Ppp1ca (protein phosphatase 1 catalytic subunit alpha)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) RatMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Ppp1ca (protein phosphatase 1 catalytic subunit alpha) Rattus norvegicus

Analyze

Symbol:

Ppp1ca

Name:

protein phosphatase 1 catalytic subunit alpha

RGD ID:

3375

Description:

Enables phosphoprotein phosphatase activity; protein phosphatase 1 binding activity; and ribonucleoprotein complex binding activity. Involved in protein dephosphorylation; regulation of glycogen metabolic process; and response to lead ion. Located in several cellular components, including dendritic spine; glycogen granule; and perikaryon. Part of protein phosphatase type 1 complex. Is active in glutamatergic synapse; postsynapse; and presynapse. Orthologous to human PPP1CA (protein phosphatase 1 catalytic subunit alpha); PARTICIPATES IN glycogen biosynthetic pathway; glycogen degradation pathway; adenosine monophosphate-activated protein kinase (AMPK) signaling pathway; INTERACTS WITH 1,3-dinitrobenzene; 2,3,7,8-tetrachlorodibenzodioxine; ammonium chloride.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

PP-1A; PP1alpha; protein phosphatase 1, catalytic subunit, alpha; protein phosphatase 1, catalytic subunit, alpha isoform; protein phosphatase 1, catalytic subunit, alpha isozyme; Protein phosphatase type 1 alpha catalytic subunit; Protein phosphatase type 1 alpha, catalytic subunit; protein phosphatase-1d; serine/threonine-protein phosphatase PP1-alpha catalytic subunit

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	1	201,485,117 - 201,488,734 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	201,485,085 - 201,497,327 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	209,837,354 - 209,840,969 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	1	216,930,585 - 216,934,202 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	1	209,621,601 - 209,625,218 (+)	NCBI	Rnor_WKY
Rnor_6.0	1	219,439,953 - 219,443,570 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	219,439,953 - 219,443,570 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	226,310,604 - 226,314,221 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	206,774,719 - 206,778,336 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	206,928,171 - 206,931,789 (+)	NCBI
Celera	1	199,029,483 - 199,033,100 (+)	NCBI		Celera
Cytogenetic Map	1	q43	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

congestive heart failure (ISO)

dilated cardiomyopathy (ISO)

familial temporal lobe epilepsy 8 (ISO)

intellectual disability (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (ISO)

(S)-colchicine (ISO)

1,3-dinitrobenzene (EXP)

1-chloro-2,4-dinitrobenzene (ISO)

14-Deoxy-11,12-didehydroandrographolide (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,6-tribromophenol (ISO)

3,3',5,5'-tetrabromobisphenol A (ISO)

3,4-methylenedioxymethamphetamine (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4-hydroxynon-2-enal (ISO)

5-fluorouracil (ISO)

amiloride (ISO)

aminoglutethimide (ISO)

ammonium chloride (EXP)

ampicillin (EXP)

arachidonic acid (ISO)

Aroclor 1254 (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

caffeine (ISO)

calcium atom (EXP)

calcium(0) (EXP)

cannabidiol (ISO)

carbon nanotube (ISO)

choline (ISO)

clobetasol (ISO)

cobalt dichloride (ISO)

cocaine (ISO)

curcumin (EXP)

cyhalothrin (EXP)

decabromodiphenyl ether (ISO)

dexamethasone (ISO)

diarsenic trioxide (ISO)

dioxygen (ISO)

doxorubicin (ISO)

elemental selenium (ISO)

endosulfan (EXP)

flavonoids (EXP)

folic acid (ISO)

gentamycin (EXP)

hyaluronic acid (EXP)

hydrogen peroxide (EXP,ISO)

ibuprofen (ISO)

indometacin (ISO)

ivermectin (ISO)

L-methionine (ISO)

lead diacetate (EXP)

lead(0) (ISO)

lead(2+) (ISO)

lovastatin (ISO)

metronidazole (EXP)

neomycin (EXP)

okadaic acid (EXP,ISO)

paracetamol (ISO)

paraquat (ISO)

perfluorooctane-1-sulfonic acid (EXP)

pyrrolidine dithiocarbamate (ISO)

resveratrol (ISO)

rotenone (EXP,ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

sarin (ISO)

selenium atom (ISO)

sodium arsenite (EXP,ISO)

sodium azide (EXP)

sodium dichromate (ISO)

temozolomide (ISO)

tert-butyl hydroperoxide (ISO)

valproic acid (ISO)

vancomycin (EXP)

venlafaxine hydrochloride (EXP)

vinclozolin (EXP)

vitamin E (ISO)

warfarin (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

branching morphogenesis of an epithelial tube (ISO)

cell division (IEA)

cell-cell adhesion (IEA)

circadian regulation of gene expression (ISO,ISS)

dephosphorylation (ISO)

entrainment of circadian clock by photoperiod (ISO,ISS)

glycogen metabolic process (IEA)

lung development (ISO)

