Symbol:
Ncoa2
Name:
nuclear receptor coactivator 2
RGD ID:
620108
Description:
Enables DNA polymerase binding activity and nuclear receptor binding activity. Involved in several processes, including positive regulation of female receptivity; positive regulation of nuclear receptor-mediated glucocorticoid signaling pathway; and response to estradiol. Located in dendritic spine. Used to study polycystic ovary syndrome. Human ortholog(s) of this gene implicated in acute myeloid leukemia; colorectal carcinoma; lung non-small cell carcinoma; and prostate adenocarcinoma. Orthologous to human NCOA2 (nuclear receptor coactivator 2); PARTICIPATES IN aldosterone signaling pathway; altered androgen signaling pathway; androgen signaling pathway; INTERACTS WITH (+)-schisandrin B; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
glucocorticoid receptor interacting protein 1; glucocorticoid receptor-interacting protein 1; GRIP-1; Grip1; LOC102549300; NCoA-2; Tif2; transcriptional intermediary factor 2; uncharacterized LOC102549300
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 10,618,712 - 10,852,776 (+) NCBI GRCr8 mRatBN7.2 5 5,835,642 - 6,069,693 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 5,835,706 - 6,067,451 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 8,132,076 - 8,209,657 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 9,770,968 - 9,848,544 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 9,460,403 - 9,538,097 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 5,466,544 - 5,696,540 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 5,616,483 - 5,694,598 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 10,306,581 - 10,538,264 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 5,197,891 - 5,275,776 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 5,197,890 - 5,273,000 (+) NCBI Celera 5 5,570,901 - 5,648,759 (+) NCBI Celera Cytogenetic Map 5 q11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ncoa2 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of NCOA2 mRNA] CTD PMID:31150632 Ncoa2 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO NCOA2 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of NCOA2 mRNA CTD PMID:22079256 Ncoa2 Rat (R)-linalyl acetate multiple interactions ISO NCOA2 (Homo sapiens) 6480464 NCOA2 protein promotes the reaction [linalyl acetate results in increased activity of ESR1 protein] CTD PMID:31393563 Ncoa2 Rat (S)-colchicine multiple interactions ISO NCOA2 (Homo sapiens) 6480464 Colchicine inhibits the reaction [Chenodeoxycholic Acid promotes the reaction [NR1H4 protein affects the localization of NCOA2 protein]] CTD PMID:25257666 Ncoa2 Rat 1,1,1-trichloro-2,2-bis(4-hydroxyphenyl)ethane multiple interactions ISO Ncoa2 (Mus musculus) 6480464 NCOA2 protein promotes the reaction [2 more ... CTD PMID:27634370 Ncoa2 Rat 1,2-dimethylhydrazine decreases expression ISO Ncoa2 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of NCOA2 mRNA CTD PMID:22206623 Ncoa2 Rat 17beta-estradiol multiple interactions ISO NCOA2 (Homo sapiens) 6480464 [Estradiol binds to ESR2 protein] promotes the reaction [NCOA2 protein binds to CST5 promoter] more ... CTD PMID:10964929 more ... Ncoa2 Rat 17beta-estradiol affects expression EXP 6480464 Estradiol affects the expression of NCOA2 mRNA CTD PMID:32145629 Ncoa2 Rat 17beta-estradiol multiple interactions ISO Ncoa2 (Mus musculus) 6480464 NCOA2 protein inhibits the reaction [ESR2 protein alternative form inhibits the reaction [Estradiol results in increased expression of ESR2 protein]] more ... CTD PMID:27634370 Ncoa2 Rat 