression of HSPA4 mRNA CTD PMID:26097037 Hspa4 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of HSPA4 mRNA CTD PMID:30047161 Hspa4 Rat methotrexate affects expression ISO Hspa4 (Mus musculus) 6480464 Methotrexate affects the expression of HSPA4 mRNA CTD PMID:18502557 Hspa4 Rat methotrexate increases expression ISO HSPA4 (Homo sapiens) 6480464 Methotrexate results in increased expression of HSPA4 mRNA CTD PMID:17400583 Hspa4 Rat methyl methanesulfonate decreases expression ISO HSPA4 (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of HSPA4 mRNA CTD PMID:23649840 Hspa4 Rat methylmercury chloride increases expression ISO HSPA4 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of HSPA4 mRNA CTD PMID:23179753 more ... Hspa4 Rat methylmercury chloride multiple interactions ISO HSPA4 (Homo sapiens) 6480464 [NOG protein co-treated with methylmercuric chloride co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of HSPA4 mRNA CTD PMID:27188386 Hspa4 Rat methylparaben decreases expression ISO HSPA4 (Homo sapiens) 6480464 methylparaben results in decreased expression of HSPA4 mRNA CTD PMID:31745603 Hspa4 Rat Mitotane increases expression EXP 6480464 Mitotane analog results in increased expression of HSPA4 mRNA CTD PMID:23485034 Hspa4 Rat motexafin gadolinium increases expression ISO HSPA4 (Homo sapiens) 6480464 motexafin gadolinium results in increased expression of HSPA4 mRNA CTD PMID:16357179 Hspa4 Rat motexafin gadolinium multiple interactions ISO HSPA4 (Homo sapiens) 6480464 [Zinc Acetate co-treated with motexafin gadolinium] results in increased expression of HSPA4 mRNA CTD PMID:16357179 Hspa4 Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal multiple interactions ISO Hspa4 (Mus musculus) 6480464 Quercetin inhibits the reaction [benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in increased expression of HSPA4 protein] CTD PMID:15914627 Hspa4 Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal multiple interactions ISO HSPA4 (Homo sapiens) 6480464 HSF1 promotes the reaction [benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in increased expression of HSPA4 mRNA] CTD PMID:30186748 Hspa4 Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal increases expression ISO Hspa4 (Mus musculus) 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in increased expression of HSPA4 protein CTD PMID:15914627 Hspa4 Rat N-nitrosomorpholine increases expression EXP 6480464 N-nitrosomorpholine results in increased expression of HSPA4 protein CTD PMID:19716841 Hspa4 Rat nitrates multiple interactions ISO Hspa4 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of HSPA4 mRNA CTD PMID:35964746 Hspa4 Rat nonanoic acid increases expression ISO Hspa4 (Mus musculus) 6480464 pelargonic acid results in increased expression of HSPA4 mRNA CTD PMID:11379042 Hspa4 Rat Nonidet P-40 increases expression ISO HSPA4 (Homo sapiens) 6480464 Nonidet P-40 results in increased expression of HSPA4 mRNA CTD PMID:26552463 Hspa4 Rat oxidopamine increases expression EXP 6480464 Oxidopamine results in increased expression of HSPA4 mRNA CTD PMID:12486162 Hspa4 Rat paracetamol affects expression ISO Hspa4 (Mus musculus) 6480464 Acetaminophen affects the expression of HSPA4 mRNA CTD PMID:17562736 Hspa4 Rat paracetamol increases expression ISO Hspa4 (Mus musculus) 6480464 Acetaminophen results in increased expression of HSPA4 mRNA CTD PMID:11264010 Hspa4 Rat PCB138 decreases expression EXP 6480464 2 more ... CTD PMID:23829299 Hspa4 Rat pentachlorophenol increases expression ISO Hspa4 (Mus musculus) 6480464 Pentachlorophenol results in increased expression of HSPA4 mRNA CTD PMID:23892564 Hspa4 Rat perfluorooctanoic acid decreases expression ISO HSPA4 (Homo sapiens) 6480464 perfluorooctanoic acid results in decreased expression of HSPA4 protein CTD PMID:22609092 Hspa4 Rat phenethyl isothiocyanate affects binding ISO HSPA4 (Homo sapiens) 6480464 HSPA4 protein binds to phenethyl isothiocyanate CTD PMID:21838287 Hspa4 Rat picoxystrobin increases expression ISO HSPA4 (Homo sapiens) 6480464 picoxystrobin results in increased expression of HSPA4 mRNA CTD PMID:33512557 Hspa4 Rat pirinixic acid decreases expression ISO Hspa4 (Mus musculus) 6480464 pirinixic acid results in decreased expression of HSPA4 mRNA CTD PMID:18445702 Hspa4 Rat pirinixic acid increases expression ISO Hspa4 (Mus musculus) 6480464 pirinixic acid results in increased expression of HSPA4 mRNA CTD PMID:23811191 Hspa4 Rat pirinixic acid multiple interactions ISO Hspa4 (Mus musculus) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in increased expression of