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand (ISO)

protein dephosphorylation (IDA,IEA,ISO)

regulation of circadian rhythm (ISO,ISS)

regulation of glycogen biosynthetic process (IDA)

regulation of glycogen catabolic process (IDA)

response to lead ion (IDA)

rhythmic process (IEA)

Cellular Component

adherens junction (ISO)

chromosome, telomeric region (ISO)

cytoplasm (IBA,IDA,IEA,ISO)

cytosol (ISO,TAS)

dendritic spine (IDA)

glutamatergic synapse (IDA)

glycogen granule (IDA)

neuron projection (IDA)

neuronal cell body (IDA)

nucleolus (IEA)

nucleoplasm (IEA,ISO)

nucleus (IBA,IDA,ISO)

perikaryon (IDA)

plasma membrane (IEA,ISO)

postsynapse (IDA)

presynapse (IDA)

protein phosphatase type 1 complex (IDA)

PTW/PP1 phosphatase complex (ISO,ISS)

Molecular Function

cadherin binding involved in cell-cell adhesion (ISO)

metal ion binding (IEA)

myosin phosphatase activity (IEA)

phosphatase activity (ISO,ISS)

phosphoprotein phosphatase activity (IDA,ISO)

protein binding (IPI,ISO)

protein phosphatase 1 binding (IPI)

protein serine/threonine phosphatase activity (IBA,ISO,TAS)

protein-containing complex binding (IPI)

ribonucleoprotein complex binding (IPI)

Molecular Pathway Annotations Click to see Annotation Detail View

adenosine monophosphate-activated protein kinase (AMPK) signaling pathway (ISO)

Bone morphogenetic proteins signaling pathway (ISO)

dopamine signaling pathway (ISO)

follicle-stimulating hormone signaling pathway (ISO)

glycogen biosynthetic pathway (IDA,ISO)

glycogen degradation pathway (IDA,ISO)

histamine signaling pathway, immunological (ISO)

insulin signaling pathway (IEA)

long term potentiation (IEA)

luteinizing hormone signaling pathway (ISO)

serotonin signaling pathway via receptors engaging G alphas protein family (ISO)