17beta-estradiol affects localization ISO Ncoa2 (Mus musculus) 6480464 Estradiol affects the localization of NCOA2 protein CTD PMID:17556502 Ncoa2 Rat 17beta-estradiol increases expression ISO NCOA2 (Homo sapiens) 6480464 Estradiol results in increased expression of NCOA2 mRNA and Estradiol results in increased expression of NCOA2 protein CTD PMID:16739346 and PMID:31646340 Ncoa2 Rat 17beta-estradiol affects binding ISO NCOA2 (Homo sapiens) 6480464 [Estradiol binds to ESR1 protein] which binds to NCOA2 protein and [Estradiol binds to ESR2 protein] which binds to NCOA2 protein CTD PMID:15123288 Ncoa2 Rat 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one multiple interactions ISO NCOA2 (Homo sapiens) 6480464 [Metribolone binds to and affects the folding of AR protein] promotes the reaction [AR protein modified form binds to NCOA2 protein modified form] more ... CTD PMID:19131511 and PMID:28751236 Ncoa2 Rat 17beta-hydroxy-5alpha-androstan-3-one multiple interactions ISO NCOA2 (Homo sapiens) 6480464 Dihydrotestosterone promotes the reaction [NCOA2 protein binds to KLK3 promoter] more ... CTD PMID:15336702 more ... Ncoa2 Rat 2,2'-Dihydroxy-4-methoxybenzophenone multiple interactions ISO NCOA2 (Homo sapiens) 6480464 dioxybenzone promotes the reaction [NCOA2 protein binds to PPARG protein] CTD PMID:32407875 Ncoa2 Rat 2,3,4,5-Tetrachloro-4'-biphenylol multiple interactions ISO NCOA2 (Homo sapiens) 6480464 2' more ... CTD PMID:10964929 Ncoa2 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO NCOA2 (Homo sapiens) 6480464 NCOA2 protein affects the reaction [Tetrachlorodibenzodioxin results in increased expression of CYP1A1 mRNA] more ... CTD PMID:12024042 more ... Ncoa2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of NCOA2 mRNA CTD PMID:32109520 Ncoa2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Ncoa2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of NCOA2 mRNA CTD PMID:21570461 Ncoa2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO NCOA2 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of NCOA2 mRNA CTD PMID:12377990 and PMID:15345368 Ncoa2 Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:32109520 Ncoa2 Rat 2-[(2,4-dichlorophenyl)methyl]-4-(2,4,4-trimethylpentan-2-yl)phenol multiple interactions EXP 6480464 clofoctol promotes the reaction [THRA protein binds to NCOA2 protein] and clofoctol promotes the reaction [THRB protein binds to NCOA2 protein] CTD PMID:31566444 Ncoa2 Rat 2-hydroxypropanoic acid decreases expression ISO NCOA2 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of NCOA2 mRNA CTD PMID:30851411 Ncoa2 Rat 22,23-dihydroavermectin B1a multiple interactions ISO NCOA2 (Homo sapiens) 6480464 22 and 23-dihydroavermectin B(1)a inhibits the reaction [Chenodeoxycholic Acid promotes the reaction [NR1H4 protein affects the localization of NCOA2 protein]] CTD PMID:25257666 Ncoa2 Rat 3,3',5'-triiodo-L-thyronine multiple interactions ISO NCOA2 (Homo sapiens) 6480464 Triiodothyronine more ... CTD PMID:31566444 Ncoa2 Rat 3,3',5,5'-tetraiodothyroacetic acid multiple interactions ISO NCOA2 (Homo sapiens) 6480464 tetraiodothyroacetic acid promotes the reaction [THRA protein binds to NCOA2 protein] and tetraiodothyroacetic acid promotes the reaction [THRB protein binds to NCOA2 protein] CTD PMID:31566444 Ncoa2 Rat 3,3',5-triiodo-L-thyronine multiple interactions ISO NCOA2 (Homo sapiens) 6480464 Triiodothyronine promotes the reaction [NCOA2 protein binds to THRA protein] more ... CTD PMID:29146198 and PMID:31566444 Ncoa2 Rat 3,3'-diindolylmethane multiple interactions ISO NCOA2 (Homo sapiens) 