HSPA4 mRNA CTD PMID:19710929 Hspa4 Rat progesterone increases expression EXP 6480464 Progesterone results in increased expression of HSPA4 mRNA CTD PMID:16376865 Hspa4 Rat propiconazole increases expression EXP 6480464 propiconazole results in increased expression of HSPA4 mRNA CTD PMID:30047161 Hspa4 Rat Propiverine affects binding EXP 6480464 propiverine binds to HSPA4 protein CTD PMID:29273565 Hspa4 Rat prostaglandin A1 increases metabolic processing ISO Hspa4 (Mus musculus) 6480464 prostaglandin A1 analog results in increased metabolism of HSPA4 protein CTD PMID:19800325 Hspa4 Rat quercetin multiple interactions ISO Hspa4 (Mus musculus) 6480464 Quercetin inhibits the reaction [benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in increased expression of HSPA4 protein] CTD PMID:15914627 Hspa4 Rat quercetin decreases expression ISO HSPA4 (Homo sapiens) 6480464 Quercetin results in decreased expression of HSPA4 mRNA CTD PMID:21632981 Hspa4 Rat raloxifene decreases expression ISO HSPA4 (Homo sapiens) 6480464 Raloxifene Hydrochloride results in decreased expression of HSPA4 mRNA CTD PMID:16514628 Hspa4 Rat resveratrol multiple interactions ISO HSPA4 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of HSPA4 mRNA CTD PMID:23557933 Hspa4 Rat rotenone increases oxidation EXP 6480464 Rotenone results in increased oxidation of HSPA4 protein CTD PMID:30951809 Hspa4 Rat S-butyl-DL-homocysteine (S,R)-sulfoximine increases expression EXP 6480464 Buthionine Sulfoximine results in increased expression of HSPA4 protein CTD PMID:23736079 Hspa4 Rat sarin decreases expression ISO HSPA4 (Homo sapiens) 6480464 Sarin results in decreased expression of HSPA4 mRNA CTD PMID:19522546 Hspa4 Rat sarin increases expression ISO HSPA4 (Homo sapiens) 6480464 Sarin results in increased expression of HSPA4 mRNA CTD PMID:19522546 Hspa4 Rat SB 431542 multiple interactions ISO HSPA4 (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 and PMID:37664457 Hspa4 Rat selenium atom multiple interactions ISO HSPA4 (Homo sapiens) 6480464 [Selenium co-treated with Vitamin E] results in increased expression of HSPA4 mRNA CTD PMID:19244175 Hspa4 Rat serpentine asbestos increases methylation ISO HSPA4 (Homo sapiens) 6480464 Asbestos and Serpentine results in increased methylation of HSPA4 5' UTR CTD PMID:29523930 Hspa4 Rat silicon dioxide affects secretion ISO HSPA4 (Homo sapiens) 6480464 Silicon Dioxide analog affects the secretion of HSPA4 protein CTD PMID:25895662 Hspa4 Rat silicon dioxide increases expression ISO HSPA4 (Homo sapiens) 6480464 Silicon Dioxide results in increased expression of HSPA4 mRNA CTD PMID:25351596 Hspa4 Rat silver atom increases expression ISO HSPA4 (Homo sapiens) 6480464 Silver results in increased expression of HSPA4 mRNA CTD PMID:22036727 Hspa4 Rat silver atom decreases expression ISO Hspa4 (Mus musculus) 6480464 Silver results in decreased expression of HSPA4 mRNA CTD PMID:27131904 Hspa4 Rat silver(0) increases expression ISO HSPA4 (Homo sapiens) 6480464 Silver results in increased expression of HSPA4 mRNA CTD PMID:22036727 Hspa4 Rat silver(0) decreases expression ISO Hspa4 (Mus musculus) 6480464 Silver results in decreased expression of HSPA4 mRNA CTD PMID:27131904 Hspa4 Rat simvastatin increases expression ISO HSPA4 (Homo sapiens) 6480464 Simvastatin results in increased expression of HSPA4 protein CTD PMID:16375908 Hspa4 Rat sodium arsenite multiple interactions ISO HSPA4 (Homo sapiens) 6480464 2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one inhibits the reaction [sodium arsenite results in increased expression of HSPA4 mRNA] more ... CTD PMID:11322385 more ... Hspa4 Rat sodium arsenite decreases expression ISO HSPA4 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of HSPA4 protein CTD PMID:21925251 Hspa4 Rat sodium arsenite increases expression ISO Hspa4 (Mus musculus) 6480464 sodium arsenite results in increased expression of HSPA4 mRNA CTD PMID:16014739 Hspa4 Rat sodium arsenite increases expression ISO HSPA4 (Homo sapiens) 6480464 sodium arsenite results in increased expression of HSPA4 mRNA and sodium arsenite results in increased expression of HSPA4 protein CTD PMID:11322385 more ... Hspa4 Rat sodium chloride multiple interactions ISO HSPA4 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of HSPA4 protein more ... CTD PMID:38598786 Hspa4 Rat Soman increases expression EXP 6480464 Soman results in increased expression of HSPA4 mRNA CTD PMID:19281266 Hspa4 Rat succimer multiple interactions ISO Hspa4 (Mus musculus) 6480464 [Succimer binds to Magnetite Nanoparticles] which results in