transforming growth factor-beta Smad dependent signaling pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Spinophilin, a novel protein phosphatase 1 binding protein localized to dendritic spines.	Allen PB, etal., Proc Natl Acad Sci U S A 1997 Sep 2;94(18):9956-61.
2.	Type 1 phosphatase, a negative regulator of cardiac function.	Carr AN, etal., Mol Cell Biol 2002 Jun;22(12):4124-35.
3.	Functional diversity of protein phosphatase-1, a cellular economizer and reset button.	Ceulemans H and Bollen M, Physiol Rev. 2004 Jan;84(1):1-39.
4.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.	AMP-activated protein kinase: also regulated by ADP?	Hardie DG, etal., Trends Biochem Sci. 2011 Sep;36(9):470-7. doi: 10.1016/j.tibs.2011.06.004. Epub 2011 Jul 23.
6.	Molecular cloning and sequence analysis of cDNA for the catalytic subunit 1 alpha of rat kidney type 1 protein phosphatase, and detection of the gene expression at high levels in hepatoma cells and regenerating livers as compared to rat livers.	Kitamura K, etal., J Biochem (Tokyo) 1991 Feb;109(2):307-10.
7.	Regulation of neurabin I interaction with protein phosphatase 1 by phosphorylation.	McAvoy T, etal., Biochemistry. 1999 Sep 28;38(39):12943-9.
8.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
9.	The RNA-binding protein Staufen from rat brain interacts with protein phosphatase-1.	Monshausen M, etal., J Neurochem. 2002 May;81(3):557-64.
10.	Purification of the hepatic glycogen-associated form of protein phosphatase-1 by microcystin-Sepharose affinity chromatography.	Moorhead G, etal., FEBS Lett. 1995 Apr 3;362(2):101-5.
11.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
12.	The alpha and gamma 1 isoforms of protein phosphatase 1 are highly and specifically concentrated in dendritic spines.	Ouimet CC, etal., Proc Natl Acad Sci U S A. 1995 Apr 11;92(8):3396-400.
13.	Myr 8, a novel unconventional myosin expressed during brain development associates with the protein phosphatase catalytic subunits 1alpha and 1gamma1.	Patel KG, etal., J Neurosci 2001 Oct 15;21(20):7954-68.
14.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
15.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
16.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
17.	Over activation of hippocampal serine/threonine protein phosphatases PP1 and PP2A is involved in lead-induced deficits in learning and memory in young rats.	Rahman A, etal., Neurotoxicology. 2012 Jun;33(3):370-83. doi: 10.1016/j.neuro.2012.02.014. Epub 2012 Mar 1.
18.	GOA pipeline	RGD automated data pipeline
19.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
20.	The nuclear envelope protein, LAP1B, is a novel protein phosphatase 1 substrate.	Santos M, etal., PLoS One. 2013 Oct 7;8(10):e76788. doi: 10.1371/journal.pone.0076788. eCollection 2013.
21.	Identification of members of the protein phosphatase 1 gene family in the rat and enhanced expression of protein phosphatase 1 alpha gene in rat hepatocellular carcinomas.	Sasaki K, etal., Jpn J Cancer Res 1990 Dec;81(12):1272-80.
22.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
23.	The neuronal actin-binding proteins, neurabin I and neurabin II, recruit specific isoforms of protein phosphatase-1 catalytic subunits.	Terry-Lorenzo RT, etal., J Biol Chem 2002 Aug 2;277(31):27716-24.
24.	The nuclear PP1 interacting protein ZAP3 (ZAP) is a putative nucleoside kinase that complexes with SAM68, CIA, NF110/45, and HNRNP-G.	Ulke-Lemee A, etal., Biochim Biophys Acta. 2007 Oct;1774(10):1339-50. Epub 2007 Aug 15.
25.	DARPP-32, Jack of All Trades... Master of Which?	Yger M and Girault JA, Front Behav Neurosci. 2011 Sep 8;5:56. doi: 10.3389/fnbeh.2011.00056. eCollection 2011.

Additional References at PubMed

PMID:2174876	PMID:7751917	PMID:9755872	PMID:9882488	PMID:11739654	PMID:12115603	PMID:14580336	PMID:14640981	PMID:15042703	PMID:15303970	PMID:15489334	PMID:15865439
PMID:20124353	PMID:20206270	PMID:20458337	PMID:20516061	PMID:21094159	PMID:21471512	PMID:21630459	PMID:21712997	PMID:21930935	PMID:22311981	PMID:22801782	PMID:22871113
PMID:23376485	PMID:24270157	PMID:24625528	PMID:25468996	PMID:29383693	PMID:29476059	PMID:33450132

Genomics

Comparative Map Data

Ppp1ca
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	1	201,485,117 - 201,488,734 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	201,485,085 - 201,497,327 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	209,837,354 - 209,840,969 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	1	216,930,585 - 216,934,202 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	1	209,621,601 - 209,625,218 (+)	NCBI	Rnor_WKY
Rnor_6.0	1	219,439,953 - 219,443,570 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	219,439,953 - 219,443,570 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	226,310,604 - 226,314,221 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	206,774,719 - 206,778,336 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	206,928,171 - 206,931,789 (+)	NCBI
Celera	1	199,029,483 - 199,033,100 (+)	NCBI		Celera
Cytogenetic Map	1	q43	NCBI

PPP1CA
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	11	67,398,183 - 67,401,858 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	11	67,398,181 - 67,421,183 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	11	67,165,654 - 67,169,329 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	11	66,922,228 - 66,925,952 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	11	66,922,227 - 66,925,952	NCBI
Celera	11	64,498,838 - 64,502,559 (-)	NCBI		Celera
Cytogenetic Map	11	q13.2	NCBI
HuRef	11	63,494,035 - 63,498,137 (-)	NCBI		HuRef
CHM1_1	11	67,048,688 - 67,052,412 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	11	67,392,298 - 67,395,973 (-)	NCBI		T2T-CHM13v2.0