6480464 3 more ... CTD PMID:20160136 Ncoa2 Rat 3,3,4,4,5,5,6,6,7,7,8,8,9,9,10,10,10-heptadecafluoro-1-decanol multiple interactions ISO NCOA2 (Homo sapiens) 6480464 fluorotelomer alcohols promotes the reaction [ESR1 protein binds to NCOA2 protein] and fluorotelomer alcohols promotes the reaction [ESR2 protein binds to NCOA2 protein] CTD PMID:17603182 Ncoa2 Rat 3,4-methylenedioxymethamphetamine increases expression ISO Ncoa2 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of NCOA2 mRNA CTD PMID:20188158 Ncoa2 Rat 3,4-methylenedioxymethamphetamine decreases expression ISO Ncoa2 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of NCOA2 mRNA CTD PMID:26251327 Ncoa2 Rat 3beta-hydroxycholest-5-en-26-oic acid multiple interactions ISO NCOA2 (Homo sapiens) 6480464 3-hydroxy-5-cholestenoic acid affects the reaction [NR1H3 protein binds to NCOA2 protein] CTD PMID:11089551 Ncoa2 Rat 4'-epidoxorubicin multiple interactions ISO NCOA2 (Homo sapiens) 6480464 Epirubicin inhibits the reaction [Chenodeoxycholic Acid promotes the reaction [NR1H4 protein affects the localization of NCOA2 protein]] CTD PMID:25257666 Ncoa2 Rat 4,4'-sulfonyldiphenol multiple interactions ISO NCOA2 (Homo sapiens) 6480464 bisphenol S promotes the reaction [ESR1 protein binds to NCOA2 protein] and bisphenol S promotes the reaction [NCOA2 protein binds to THRB protein] CTD PMID:29146198 and PMID:29389661 Ncoa2 Rat 4,4'-sulfonyldiphenol decreases expression ISO Ncoa2 (Mus musculus) 6480464 bisphenol S results in decreased expression of NCOA2 mRNA CTD PMID:39298647 Ncoa2 Rat 4-terpineol multiple interactions ISO NCOA2 (Homo sapiens) 6480464 NCOA2 protein promotes the reaction [terpinenol-4 results in increased activity of ESR1 protein] CTD PMID:31393563 Ncoa2 Rat 4-tert-Octylphenol multiple interactions ISO NCOA2 (Homo sapiens) 6480464 4-tert-octylphenol promotes the reaction [ESR1 protein binds to NCOA2 protein] and 4-tert-octylphenol promotes the reaction [ESR2 protein binds to NCOA2 protein] CTD PMID:10964929 Ncoa2 Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of NCOA2 mRNA CTD PMID:31881176 Ncoa2 Rat Acetyl tributyl citrate multiple interactions ISO NCOA2 (Homo sapiens) 6480464 2-acetyltributylcitrate promotes the reaction [NCOA2 protein binds to NR1I2 protein] CTD PMID:21742782 Ncoa2 Rat acrolein multiple interactions ISO NCOA2 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of NCOA2 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in decreased expression of NCOA2 mRNA CTD PMID:32699268 Ncoa2 Rat acrylamide increases expression ISO NCOA2 (Homo sapiens) 6480464 Acrylamide results in increased expression of NCOA2 mRNA CTD PMID:32763439 Ncoa2 Rat afimoxifene multiple interactions ISO NCOA2 (Homo sapiens) 6480464 afimoxifene inhibits the reaction [[Estradiol co-treated with ESR1 protein] results in increased activity of NCOA2 protein] more ... CTD PMID:23583298 and PMID:28248286 Ncoa2 Rat aflatoxin B1 affects expression ISO NCOA2 (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of NCOA2 protein CTD PMID:20106945 Ncoa2 Rat aflatoxin B1 decreases methylation ISO NCOA2 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of NCOA2 3' UTR and Aflatoxin B1 results in decreased methylation of NCOA2 gene CTD PMID:27153756 and PMID:30157460 Ncoa2 Rat all-trans-acitretin multiple interactions ISO NCOA2 (Homo sapiens) 6480464 Acitretin promotes the reaction [THRB protein binds to NCOA2 protein] CTD PMID:31566444 Ncoa2 Rat all-trans-retinoic acid multiple interactions ISO Ncoa2 (Mus musculus) 6480464 Tretinoin affects the reaction [NCOA2 protein binds