decreased expression of HSPA4 mRNA CTD PMID:21641980 Hspa4 Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of HSPA4 mRNA CTD PMID:30047161 Hspa4 Rat sulforaphane affects binding ISO HSPA4 (Homo sapiens) 6480464 HSPA4 protein binds to sulforaphane CTD PMID:21838287 Hspa4 Rat T-2 toxin affects expression EXP 6480464 T-2 Toxin affects the expression of HSPA4 protein CTD PMID:26141394 Hspa4 Rat tamoxifen affects expression ISO Hspa4 (Mus musculus) 6480464 Tamoxifen affects the expression of HSPA4 mRNA CTD PMID:17555576 Hspa4 Rat tanespimycin multiple interactions ISO HSPA4 (Homo sapiens) 6480464 [tanespimycin results in increased expression of HSPA4 protein] which results in decreased susceptibility to Doxorubicin CTD PMID:16311509 Hspa4 Rat tanespimycin increases expression ISO HSPA4 (Homo sapiens) 6480464 tanespimycin results in increased expression of HSPA4 protein CTD PMID:16311509 Hspa4 Rat tert-butyl hydroperoxide increases expression ISO HSPA4 (Homo sapiens) 6480464 tert-Butylhydroperoxide results in increased expression of HSPA4 mRNA CTD PMID:15336504 Hspa4 Rat testosterone enanthate affects expression ISO HSPA4 (Homo sapiens) 6480464 testosterone enanthate affects the expression of HSPA4 mRNA CTD PMID:17440010 Hspa4 Rat tetrachloromethane affects expression EXP 6480464 Carbon Tetrachloride affects the expression of HSPA4 mRNA CTD PMID:15963342 Hspa4 Rat tetrachloromethane increases expression ISO Hspa4 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of HSPA4 mRNA CTD PMID:31919559 Hspa4 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of HSPA4 mRNA CTD PMID:31150632 Hspa4 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of HSPA4 mRNA] CTD PMID:31150632 Hspa4 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of HSPA4 mRNA CTD PMID:23411599 and PMID:34492290 Hspa4 Rat thiostrepton increases expression ISO HSPA4 (Homo sapiens) 6480464 Thiostrepton results in increased expression of HSPA4 mRNA CTD PMID:22321511 Hspa4 Rat thiram increases expression ISO HSPA4 (Homo sapiens) 6480464 Thiram results in increased expression of HSPA4 mRNA CTD PMID:38568856 Hspa4 Rat titanium dioxide decreases expression ISO HSPA4 (Homo sapiens) 6480464 titanium dioxide results in decreased expression of HSPA4 mRNA CTD PMID:19695317 Hspa4 Rat titanium dioxide increases methylation ISO Hspa4 (Mus musculus) 6480464 titanium dioxide results in increased methylation of HSPA4 gene CTD PMID:35295148 Hspa4 Rat titanium dioxide decreases methylation ISO Hspa4 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of HSPA4 promoter CTD PMID:35295148 Hspa4 Rat toluene 2,4-diisocyanate decreases expression ISO Hspa4 (Mus musculus) 6480464 Toluene 2 and 4-Diisocyanate results in decreased expression of HSPA4 mRNA CTD PMID:11379042 Hspa4 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of HSPA4 mRNA CTD PMID:33387578 Hspa4 Rat trimellitic anhydride increases expression ISO Hspa4 (Mus musculus) 6480464 trimellitic anhydride results in increased expression of HSPA4 mRNA CTD PMID:19042947 Hspa4 Rat triphenyl phosphate affects expression ISO HSPA4 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of HSPA4 mRNA CTD PMID:37042841 Hspa4 Rat troglitazone increases expression ISO HSPA4 (Homo sapiens) 6480464 troglitazone results in increased expression of HSPA4 mRNA CTD PMID:19631733 Hspa4 Rat tunicamycin decreases expression ISO HSPA4 (Homo sapiens) 6480464 Tunicamycin results in decreased expression of HSPA4 mRNA CTD PMID:29453283 Hspa4 Rat valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of HSPA4 mRNA CTD PMID:21318169 Hspa4 Rat valproic acid affects expression ISO HSPA4 (Homo sapiens) 6480464 Valproic Acid affects the expression of HSPA4 mRNA CTD PMID:25979313 Hspa4 Rat valproic acid increases expression ISO HSPA4 (Homo sapiens) 6480464 Valproic Acid results in increased expression of HSPA4 mRNA CTD PMID:23179753 Hspa4 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of HSPA4 mRNA CTD PMID:20566332 Hspa4 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of HSPA4 mRNA CTD PMID:23034163 Hspa4 Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of HSPA4 mRNA CTD PMID:19015723 Hspa4 Rat vitamin E multiple interactions ISO HSPA4 (Homo sapiens) 6480464 [Selenium co-treated with Vitamin E] results in increased expression of HSPA4 mRNA CTD PMID:19244175 Hspa4 Rat vitamin E increases expression ISO HSPA4 (Homo sapiens) 6480464 Vitamin E results in increased expression of HSPA4 mRNA CTD PMID:19244175 Hspa4 Rat vorinostat decreases expression ISO HSPA4 (Homo sapiens) 6480464 vorinostat results in decreased expression of