Ppp1ca
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	19	4,242,173 - 4,245,418 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	19	4,242,064 - 4,245,419 (+)	Ensembl		GRCm39 Ensembl
GRCm38	19	4,192,174 - 4,195,419 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	19	4,192,065 - 4,195,420 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	19	4,192,174 - 4,195,419 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	19	4,192,174 - 4,195,419 (+)	NCBI		MGSCv36	mm8
Celera	19	4,063,314 - 4,066,560 (+)	NCBI		Celera
Cytogenetic Map	19	A	NCBI

Ppp1ca
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955422	18,076,670 - 18,079,859 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955422	18,076,670 - 18,079,859 (+)	NCBI	ChiLan1.0	ChiLan1.0

PPP1CA
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	11	66,068,007 - 66,071,579 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	11	66,068,007 - 66,071,611 (-)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	11	62,756,659 - 62,760,369 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

PPP1CA
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	18	50,062,352 - 50,065,166 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	18	50,062,352 - 50,065,166 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	18	48,672,765 - 48,675,579 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	18	50,984,259 - 50,987,073 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	18	50,984,297 - 50,987,279 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	18	50,197,606 - 50,200,420 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	18	49,772,313 - 49,775,127 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	18	50,566,605 - 50,569,419 (+)	NCBI		UU_Cfam_GSD_1.0

Ppp1ca
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	5,903,630 - 5,906,145 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936599	2,344,552 - 2,348,494 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936599	2,345,982 - 2,348,494 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PPP1CA
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	5,119,939 - 5,123,617 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	5,120,202 - 5,123,168 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	3,838,730 - 3,841,695 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PPP1CA
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	1	6,862,536 - 6,866,212 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	1	6,862,540 - 6,865,855 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666038	104,147,620 - 104,151,329 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ppp1ca
(Heterocephalus glaber - naked mole-rat)