to NR2C1 promoter] CTD PMID:17389641 Ncoa2 Rat all-trans-retinoic acid increases expression ISO NCOA2 (Homo sapiens) 6480464 Tretinoin results in increased expression of NCOA2 mRNA CTD PMID:33167477 Ncoa2 Rat all-trans-retinoic acid multiple interactions ISO NCOA2 (Homo sapiens) 6480464 Tretinoin promotes the reaction [RARA protein binds to NCOA2 protein] CTD PMID:15578590 Ncoa2 Rat alpha-pinene multiple interactions ISO NCOA2 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of NCOA2 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in decreased expression of NCOA2 mRNA CTD PMID:32699268 Ncoa2 Rat alpha-terpineol multiple interactions ISO NCOA2 (Homo sapiens) 6480464 NCOA2 protein promotes the reaction [alpha-terpineol results in increased activity of ESR1 protein] CTD PMID:31393563 Ncoa2 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of NCOA2 mRNA CTD PMID:16483693 Ncoa2 Rat amphetamine decreases expression EXP 6480464 Amphetamine results in decreased expression of NCOA2 mRNA CTD PMID:30779732 Ncoa2 Rat androst-4-ene-3,17-dione multiple interactions ISO NCOA2 (Homo sapiens) 6480464 NCOA2 protein promotes the reaction [Androstenedione binds to and results in increased activity of AR protein] CTD PMID:15336702 Ncoa2 Rat aristolochic acid A decreases expression ISO NCOA2 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of NCOA2 mRNA CTD PMID:33212167 Ncoa2 Rat arsane multiple interactions ISO NCOA2 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of NCOA2 mRNA CTD PMID:39836092 Ncoa2 Rat arsenic atom multiple interactions ISO NCOA2 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of NCOA2 mRNA CTD PMID:39836092 Ncoa2 Rat arsenite(3-) increases expression ISO NCOA2 (Homo sapiens) 6480464 arsenite results in increased expression of NCOA2 mRNA CTD PMID:31646340 Ncoa2 Rat arsenite(3-) multiple interactions ISO NCOA2 (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to NCOA2 mRNA] CTD PMID:32406909 Ncoa2 Rat arsenous acid multiple interactions ISO NCOA2 (Homo sapiens) 6480464 Arsenic Trioxide inhibits the reaction [Metribolone promotes the reaction [NCOA2 protein binds to KLK3 promoter]] CTD PMID:19131511 Ncoa2 Rat atrazine decreases expression ISO Ncoa2 (Mus musculus) 6480464 Atrazine results in decreased expression of NCOA2 mRNA CTD PMID:26518232 Ncoa2 Rat benidipine multiple interactions ISO NCOA2 (Homo sapiens) 6480464 benidipine inhibits the reaction [Chenodeoxycholic Acid promotes the reaction [NCOA2 protein modified form binds to NR1H4 protein]] CTD PMID:27773686 Ncoa2 Rat benzo[a]pyrene decreases expression ISO Ncoa2 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of NCOA2 mRNA CTD PMID:19770486 Ncoa2 Rat benzo[a]pyrene decreases methylation ISO NCOA2 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of NCOA2 promoter CTD PMID:27901495 Ncoa2 Rat benzo[a]pyrene affects methylation ISO NCOA2 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of NCOA2 3' UTR more ... CTD PMID:27901495 and PMID:30157460 Ncoa2 Rat benzo[a]pyrene multiple interactions ISO NCOA2 (Homo sapiens) 6480464 Benzo(a)pyrene inhibits the reaction [cobaltous chloride affects the localization of NCOA2 protein] CTD PMID:26350169 Ncoa2 Rat benzo[a]pyrene decreases expression ISO NCOA2 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of NCOA2 mRNA and Benzo(a)pyrene results in decreased expression of NCOA2 protein CTD PMID:20106945 more ... Ncoa2 Rat Benzo[ghi]perylene increases expression ISO NCOA2 (Homo sapiens) 6480464 1 and 12-benzoperylene results in increased expression of NCOA2 mRNA CTD PMID:35182551 Ncoa2 Rat