HSPA4 protein CTD PMID:17593366 Hspa4 Rat zearalenone decreases expression ISO Hspa4 (Mus musculus) 6480464 Zearalenone results in decreased expression of HSPA4 protein CTD PMID:25058043 Hspa4 Rat zinc acetate multiple interactions ISO HSPA4 (Homo sapiens) 6480464 [Zinc Acetate co-treated with motexafin gadolinium] results in increased expression of HSPA4 mRNA CTD PMID:16357179 Hspa4 Rat zinc acetate increases expression ISO HSPA4 (Homo sapiens) 6480464 Zinc Acetate results in increased expression of HSPA4 mRNA CTD PMID:16357179 Hspa4 Rat zinc atom multiple interactions ISO HSPA4 (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of HSPA4 mRNA CTD PMID:18593933 Hspa4 Rat zinc pyrithione increases expression ISO HSPA4 (Homo sapiens) 6480464 pyrithione zinc results in increased expression of HSPA4 mRNA CTD PMID:21424779 Hspa4 Rat zinc sulfate decreases expression ISO HSPA4 (Homo sapiens) 6480464 Zinc Sulfate results in decreased expression of HSPA4 mRNA CTD PMID:12756304 Hspa4 Rat zinc(0) multiple interactions ISO HSPA4 (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of HSPA4 mRNA CTD PMID:18593933
Imported Annotations - KEGG (archival)
(+)-schisandrin B (EXP) (-)-epigallocatechin 3-gallate (ISO) 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (EXP,ISO) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 1-naphthyl isothiocyanate (ISO) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (EXP,ISO) 1H-pyrazole (ISO) 2,2',5,5'-tetrachlorobiphenyl (EXP) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (EXP,ISO) 2,4-dinitrotoluene (EXP) 2,6-dimethoxyphenol (ISO) 3,3'-Dichlorobenzidine (ISO) 3H-1,2-dithiole-3-thione (EXP) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) 4-(ethoxymethylene)-2-phenyloxazol-5-one (ISO) 5-fluorouracil (ISO) 6-propyl-2-thiouracil (EXP) acrylamide (ISO) afimoxifene (ISO) aflatoxin B1 (ISO) albendazole (ISO) all-trans-retinoic acid (ISO) amitrole (EXP) ammonium chloride (EXP) amphibole asbestos (ISO) aristolochic acid A (ISO) Aroclor 1254 (EXP,ISO) arsane (ISO) arsenic atom (ISO) arsenous acid (ISO) atrazine (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bexarotene (EXP) bis(2-chloroethyl) sulfide (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (EXP) cadmium atom (ISO) cadmium dichloride (ISO) caffeine (ISO) calciol (ISO) cannabidiol (ISO) carbon nanotube (ISO) carbonyl cyanide p-trifluoromethoxyphenylhydrazone (ISO) casticin (ISO) chloropicrin (ISO) chlorpyrifos (ISO) clofibrate (ISO) clotrimazole (EXP) cobalt dichloride (ISO) copper atom (ISO) copper(0) (ISO) curcumin (ISO) cyclosporin A (ISO) DDT (EXP) deguelin (ISO) diarsenic trioxide (ISO) Dibutyl phosphate (ISO) disulfiram (ISO) dorsomorphin (ISO) doxorubicin (ISO) elemental selenium (ISO) enzyme inhibitor (ISO) ethanol (EXP,ISO) finasteride (EXP) flutamide (EXP) folic acid (ISO) formaldehyde (ISO) FR900359 (ISO) fulvestrant (ISO) furfural (ISO) gamma-hexachlorocyclohexane (EXP) geldanamycin (ISO) gentamycin (EXP) glyphosate (ISO) gold atom (ISO) gold(0) (ISO) isobutyl nitrite (ISO) ivermectin (ISO) linalool (ISO) lycopene (EXP) manganese(II) sulfate (EXP) methimazole (EXP) methotrexate (ISO) methyl methanesulfonate (ISO) methylmercury chloride (ISO) methylparaben (ISO) Mitotane (EXP) motexafin gadolinium (ISO) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO) N-nitrosomorpholine (EXP) nitrates (ISO) nonanoic acid (ISO) Nonidet P-40 (ISO) oxidopamine (EXP) paracetamol (ISO) PCB138 (EXP) pentachlorophenol (ISO) perfluorooctanoic acid (ISO) phenethyl isothiocyanate (ISO) picoxystrobin (ISO) pirinixic acid (ISO) progesterone (EXP) propiconazole (EXP) Propiverine (EXP) prostaglandin A1 (ISO) quercetin (ISO) raloxifene (ISO) resveratrol (ISO) rotenone (EXP) S-butyl-DL-homocysteine (S,R)-sulfoximine (EXP) sarin (ISO) SB 431542 (ISO) selenium atom (ISO) serpentine asbestos (ISO) silicon dioxide (ISO) silver atom (ISO) silver(0) (ISO) simvastatin (ISO) sodium arsenite (ISO) sodium chloride (ISO) Soman (EXP) succimer (ISO) sulfadimethoxine (EXP) sulforaphane (ISO) T-2 toxin (EXP) tamoxifen (ISO) tanespimycin (ISO) tert-butyl hydroperoxide (ISO) testosterone enanthate (ISO) tetrachloromethane (EXP,ISO) thioacetamide (EXP) thiostrepton (ISO) thiram (ISO) titanium dioxide (ISO) toluene 2,4-diisocyanate (ISO) trichloroethene (EXP) trimellitic anhydride (ISO) triphenyl phosphate (ISO) troglitazone (ISO) tunicamycin (ISO) valproic acid (EXP,ISO) vinclozolin (EXP) vitamin E (ISO) vorinostat (ISO) zearalenone (ISO) zinc acetate (ISO) zinc atom (ISO) zinc pyrithione (ISO) zinc sulfate (ISO) zinc(0) (ISO)
1.