Naked Mole-rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624767	19,119,883 - 19,123,934 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624767	19,120,683 - 19,123,935 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Ppp1ca
8 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	58
Count of miRNA genes:	53
Interacting mature miRNAs:	55
Transcripts:	ENSRNOT00000025282
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578780	Cm52	Cardiac mass QTL 52	3.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	1	81591954	219808434	Rat
731168	Bp154	Blood pressure QTL 154	3.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	94642722	214537671	Rat
1354606	Bp246	Blood pressure QTL 246	3.6		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	102813953	218753816	Rat
7794788	Mcs32	Mammary carcinoma susceptibility QTL 32	2.61		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	1	115540693	238914717	Rat
7421630	Bp362	Blood pressure QTL 362		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	118608292	241799120	Rat
1598853	Memor3	Memory QTL 3	4.5		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	1	143506580	212458660	Rat
737828	Hcas3	Hepatocarcinoma susceptibility QTL 3	4.9		liver integrity trait (VT:0010547)	liver tumorous lesion volume to total liver volume ratio (CMO:0001082)	1	144267353	222987745	Rat
2302378	Insul11	Insulin level QTL 11	3.25		blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	1	144267353	251128347	Rat
7771612	Cm80	Cardiac mass QTL 80	8.4		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	1	149448574	221264292	Rat
724531	Uae5	Urinary albumin excretion QTL 5	4		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	1	150700142	252085212	Rat
1578759	Uae30	Urinary albumin excretion QTL 30	3.3	0.003	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	150700247	252085048	Rat
1578778	Pur4	Proteinuria QTL 4	3.3	0.003	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	1	150700247	252085048	Rat
1354610	Bw34	Body weight QTL 34	4.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	256448636	Rat
1354646	Kidm18	Kidney mass QTL 18	5.7		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	151162512	256448636	Rat
1354661	Bw33	Body weight QTL 33	5.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	256448636	Rat
1358886	Bp260	Blood pressure QTL 260	3.67		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	151162766	225824951	Rat
1549837	Hcar15	Hepatocarcinoma resistance QTL 15		0.05	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	153136852	260522016	Rat
2312420	Pur17	Proteinuria QTL 17	7.1	0.0001	urine protein amount (VT:0005160)	urine total protein excretion rate (CMO:0000756)	1	156677124	218753816	Rat
1354580	Scort1	Serum corticosterone level QTL 1	3.4		blood corticosterone amount (VT:0005345)	blood corticosterone level (CMO:0001172)	1	156677124	256448636	Rat
61347	Bp197	Blood pressure QTL 197	4.2		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	1	158633083	203633083	Rat
2292222	Bp307	Blood pressure QTL 307	3.06	0.0014	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	164310393	213533942	Rat
2292220	Bp306	Blood pressure QTL 306	3.47	0.00087	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	164310393	243914901	Rat
619613	Bp77	Blood pressure QTL 77		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	164747424	209747424	Rat
619613	Bp77	Blood pressure QTL 77		0.01	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	164747424	209747424	Rat
1354653	Despr9	Despair related QTL 9		0.00019	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	1	167909849	212909849	Rat
61341	Bp26	Blood pressure QTL 26			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	169537671	214537671	Rat
724562	Rends1	Renal damage susceptibility QTL 1		0.05	kidney glomerulus integrity trait (VT:0010546)	index of glomerular damage (CMO:0001135)	1	169537671	214537671	Rat
1358294	Bw37	Body weight QTL 37	5	0.000011	body mass (VT:0001259)	body weight (CMO:0000012)	1	171310381	216310381	Rat
2293689	Bss47	Bone structure and strength QTL 47	7.25	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	1	171629477	216629477	Rat
2293693	Bss22	Bone structure and strength QTL 22	33.52	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	1	171629477	216629477	Rat
2300161	Bmd43	Bone mineral density QTL 43	8.4	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	171629477	216629477	Rat
2300174	Bmd42	Bone mineral density QTL 42	8.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	bone mineral density (CMO:0001226)	1	171629477	216629477	Rat
2300187	Bmd41	Bone mineral density QTL 41	8.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	171629477	216629477	Rat
2293654	Bss30	Bone structure and strength QTL 30	32.65	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	1	171629477	216629477	Rat
2293673	Bss27	Bone structure and strength QTL 27	18.63	0.0001	femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	1	171629477	216629477	Rat
2293677	Bss41	Bone structure and strength QTL 41	9.38	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra cross-sectional area (CMO:0001689)	1	171629477	216629477	Rat
1549830	Bss1	Bone structure and strength QTL 1	4.8		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	1	172609619	217609619	Rat
631214	Bw61	Body weight QTL61	3.4	0.0001	intramuscular adipose amount (VT:0010044)	intramuscular fat area (CMO:0001162)	1	173108781	218108781	Rat
70163	Bw20	Body weight QTL 20	5.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	174133260	219133260	Rat