Benzyl parahydroxybenzoate multiple interactions ISO NCOA2 (Homo sapiens) 6480464 benzylparaben inhibits the reaction [afimoxifene inhibits the reaction [ESRRG protein binds to NCOA2 protein]] CTD PMID:23583298 Ncoa2 Rat beta-lapachone decreases expression ISO NCOA2 (Homo sapiens) 6480464 beta-lapachone results in decreased expression of NCOA2 mRNA CTD PMID:38218311 Ncoa2 Rat bezafibrate multiple interactions ISO NCOA2 (Homo sapiens) 6480464 Bezafibrate promotes the reaction [PPARA protein binds to NCOA2 protein] CTD PMID:19263263 Ncoa2 Rat bicalutamide multiple interactions ISO NCOA2 (Homo sapiens) 6480464 [IL6 protein results in increased expression of NCOA2 protein] which results in decreased susceptibility to bicalutamide CTD PMID:19240160 Ncoa2 Rat bisphenol A multiple interactions ISO NCOA2 (Homo sapiens) 6480464 bisphenol A inhibits the reaction [afimoxifene inhibits the reaction [ESRRG protein binds to NCOA2 protein]] more ... CTD PMID:10964929 more ... Ncoa2 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of NCOA2 mRNA CTD PMID:32145629 Ncoa2 Rat bisphenol A multiple interactions EXP 6480464 bisphenol A inhibits the reaction [Genistein results in decreased expression of NCOA2 protein] and Genistein inhibits the reaction [bisphenol A results in increased expression of NCOA2 protein] CTD PMID:24884420 Ncoa2 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of NCOA2 protein CTD PMID:19379760 more ... Ncoa2 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of NCOA2 mRNA CTD PMID:25181051 and PMID:34947998 Ncoa2 Rat bisphenol A multiple interactions ISO Ncoa2 (Mus musculus) 6480464 NCOA2 protein promotes the reaction [bisphenol A results in increased expression of ESR2 protein] CTD PMID:27634370 Ncoa2 Rat bisphenol AF multiple interactions ISO NCOA2 (Homo sapiens) 6480464 bisphenol AF inhibits the reaction [ESR1 protein binds to NCOA2 protein] CTD PMID:29389661 Ncoa2 Rat bisphenol AF multiple interactions ISO Ncoa2 (Mus musculus) 6480464 NCOA2 protein promotes the reaction [bisphenol AF results in increased expression of ESR2 protein] CTD PMID:27634370 Ncoa2 Rat bisphenol AF increases expression EXP 6480464 bisphenol AF results in increased expression of NCOA2 mRNA CTD PMID:27567155 Ncoa2 Rat bisphenol F multiple interactions ISO NCOA2 (Homo sapiens) 6480464 4 and 4'-bisphenol F promotes the reaction [NCOA2 protein binds to THRB protein] CTD PMID:29146198 Ncoa2 Rat bisphenol F increases expression ISO Ncoa2 (Mus musculus) 6480464 bisphenol F results in increased expression of NCOA2 mRNA CTD PMID:38685157 Ncoa2 Rat butamben multiple interactions ISO NCOA2 (Homo sapiens) 6480464 butamben promotes the reaction [NR1I2.L protein binds to NCOA2 protein] CTD PMID:12198127 Ncoa2 Rat butanal decreases expression ISO NCOA2 (Homo sapiens) 6480464 butyraldehyde results in decreased expression of NCOA2 mRNA CTD PMID:26079696 Ncoa2 Rat Butylparaben multiple interactions ISO NCOA2 (Homo sapiens) 6480464 butylparaben inhibits the reaction [afimoxifene inhibits the reaction [ESRRG protein binds to NCOA2 protein]] CTD PMID:23583298 Ncoa2 Rat cadmium atom increases expression ISO NCOA2 (Homo sapiens) 6480464 Cadmium results in increased expression of NCOA2 mRNA CTD PMID:31646340 Ncoa2 Rat cadmium dichloride increases methylation EXP 6480464 Cadmium Chloride results in increased methylation of NCOA2 promoter CTD PMID:22457795 Ncoa2 Rat cadmium dichloride decreases expression ISO NCOA2 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of NCOA2 mRNA CTD PMID:38568856 Ncoa2 Rat cadmium dichloride multiple interactions ISO NCOA2 (Homo sapiens) 6480464 Cadmium Chloride promotes the reaction [VDR protein binds to NCOA2 protein] CTD PMID:21229763 Ncoa2 Rat caffeine decreases phosphorylation ISO NCOA2 (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of NCOA2 protein CTD PMID:35688186 Ncoa2 Rat calcitriol multiple interactions ISO NCOA2 (Homo sapiens) 6480464 Calcitriol inhibits the reaction [NCOA2 protein binds to CYP7A1 mRNA] more ... CTD PMID:15578590 more ... Ncoa2 Rat calcitriol multiple interactions ISO Ncoa2 (Mus musculus) 6480464 Calcitriol promotes the reaction [NCOA2 protein binds to CYP24A1 promoter] and Calcitriol promotes the reaction [NCOA2 protein binds to SPP1 promoter] CTD PMID:15647825 Ncoa2 Rat calcitriol affects localization ISO Ncoa2 (Mus musculus) 6480464 Calcitriol affects the localization of NCOA2 protein CTD PMID:15647825 Ncoa2 Rat calcitriol increases response to substance ISO NCOA2 (Homo sapiens) 6480464 NCOA2 protein results in increased susceptibility to Calcitriol CTD PMID:25279795 Ncoa2 Rat chenodeoxycholic acid multiple interactions ISO NCOA2 (Homo sapiens) 6480464 22 more ... CTD PMID:25257666 and PMID:27773686 Ncoa2 Rat cholesterol affects metabolic processing ISO Ncoa2 (Mus musculus) 6480464 NCOA2 protein affects the metabolism of Cholesterol CTD PMID:14993927 Ncoa2 Rat cilnidipine multiple interactions ISO NCOA2 (Homo sapiens) 6480464 cilnidipine inhibits the reaction [Chenodeoxycholic Acid promotes the reaction [NCOA2 protein modified form binds to NR1H4 protein]] CTD PMID:27773686 Ncoa2 Rat clevidipine multiple interactions ISO NCOA2 (Homo sapiens) 6480464 clevidipine inhibits the reaction [Chenodeoxycholic Acid promotes the reaction [NCOA2 protein modified form binds to NR1H4 protein]] CTD PMID:27773686 Ncoa2 Rat cobalt dichloride decreases expression ISO NCOA2 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of NCOA2 protein CTD PMID:26350169 Ncoa2 Rat cobalt dichloride multiple interactions ISO NCOA2 (Homo sapiens) 6480464 Benzo(a)pyrene inhibits the reaction [cobaltous chloride affects the localization of NCOA2 protein] CTD PMID:26350169 Ncoa2 Rat coenzyme Q10 multiple interactions ISO NCOA2 (Homo sapiens) 6480464 coenzyme Q10 inhibits the reaction [Lipopolysaccharides results in increased expression of NCOA2 mRNA] CTD PMID:21370964 Ncoa2 Rat coumarin decreases phosphorylation ISO NCOA2 (Homo sapiens) 6480464 coumarin results in decreased phosphorylation of NCOA2 protein CTD PMID:35688186 Ncoa2 Rat coumestrol multiple interactions ISO NCOA2 (Homo sapiens) 6480464 Coumestrol promotes the reaction [NCOA2 protein binds to ESR1 protein] CTD PMID:15084758 Ncoa2 Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of NCOA2 mRNA CTD PMID:26577399 Ncoa2 Rat cyproterone acetate multiple interactions ISO NCOA2 (Homo sapiens) 6480464 [Cyproterone Acetate binds to and affects the folding of AR protein] promotes the reaction [AR protein modified form binds to NCOA2 protein modified form] more ... CTD PMID:15308689 and PMID:28751236 Ncoa2 Rat daidzein multiple interactions ISO NCOA2 (Homo sapiens) 6480464 daidzein metabolite promotes the reaction [NCOA2 protein binds to ESR1 protein] CTD PMID:15084758 Ncoa2 Rat daunorubicin multiple interactions ISO NCOA2 (Homo sapiens) 6480464 Daunorubicin inhibits the reaction [Chenodeoxycholic Acid promotes the reaction [NR1H4 protein affects the localization of NCOA2 protein]] CTD PMID:25257666 Ncoa2 Rat DDT decreases methylation EXP 6480464 DDT results in decreased methylation of NCOA2 gene CTD PMID:31682807 Ncoa2 Rat dexamethasone increases expression ISO NCOA2 (Homo sapiens) 