Black currant phytoconstituents exert chemoprevention of diethylnitrosamine-initiated hepatocarcinogenesis by suppression of the inflammatory response.
Bishayee A, etal., Mol Carcinog. 2011 Dec 27. doi: 10.1002/mc.21860.
2.
Convergent sets of data from in vivo and in vitro methods point to an active role of Hsp60 in chronic obstructive pulmonary disease pathogenesis.
Cappello F, etal., PLoS One. 2011;6(11):e28200. Epub 2011 Nov 28.
3.
Administration of carnosine in the treatment of acute spinal cord injury.
Di Paola R, etal., Biochem Pharmacol. 2011 Nov 15;82(10):1478-89. Epub 2011 Jul 20.
4.
Short-term follow-up of chagasic patients after benznidazole treatment using multiple serological markers.
Fernandez-Villegas A, etal., BMC Infect Dis. 2011 Jul 31;11:206.
5.
BAG3 protein is overexpressed in human glioblastoma and is a potential target for therapy.
Festa M, etal., Am J Pathol. 2011 Jun;178(6):2504-12. Epub 2011 May 10.
6.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
7.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
8.
Elevated HSP27, HSP70 and HSP90 alpha in chronic obstructive pulmonary disease: markers for immune activation and tissue destruction.
Hacker S, etal., Clin Lab. 2009;55(1-2):31-40.
9.
Hsp70 regulates the interaction between the peroxisome targeting signal type 1 (PTS1)-receptor Pex5p and PTS1.
Harano T, etal., Biochem J. 2001 Jul 1;357(Pt 1):157-65.
10.
Riluzole prevents morphine-induced apoptosis in rat cerebral cortex.
Hassanzadeh K, etal., Pharmacol Rep. 2011;63(3):697-707.
11.
Mildronate as a regulator of protein expression in a rat model of Parkinson's disease.
Isajevs S, etal., Medicina (Kaunas). 2011;47(10):552-9.
12.
Heat shock protein 70 is translocated to lipid droplets in rat adipocytes upon heat stimulation.
Jiang H, etal., Biochim Biophys Acta. 2007 Jan;1771(1):66-74. Epub 2006 Nov 15.
13.
Developmental immunolocalization of heat shock protein 70 (HSP70) in epithelial cell of rat kidney.
Kang SS, etal., Histol Histopathol. 2011 Nov;26(11):1363-73.
14.
HSP70 protein promotes survival of C6 and U87 glioma cells by inhibition of ATF5 degradation.
Li G, etal., J Biol Chem. 2011 Jun 10;286(23):20251-9. Epub 2011 Apr 25.
15.
Therapeutic efficacy of trehalose eye drops for treatment of murine dry eye induced by an intelligently controlled environmental system.
Li J, etal., Mol Vis. 2012;18:317-29. Epub 2012 Feb 4.
16.
TLR2 ligand induces protection against cerebral ischemia/reperfusion injury via activation of phosphoinositide 3-kinase/Akt signaling.
Lu C, etal., J Immunol. 2011 Aug 1;187(3):1458-66. Epub 2011 Jun 27.
17.
Initiation but no execution - modulation of peripheral blood lymphocyte apoptosis in rheumatoid arthritis - a potential role for heat shock protein 70.
Moodley D, etal., J Inflamm (Lond). 2011 Nov 3;8(1):30.
18.
The dual behavior of heat shock protein 70 and asymmetric dimethylarginine in relation to serum CRP levels in type 2 diabetes.
Nakhjavani M, etal., Gene. 2012 Feb 13.
19.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
20.
Chaperoning of glucocorticoid receptors.
Pratt WB, etal., Handb Exp Pharmacol. 2006;(172):111-38.
21.
Increase in periosteal angiogenesis through heat shock conditioning.
Rana M, etal., Head Face Med. 2011 Nov 18;7:22.
22.
GOA pipeline
RGD automated data pipeline
23.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
24.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
25.
Role of mitochondria biogenesis in the metabolic memory associated with the continued progression of diabetic retinopathy and its regulation by lipoic acid.
Santos JM and Kowluru RA, Invest Ophthalmol Vis Sci. 2011 Nov 11;52(12):8791-8. Print 2011.
26.
Anti-inflammatory effects of -shogaol: potential roles of HDAC inhibition and HSP70 induction.
Shim S, etal., Food Chem Toxicol. 2011 Nov;49(11):2734-40. Epub 2011 Aug 16.
27.
Minireview: the intersection of steroid receptors with molecular chaperones: observations and questions.
Smith DF and Toft DO, Mol Endocrinol. 2008 Oct;22(10):2229-40. Epub 2008 May 1.
28.
Hyperthermia assists survival of astrocytes from oxidative-mediated necrotic cell death.
Thomas G, etal., Cell Mol Biol (Noisy-le-grand) 2002 Mar;48(2):191-8.
29.
Hsp10, Hsp70, and Hsp90 immunohistochemical levels change in ulcerative colitis after therapy.