738032	Hcas5	Hepatocarcinoma susceptibility QTL 5	3.12		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	176426412	257976495	Rat
1600380	Niddm70	Non-insulin dependent diabetes mellitus QTL 70	3.1	0.0008	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	1	176550523	221550523	Rat
10059600	Bp378	Blood pressure QTL 378	3.08	0.05	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	176869060	221869060	Rat
1354624	Cm35	Cardiac mass QTL35	5.7		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	177227632	256448636	Rat
1354652	Kidm20	Kidney mass QTL 20	4.3		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	177227632	256448636	Rat
1558658	Bw59	Body weight QTL 59	3.5	0.0003	body mass (VT:0001259)	body weight (CMO:0000012)	1	178784622	223784622	Rat
634321	Hc1	Hypercalciuria QTL 1	2.91		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	1	178810256	240830002	Rat
1578763	Kidm29	Kidney mass QTL 29	3.3	0.0001	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	1	179567751	260522016	Rat
1302787	Stl25	Serum triglyceride level QTL 25	2.7	0.0073	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	1	180359209	210702199	Rat
6903303	Scl34	Serum cholesterol QTL 34	2.5	0.0033	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	180359209	218108781	Rat
737977	Bp160	Blood pressure QTL 160		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	181133855	226133855	Rat
724559	Pancm1	Pancreatic morphology QTL 1	7.1		islet of Langerhans morphology trait (VT:0005215)	pancreatic islet damage composite score (CMO:0001156)	1	181759564	214537555	Rat
2293083	Iddm25	Insulin dependent diabetes mellitus QTL 25	4.18		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	181829673	224569684	Rat
634312	Bp143	Blood pressure QTL 143	3	0.0002	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	182623426	219932796	Rat
8655655	Arrd2	Age-related retinal degeneration QTL 2	7.79		retinal layer morphology trait (VT:0003727)	percentage of study population developing retinopathy during a period of time (CMO:0002453)	1	183970203	243914901	Rat
8655855	Arrd3	Age-related retinal degeneration QTL 3	3.07		lens clarity trait (VT:0001304)	cataract incidence/prevalence measurement (CMO:0001585)	1	183970203	243914901	Rat
631838	Niddm36	Non-insulin dependent diabetes mellitus QTL 36		0.01	insulin secretion trait (VT:0003564)	calculated pancreatic islet insulin release measurement (CMO:0001217)	1	184550676	229550676	Rat
1300145	Rf7	Renal function QTL 7	2.96		urine creatinine amount (VT:0010540)	urine creatinine level (CMO:0000125)	1	185145134	221264292	Rat
1359018	Hrtrt20	Heart rate QTL 20	3.08		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	185356336	202902618	Rat
2312564	Glom18	Glomerulus QTL 18	2.4	0.003	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	1	185356336	231689108	Rat
1582206	Kidm33	Kidney mass QTL 33	6.9		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	1	188377360	224054420	Rat
1358898	Bp255	Blood pressure QTL 255	3.6		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	191019702	246062233	Rat
10059590	Kidm44	Kidney mass QTL 44	3.42	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	1	191033875	236033875	Rat
1358191	Ept10	Estrogen-induced pituitary tumorigenesis QTL 10	3.8		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	1	192825253	243914732	Rat
8552891	Epfw5	Epididymal fat weight QTL 5	4.4		epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	1	193113876	238113876	Rat
634338	Hcar4	Hepatocarcinoma resistance QTL 4	4.6		liver integrity trait (VT:0010547)	liver tumorous lesion number to liver area ratio (CMO:0001210)	1	193422268	214537671	Rat
1600388	Niddm67	Non-insulin dependent diabetes mellitus QTL 67	5.84	0.000004	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	195804352	257091168	Rat
1600395	Niddm69	Non-insulin dependent diabetes mellitus QTL 69	4.14	0.0002	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	1	195804352	257091168	Rat
1600396	Niddm68	Non-insulin dependent diabetes mellitus QTL 68	4.97	0.0003	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	195804352	257091168	Rat
631658	Cm7	Cardiac mass QTL 7	5.32	0.0001	aorta mass (VT:0002845)	aorta weight (CMO:0000076)	1	196248093	241248093	Rat
1358292	Cm37	Cardiac mass QTL 37	6.2	0.00000081	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	1	196248093	241248093	Rat
1600374	Mcs17	Mammary carcinoma susceptibility QTL 17	3		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	1	197670404	242670404	Rat
1641926	Teswt2	Testicular weight QTL 2	2.82		testis mass (VT:1000644)	both testes wet weight (CMO:0000175)	1	197697768	238755659	Rat
2302375	Bw83	Body weight QTL 83	4.87	0.0002	body mass (VT:0001259)	body weight (CMO:0000012)	1	197697768	242697768	Rat
61376	Bp42	Blood pressure QTL 42	23.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	197814409	242814409	Rat
1298084	Thym4	Thymus enlargement QTL 4	10.68		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	1	197814409	242814409	Rat
1357335	Bw39	Body weight QTL 39	3.3		body mass (VT:0001259)	body weight (CMO:0000012)	1	197814409	242814409	Rat
1331790	Bp201	Blood pressure QTL 201	3.127		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	198211513	225126682	Rat
634313	Niddm43	Non-insulin dependent diabetes mellitus QTL 43			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	199050459	259647894	Rat
2292218	Kidm35	Kidney mass QTL 35			kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	1	199368955	224569684	Rat
2314011	Gluco56	Glucose level QTL 56			blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	199773958	202166723	Rat