6480464 Dexamethasone results in increased expression of NCOA2 mRNA CTD PMID:19022236 Ncoa2 Rat dexamethasone multiple interactions ISO Ncoa2 (Mus musculus) 6480464 Dexamethasone inhibits the reaction [Ovalbumin results in increased expression of NCOA2 mRNA] CTD PMID:37004399 Ncoa2 Rat diarsenic trioxide multiple interactions ISO NCOA2 (Homo sapiens) 6480464 Arsenic Trioxide inhibits the reaction [Metribolone promotes the reaction [NCOA2 protein binds to KLK3 promoter]] CTD PMID:19131511 Ncoa2 Rat Dibutyl phosphate affects expression ISO NCOA2 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of NCOA2 mRNA CTD PMID:37042841 Ncoa2 Rat dibutyl phthalate affects expression EXP 6480464 Dibutyl Phthalate affects the expression of NCOA2 mRNA CTD PMID:30934153 Ncoa2 Rat dicrotophos increases expression ISO NCOA2 (Homo sapiens) 6480464 dicrotophos results in increased expression of NCOA2 mRNA CTD PMID:28302478 Ncoa2 Rat diethylstilbestrol affects binding ISO NCOA2 (Homo sapiens) 6480464 [Diethylstilbestrol binds to ESR1 protein] which binds to NCOA2 protein and [Diethylstilbestrol binds to ESR2 protein] which binds to NCOA2 protein CTD PMID:15123288 Ncoa2 Rat diethylstilbestrol decreases expression ISO Ncoa2 (Mus musculus) 6480464 Diethylstilbestrol results in decreased expression of NCOA2 protein CTD PMID:15019724 Ncoa2 Rat diethylstilbestrol multiple interactions ISO NCOA2 (Homo sapiens) 6480464 Diethylstilbestrol promotes the reaction [ESR1 protein binds to NCOA2 protein] more ... CTD PMID:10964929 more ... Ncoa2 Rat dioxygen multiple interactions ISO Ncoa2 (Mus musculus) 6480464 Oxygen inhibits the reaction [Oxygen deficiency results in increased expression of NCOA2 mRNA] CTD PMID:22629407 Ncoa2 Rat dioxygen decreases expression ISO NCOA2 (Homo sapiens) 6480464 Oxygen deficiency results in decreased expression of NCOA2 protein CTD PMID:26350169 Ncoa2 Rat dioxygen increases expression ISO Ncoa2 (Mus musculus) 6480464 Oxygen deficiency results in increased expression of NCOA2 mRNA CTD PMID:22629407 and PMID:24205000 Ncoa2 Rat dioxygen affects methylation ISO Ncoa2 (Mus musculus) 6480464 Oxygen deficiency affects the methylation of NCOA2 promoter CTD PMID:24205000 Ncoa2 Rat Doramectin multiple interactions ISO NCOA2 (Homo sapiens) 6480464 doramectin inhibits the reaction [Chenodeoxycholic Acid promotes the reaction [NCOA2 protein modified form binds to NR1H4 protein]] CTD PMID:27773686 Ncoa2 Rat doxorubicin multiple interactions ISO NCOA2 (Homo sapiens) 6480464 Doxorubicin inhibits the reaction [Chenodeoxycholic Acid promotes the reaction [NCOA2 protein modified form binds to NR1H4 protein]] and Doxorubicin inhibits the reaction [Chenodeoxycholic Acid promotes the reaction [NR1H4 protein affects the localization of NCOA2 protein]] CTD PMID:25257666 and PMID:27773686 Ncoa2 Rat doxorubicin decreases expression ISO NCOA2 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of NCOA2 mRNA CTD PMID:29803840 Ncoa2 Rat elemental selenium multiple interactions ISO NCOA2 (Homo sapiens) 6480464 [Selenium co-treated with Vitamin E] results in decreased expression of NCOA2 mRNA CTD PMID:19244175 Ncoa2 Rat elemental selenium decreases expression ISO NCOA2 (Homo sapiens) 6480464 Selenium results in decreased expression of NCOA2 mRNA CTD PMID:19244175 Ncoa2 Rat emamectin multiple interactions ISO NCOA2 (Homo sapiens) 6480464 emamectin inhibits the reaction [Chenodeoxycholic Acid promotes the reaction [NCOA2 protein modified form binds to NR1H4 protein]] CTD PMID:27773686 Ncoa2 Rat emodin increases expression ISO Ncoa2 (Mus musculus) 6480464 Emodin