Tomasello G, etal., Eur J Histochem. 2011 Oct 24;55(4):e38. doi: 10.4081/ejh.2011.e38.
30.
Hypobaric Hypoxia Preconditioning Attenuates Experimental Heatstroke Syndromes via Preinduction of Heat Shock Protein 70.
Wang LC, etal., Am J Med Sci. 2012 Jan 12.
31.
Adenoviral transfer of HSP-70 into pulmonary epithelium ameliorates experimental acute respiratory distress syndrome.
Weiss YG, etal., J Clin Invest. 2002 Sep;110(6):801-6.
32.
[Effect of benzo pyrene on HSP70 expression in rat cortical neurons in vitro].
Xu G and Zheng J, Wei Sheng Yan Jiu. 2011 Jul;40(4):437-40.
33.
Molecular cloning of a novel member of the HSP110 family of genes, ischemia-responsive protein 94 kDa (irp94), expressed in rat brain after transient forebrain ischemia.
Yagita Y, etal., J Neurochem 1999 Apr;72(4):1544-51.
34.
Altered expression of heat shock protein 110 family members in mouse hippocampal neurons following trimethyltin treatment in vivo and in vitro.
Yoneyama M, etal., Neuropharmacology. 2008 Oct;55(5):693-703. Epub 2008 Jun 13.
35.
Valproic acid-mediated neuroprotection in retinal ischemia injury via histone deacetylase inhibition and transcriptional activation.
Zhang Z, etal., Exp Eye Res. 2012 Jan;94(1):98-108. Epub 2011 Nov 28.
36.
Immunolocalization of Toll-like receptors 2 and 4 as well as their endogenous ligand, heat shock protein 70, in rat traumatic brain injury.
Zhang Z, etal., Neuroimmunomodulation. 2012;19(1):10-9. Epub 2011 Nov 7.
37.
Anti-inflammatory effects of the 70 kDa heat shock protein in experimental stroke.
Zheng Z, etal., J Cereb Blood Flow Metab. 2008 Jan;28(1):53-63. Epub 2007 May 2.
Hspa4 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 37,908,866 - 37,951,994 (-) NCBI GRCr8 mRatBN7.2 10 37,408,025 - 37,449,080 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 37,408,025 - 37,449,001 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 42,101,220 - 42,141,891 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 41,591,248 - 41,631,920 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 37,094,962 - 37,135,636 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 38,601,624 - 38,642,397 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 38,601,624 - 38,642,397 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 38,383,101 - 38,424,016 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 38,705,629 - 38,749,058 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 38,712,058 - 38,755,488 (-) NCBI Celera 10 36,756,477 - 36,796,741 (-) NCBI Celera Cytogenetic Map 10 q22 NCBI
HSPA4 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 5 133,052,013 - 133,106,449 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 5 133,052,013 - 133,106,449 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 5 132,387,705 - 132,442,141 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 5 132,415,561 - 132,468,608 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 5 132,415,560 - 132,468,608 NCBI Celera 5 128,517,326 - 128,569,460 (+) NCBI Celera Cytogenetic Map 5 q31.1 NCBI HuRef 5 127,579,243 - 127,632,290 (+) NCBI HuRef CHM1_1 5 131,820,919 - 131,874,036 (+) NCBI CHM1_1 T2T-CHM13v2.0 5 133,562,175 - 133,626,191 (+) NCBI T2T-CHM13v2.0
Hspa4 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 53,150,641 - 53,191,306 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 53,150,641 - 53,191,284 (-) Ensembl GRCm39 Ensembl GRCm38 11 53,259,814 - 53,300,479 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 53,259,814 - 53,300,457 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 53,073,316 - 53,113,981 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 53,104,997 - 53,143,812 (-) NCBI MGSCv36 mm8 Celera 11 57,839,531 - 57,880,195 (-) NCBI Celera Cytogenetic Map 11 B1.3 NCBI cM Map 11 31.91 NCBI
Hspa4 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955408 4,379,825 - 4,423,381 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955408 4,379,825 - 4,422,710 (+) NCBI ChiLan1.0 ChiLan1.0
HSPA4 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 4 128,358,202 - 128,410,864 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 5 126,497,801 - 126,552,375 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 5 128,463,186 - 128,517,563 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 5 134,619,076 - 134,673,658 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 5 134,619,076 - 134,673,658 (+) Ensembl panpan1.1 panPan2
HSPA4 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 11 21,290,603 - 21,363,701 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 11 21,290,621 - 21,505,122 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 11 20,116,763 - 20,164,574 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 11 22,073,430 - 22,146,303 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 11 22,073,445 - 22,146,281 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 11 20,814,567 - 20,862,388 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 11 20,662,175 - 20,709,970 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 11 21,304,890 - 21,352,758 (+) NCBI UU_Cfam_GSD_1.0
Hspa4 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024407213 115,084,886 - 115,130,573 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936647 2,087,604 - 2,133,355 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936647 2,087,650 - 2,133,343 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
HSPA4 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 2 135,345,867 - 135,391,108 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 2 135,345,724 - 135,391,112 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 2 140,866,335 - 140,911,632 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
HSPA4 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 23 35,862,817 - 35,917,490 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 23 35,862,814 - 35,918,287 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666034 42,023,595 - 42,078,723 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Hspa4
.