Markers in Region

BE099677

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	201,488,954 - 201,489,125 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	219,443,791 - 219,443,961	NCBI	Rnor6.0
Rnor_5.0	1	226,314,442 - 226,314,612	UniSTS	Rnor5.0
RGSC_v3.4	1	206,778,557 - 206,778,727	UniSTS	RGSC3.4
Celera	1	199,033,321 - 199,033,491	UniSTS
RH 3.4 Map	1	1559.2	UniSTS
Cytogenetic Map	1	q43	UniSTS

Ppp1ca

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	201,485,193 - 201,486,097 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	219,440,030 - 219,440,933	NCBI	Rnor6.0
Rnor_5.0	1	226,310,681 - 226,311,584	UniSTS	Rnor5.0
RGSC_v3.4	1	206,774,796 - 206,775,699	UniSTS	RGSC3.4
Celera	1	199,029,560 - 199,030,463	UniSTS
Cytogenetic Map	1	q43	UniSTS

Ppp1ca

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	201,488,292 - 201,488,343 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	219,443,129 - 219,443,179	NCBI	Rnor6.0
Rnor_5.0	1	226,313,780 - 226,313,830	UniSTS	Rnor5.0
RGSC_v3.4	1	206,777,895 - 206,777,945	UniSTS	RGSC3.4
Celera	1	199,032,659 - 199,032,709	UniSTS
Cytogenetic Map	1	q43	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	43	57	41	19	41	8	11	74	35	41	11	8
Low
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_031527	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC070517	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473953	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	D00859	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	D90163	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221064	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ224860	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ226749	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229461	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ231613	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ232496	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ233040	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ234898	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ235125	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000045	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M58437	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000025282 ⟹ ENSRNOP00000025282

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	201,485,121 - 201,497,327 (+)	Ensembl
Rnor_6.0 Ensembl	1	219,439,953 - 219,443,570 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000091680 ⟹ ENSRNOP00000070775

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	201,485,363 - 201,496,153 (+)	Ensembl
Rnor_6.0 Ensembl	1	219,440,192 - 219,443,564 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000098712 ⟹ ENSRNOP00000087498

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	201,485,085 - 201,488,403 (+)	Ensembl

RefSeq Acc Id:

NM_031527 ⟹ NP_113715

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	1	201,485,117 - 201,488,734 (+)	NCBI
Rnor_6.0	1	219,439,953 - 219,443,570 (+)	NCBI
Rnor_5.0	1	226,310,604 - 226,314,221 (+)	NCBI
RGSC_v3.4	1	206,774,719 - 206,778,336 (+)	RGD
Celera	1	199,029,483 - 199,033,100 (+)	RGD

Sequence:

show sequence

AGGAGGCTGCAAGAGGGCGGGAGGCAGGAGAGGGCCCGGAGCTGGTGGGCCGGAGCGGCGGCGC
CGCCATGTCCGACAGCGAGAAGCTCAACCTGGATTCCATCATCGGGCGCCTGCTGGAAGTGCAG
GGCTCACGGCCTGGAAAGAATGTGCAGCTGACAGAGAACGAGATCCGTGGTCTTTGCCTCAAAT
CCCGGGAGATTTTCCTGAGCCAGCCTATTCTTCTGGAGCTTGAGGCGCCTCTCAAGATCTGTGG
TGACATCCATGGCCAGTACTATGACCTTCTACGGCTGTTCGAGTATGGTGGCTTCCCTCCAGAG
AGCAACTACCTCTTCTTGGGGGACTATGTGGATCGGGGAAAGCAGTCTTTGGAGACCATCTGCT
TGTTGCTGGCCTATAAGATCAAATACCCGGAGAATTTCTTTCTACTACGTGGGAACCATGAGTG
TGCCAGCATCAACCGCATCTATGGCTTCTATGATGAATGCAAGAGACGATACAACATCAAACTG
TGGAAGACTTTCACCGACTGCTTCAACTGCCTGCCCATTGCAGCCATTGTAGATGAGAAGATCT
TCTGCTGCCACGGAGGCCTGTCTCCAGACTTGCAATCCATGGAGCAGATTAGACGTATTATGCG
GCCCACGGACGTGCCTGACCAGGGCCTGTTGTGTGATCTGCTGTGGTCTGACCCTGACAAGGAT
GTTCAAGGCTGGGGCGAGAATGACCGTGGAGTCTCCTTTACCTTTGGGGCCGAGGTTGTAGCCA
AGTTCCTGCACAAGCATGATTTGGACCTCATCTGCAGAGCACATCAGGTTGTAGAAGATGGCTA
TGAGTTCTTTGCCAAGAGGCAGCTGGTGACACTCTTCTCAGCTCCCAACTACTGTGGCGAGTTT
GACAACGCTGGCGCCATGATGAGTGTGGACGAGACACTCATGTGTTCCTTCCAGATCCTCAAGC
CCGCTGATAAGAATAAGGGGAAGTATGGGCAGTTCAGTGGCCTGAACCCCGGAGGCCGTCCCAT
CACTCCACCCCGCAATTCTGCCAAAGCCAAGAAATAGCCTCCATGTGCTGCCCTCTGCCCCAGA
TGACGGATTATTTGTACAGAAATCATGCTGCCATGGGTCACACTGGCCTCTCAGGCCCACCCAT
CATGGGGAACACAGCGTTAAGTGTCTTTCCTTTATTTTTTAAAGAATCAATAGCAGCATCTAAT
TCCCCAGGGCTCCCTCCCACCAGCACCTGTGGTGGCTGCAAGTGGAATCCTGGGGCCAAGGCTG
CAGCTCAGGGCAATGGCAGACCAGATTGTGGGTCTCCAGCCTTGCATGGCTGGCAGCCAGATCC
TGGGGCAACCCATCTGGTCTCTTGAATAAAGGTCAAAGCTGGATTCTC