Confirmed Target Of
Mir1 rno-miR-1-3p Mirtarbase external_info qRT-PCR//Western blot Functional MTI 17715156
Predicted Target Of
Count of predictions: 197 Count of miRNA genes: 141 Interacting mature miRNAs: 167 Transcripts: ENSRNOT00000023628 Prediction methods: Miranda, Targetscan Result types: miRGate_prediction
61441 Btemp1 Thermal response to stress QTL 1 4 body temperature trait (VT:0005535) core body temperature (CMO:0001036) 10 35392457 63642539 Rat 9589136 Insul27 Insulin level QTL 27 10.46 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 10 11474010 56474010 Rat 152025229 Scl83 Serum cholesterol level QTL 83 4.33 blood cholesterol amount (VT:0000180) 10 35710580 68663659 Rat 1578779 Tcas10 Tongue tumor susceptibility QTL 10 3.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 10 31297439 76297439 Rat 631564 Apr3 Acute phase response QTL 3 3.9 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 10 15275955 60275955 Rat 1298069 Bp168 Blood pressure QTL 168 5.5 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 10 26521957 98003205 Rat 631554 Bp133 Blood pressure QTL 133 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 743364 63851208 Rat 631557 Bp136 Blood pressure QTL 136 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 30632053 75632053 Rat 61325 Aia5 Adjuvant induced arthritis QTL 5 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1578761 Stresp21 Stress response QTL 21 3.3 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 10 6375746 51375746 Rat 2298544 Neuinf9 Neuroinflammation QTL 9 4.6 nervous system integrity trait (VT:0010566) spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126) 10 5801990 62146030 Rat 61332 Eau3 Experimental allergic uveoretinitis QTL 3 0.004 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 10 34490559 45579777 Rat 10401803 Kidm50 Kidney mass QTL 50 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 10 418344 45418344 Rat 1554317 Bmd4 Bone mineral density QTL 4 9.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 19816042 99406971 Rat 1598852 Anxrr19 Anxiety related response QTL 19 5.07 body movement coordination trait (VT:0005424) number of rearing movements in an experimental apparatus (CMO:0001752) 10 18167841 63167841 Rat 1581497 Esta1 Estrogen-induced thymic atrophy QTL 1 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 10 21329805 61345413 Rat 2313095 Bss62 Bone structure and strength QTL 62 1.5 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 10 5387014 50387014 Rat 724527 Bp148 Blood pressure QTL 148 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 28453136 73453136 Rat 1358897 Stresp6 Stress response QTL 6 4.17 0.022 blood norepinephrine amount (VT:0005663) plasma norepinephrine level (CMO:0001010) 10 35392267 64155584 Rat 1331762 Rf40 Renal function QTL 40 3.873 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 10 29299504 64155584 Rat 2300171 Bmd58 Bone mineral density QTL 58 4.9 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 26944628 71944628 Rat 61354 Pia10 Pristane induced arthritis QTL 10 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2301967 Cm73 Cardiac mass QTL 73 4.55 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 10 14487011 89062041 Rat 2303118 Mamtr7 Mammary tumor resistance QTL 7 0.003 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 9658275 104670812 Rat 2313104 Bss61 Bone structure and strength QTL 61 0.9 0.0001 tibia area (VT:1000281) tibia midshaft cross-sectional area (CMO:0001717) 10 5387014 50387014 Rat 9590310 Scort19 Serum corticosterone level QTL 19 6.3 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 11474010 56474010 Rat 10402859 Bp381 Blood pressure QTL 381 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 2316949 Gluco60 Glucose level QTL 60 3.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 14487011 107057807 Rat 6893352 Bw100 Body weight QTL 100 0.33 0.6 body mass (VT:0001259) body weight (CMO:0000012) 1 15906665 60906665 Rat 724556 Pur2 Proteinuria QTL 2 5.5 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 10 22427500 90627625 Rat 8662860 Vetf10 Vascular elastic tissue fragility QTL 10 artery integrity trait (VT:0010639) number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562) 10 6154182 73453136 Rat 2313066 Bss63 Bone structure and strength QTL 63 1.4 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 10 5387014 50387014 Rat 2313064 Bmd71 Bone mineral density QTL 71 0.9 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 10 5387014 50387014 Rat 70223 Bp57 Blood pressure QTL 57 5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 1 80676123 Rat 1354587 Kidm21 Kidney mass QTL 21 3.3 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 10 15028513 60430477 Rat 6893350 Bw99 Body weight QTL 99 0.87 0.16 body mass (VT:0001259) body weight (CMO:0000012) 1 15906665 60906665 Rat 70224 Eae3 Experimental allergic encephalomyelitis QTL 3 4.1 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 10 26521957 61345413 Rat 2313081 Bss64 Bone structure and strength QTL 64 1.3 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 10 5387014 50387014 Rat 1331791 Cm31 Cardiac mass QTL 31 3.84606 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 29299504 107211142 Rat 2313087 Bmd80 Bone mineral density QTL 80 3.2 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 10 19606483 64606483 Rat 634327 Hc4 Hypercalciuria QTL 4 2.4 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 10 1 38328221 Rat 1354614 Hpcl1 Hepatic cholesterol level QTL 1 3.3 liver cholesterol amount (VT:0010498) liver cholesterol level (CMO:0001597) 10 35392267 51793994 Rat 631532 Cm50 Cardiac mass QTL 50 6.6 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 10 17907113 51786432 Rat 1576319 Cia29 Collagen induced arthritis QTL 29 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 33973921 78973921 Rat 7411611 Foco17 Food consumption QTL 17 18.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 10 1 42315980 Rat 631267 Cia20 Collagen induced arthritis QTL 20 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1600371 Mcs21 Mammary carcinoma susceptibility QTL 21 3 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 28875650 52200160 Rat 631268 Cia21 Collagen induced arthritis QTL 21 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 14487011 104060283 Rat 9590268 Scort13 Serum corticosterone level QTL 13 3.26 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 11474010 56474010 Rat 1576311 Pia26 Pristane induced arthritis QTL 26 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 31224026 75632053 Rat 61427 Cia16 Collagen induced arthritis QTL 16 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 6357896 96121100 Rat 2292441 Bp308 Blood pressure QTL 308 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 2313055 Bw96 Body weight QTL 96 3.6 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 10 19606483 64606483 Rat 631542 Bp82 Blood pressure QTL 82 6.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 26521957 98952741 Rat
AW535242
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 37,427,084 - 37,427,272 (+) MAPPER mRatBN7.2 Rnor_6.0 10 38,620,867 - 38,621,054 NCBI Rnor6.0 Rnor_5.0 10 38,402,344 - 38,402,531 UniSTS Rnor5.0 RGSC_v3.4 10 38,726,246 - 38,726,433 UniSTS RGSC3.4 Celera 10 36,775,119 - 36,775,306 UniSTS RH 3.4 Map 10 403.4 UniSTS Cytogenetic Map 10 q22 UniSTS
RH65703
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 37,419,445 - 37,420,560 (+) MAPPER mRatBN7.2 Rnor_6.0 10 38,613,230 - 38,614,344 NCBI Rnor6.0 Rnor_5.0 10 38,394,707 - 38,395,821 UniSTS Rnor5.0 RGSC_v3.4 10 38,717,051 - 38,718,165 UniSTS RGSC3.4 Cytogenetic Map 10 q22 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000023628 ⟹ ENSRNOP00000023628
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 37,408,025 - 37,449,001 (-) Ensembl Rnor_6.0 Ensembl 10 38,601,624 - 38,642,397 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000094819 ⟹ ENSRNOP00000082426
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 37,408,025 - 37,449,001 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000111861 ⟹ ENSRNOP00000091981
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 37,408,025 - 37,439,941 (-) Ensembl
RefSeq Acc Id:
NM_153629 ⟹ NP_705893
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 37,908,866 - 37,949,835 (-) NCBI mRatBN7.2 10 37,408,025 - 37,449,001 (-) NCBI Rnor_6.0 10 38,601,624 - 38,642,397 (-) NCBI Rnor_5.0 10 38,383,101 - 38,424,016 (-) NCBI RGSC_v3.4 10 38,705,629 - 38,749,058 (-) RGD Celera 10 36,756,477 - 36,796,741 (-) RGD
Sequence:
CGGCGCCTCTTCTGCGGCCGTGGAGCCGGAGCCGGCCTGAGCGGTAGAGGCCCGTCTTTTTCAAGGACCCAAGCATCCTCGTGGACGGTCGTCCGGCTTCGCCCGCCCAGCCGCGGTGCTCCATCAGC
hide sequence
RefSeq Acc Id:
XM_039085314 ⟹ XP_038941242
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 37,908,866 - 37,951,994 (-) NCBI mRatBN7.2 10 37,409,756 - 37,449,080 (-) NCBI
RefSeq Acc Id:
NP_705893 ⟸ NM_153629
- UniProtKB:
O88600 (UniProtKB/Swiss-Prot), F1LRV4 (UniProtKB/TrEMBL)
- Sequence:
MSVVGIDLGFQSCYVAVARAGGIETIANEYSDRCTPACVSFGPKNRSVGAAAKSQVISNAKNTVQGFKRFHGRAFSDPFVEAEKSNLAYDIVQLPTGLTGIKVTYMEEERNFTTEQVTAMLLSKLKET
hide sequence
Ensembl Acc Id:
ENSRNOP00000023628 ⟸ ENSRNOT00000023628
RefSeq Acc Id:
XP_038941242 ⟸ XM_039085314
- Peptide Label:
isoform X1
- UniProtKB:
F1LRV4 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000082426 ⟸ ENSRNOT00000094819
Ensembl Acc Id:
ENSRNOP00000091981 ⟸ ENSRNOT00000111861
RGD ID: 13697173 Promoter ID: EPDNEW_R7697 Type: initiation region Name: Hspa4_1 Description: heat shock protein family A member 4 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 10 38,642,420 - 38,642,480 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2019-04-10
Hspa4
heat shock protein family A (Hsp70) member 4
Hspa4
heat shock protein family A member 4
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2016-02-25
Hspa4
heat shock protein family A member 4
Hspa4
heat shock protein 4
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-01-20
Hspa4
heat shock protein 4
heat shock 70 kDa protein 4
Name updated
1299863 APPROVED
2003-02-27
Hspa4
heat shock 70 kDa protein 4
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_regulation
expression is increased following exposure to elevated temperatures
633151