hide sequence

Protein Sequences


Protein RefSeqs	NP_113715	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA41908	(Get FASTA)	NCBI Sequence Viewer
	AAH70517	(Get FASTA)	NCBI Sequence Viewer
	BAA00732	(Get FASTA)	NCBI Sequence Viewer
	BAA14194	(Get FASTA)	NCBI Sequence Viewer
	EDM12385	(Get FASTA)	NCBI Sequence Viewer
	EDM12386	(Get FASTA)	NCBI Sequence Viewer
	P62138	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:

NP_113715 ⟸ NM_031527

- UniProtKB:

P62138 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGD
IHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECA
SINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRP
TDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYE
FFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPIT
PPRNSAKAKK

hide sequence

RefSeq Acc Id:

ENSRNOP00000025282 ⟸ ENSRNOT00000025282

RefSeq Acc Id:

ENSRNOP00000070775 ⟸ ENSRNOT00000091680

RefSeq Acc Id:

ENSRNOP00000087498 ⟸ ENSRNOT00000098712

Protein Domains

SER_THR_PHOSPHATASE

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P62138-F1-model_v2	AlphaFold	P62138	1-330	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13690618

Promoter ID:

EPDNEW_R1143

Type:

initiation region

Name:

Ppp1ca_1

Description:

protein phosphatase 1 catalytic subunit alpha

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	219,439,945 - 219,440,005	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:3375	AgrOrtholog
BIND	130598
	130600
BioCyc Gene	G2FUF-56767	BioCyc
Ensembl Genes	ENSRNOG00000018708	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000025282	ENTREZGENE, UniProtKB/Swiss-Prot
	ENSRNOP00000070775.1	UniProtKB/TrEMBL
	ENSRNOP00000087498	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000025282	ENTREZGENE, UniProtKB/Swiss-Prot
	ENSRNOT00000091680.2	UniProtKB/TrEMBL
	ENSRNOT00000098712	UniProtKB/Swiss-Prot
Gene3D-CATH	3.60.21.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7104674	IMAGE-MGC_LOAD
InterPro	Calcineurin-like_PHP_ApaH	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Metallo-depent_PP-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PPP1CA	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ser/Thr-sp_prot-phosphatase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	STPPase_N	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:24668	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:91638	IMAGE-MGC_LOAD
NCBI Gene	24668	ENTREZGENE
PANTHER	PTHR11668:SF377	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Metallophos	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	STPPase_N	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Ppp1ca	PhenoGen
PRINTS	STPHPHTASE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	SER_THR_PHOSPHATASE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SMART	PP2Ac	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF56300	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A0G2JYS8_RAT	UniProtKB/TrEMBL
	P62138	ENTREZGENE, UniProtKB/Swiss-Prot
UniProt Secondary	P08129	UniProtKB/Swiss-Prot
	P20653	UniProtKB/Swiss-Prot
	P22802	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-02-17	Ppp1ca	protein phosphatase 1 catalytic subunit alpha	Ppp1ca	protein phosphatase 1, catalytic subunit, alpha isozyme	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2011-08-02	Ppp1ca	protein phosphatase 1, catalytic subunit, alpha isozyme	Ppp1ca	protein phosphatase 1, catalytic subunit, alpha isoform	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-06-10	Ppp1ca	Protein phosphatase type 1 alpha, catalytic subunit			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_expression	expressed in the dendrite spines	625568
gene_expression	mRNA expression is induced in chemically induced hepatocellular carcinoma	729440
gene_physical_interaction	binds the neuronal actin binding proteins neurabin I and neurabin II	625568
gene_process	interacts with neurabins to regulate synaptic activity	625568

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

Send us a Message

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)