results in increased expression of NCOA2 mRNA CTD PMID:21319176 Ncoa2 Rat entinostat decreases expression ISO NCOA2 (Homo sapiens) 6480464 entinostat results in decreased expression of NCOA2 mRNA CTD PMID:27188386 Ncoa2 Rat eprinomectin multiple interactions ISO NCOA2 (Homo sapiens) 6480464 eprinomectin inhibits the reaction [Chenodeoxycholic Acid promotes the reaction [NCOA2 protein modified form binds to NR1H4 protein]] CTD PMID:27773686 Ncoa2 Rat ethanol affects splicing ISO Ncoa2 (Mus musculus) 6480464 Ethanol affects the splicing of NCOA2 mRNA CTD PMID:30319688 Ncoa2 Rat Ethyl salicylate multiple interactions ISO NCOA2 (Homo sapiens) 6480464 ethyl salicylate inhibits the reaction [afimoxifene inhibits the reaction [ESRRG protein binds to NCOA2 protein]] CTD PMID:23583298 Ncoa2 Rat ethylparaben multiple interactions ISO NCOA2 (Homo sapiens) 6480464 ethyl-p-hydroxybenzoate inhibits the reaction [afimoxifene inhibits the reaction [ESRRG protein binds to NCOA2 protein]] CTD PMID:23583298 Ncoa2 Rat Falecalcitriol multiple interactions ISO NCOA2 (Homo sapiens) 6480464 26 more ... CTD PMID:16059639 Ncoa2 Rat felodipine multiple interactions ISO NCOA2 (Homo sapiens) 6480464 Felodipine inhibits the reaction [Chenodeoxycholic Acid promotes the reaction [NCOA2 protein modified form binds to NR1H4 protein]] CTD PMID:27773686 Ncoa2 Rat flavonol multiple interactions ISO NCOA2 (Homo sapiens) 6480464 3-hydroxyflavone promotes the reaction [NCOA2 protein binds to NR1I2 protein] CTD PMID:26238175 Ncoa2 Rat FR900359 affects phosphorylation ISO NCOA2 (Homo sapiens) 6480464 FR900359 affects the phosphorylation of NCOA2 protein CTD PMID:37730182 Ncoa2 Rat fulvestrant multiple interactions ISO NCOA2 (Homo sapiens) 6480464 fulvestrant inhibits the reaction [[TNF protein co-treated with resveratrol] promotes the reaction [NCOA2 protein binds to IL6 promoter]] CTD PMID:24771768 Ncoa2 Rat fulvestrant increases expression ISO NCOA2 (Homo sapiens) 6480464 Fulvestrant results in increased expression of NCOA2 mRNA CTD PMID:31646340 Ncoa2 Rat furan increases methylation EXP 6480464 furan results in increased methylation of NCOA2 gene CTD PMID:22079235 Ncoa2 Rat galangin multiple interactions ISO NCOA2 (Homo sapiens) 6480464 galangin promotes the reaction [NCOA2 protein binds to NR1I2 protein] CTD PMID:26238175 Ncoa2 Rat geldanamycin increases expression ISO NCOA2 (Homo sapiens) 6480464 geldanamycin results in increased expression of NCOA2 mRNA CTD PMID:26705709 Ncoa2 Rat genistein affects binding ISO NCOA2 (Homo sapiens) 6480464 [Genistein binds to ESR1 protein] which binds to NCOA2 protein and [Genistein binds to ESR2 protein] which binds to NCOA2 protein CTD PMID:15123288 Ncoa2 Rat genistein multiple interactions EXP 6480464 bisphenol A inhibits the reaction [Genistein results in decreased expression of NCOA2 protein] and Genistein inhibits the reaction [bisphenol A results in increased expression of NCOA2 protein] CTD PMID:24884420 Ncoa2 Rat genistein decreases expression EXP 6480464 Genistein results in decreased expression of NCOA2 protein CTD PMID:24884420 Ncoa2 Rat genistein multiple interactions ISO Ncoa2 (Mus musculus) 6480464 NCOA2 protein promotes the reaction [Genistein results in increased expression of ESR2 protein alternative form] and NCOA2 protein promotes the reaction [Genistein results in increased expression of ESR2 protein] CTD PMID:27634370 Ncoa2 Rat genistein multiple interactions ISO NCOA2 (Homo sapiens) 6480464 Genistein promotes the reaction [ESR1 protein binds to NCOA2 protein] more ... CTD PMID:10964929 and PMID:15084758 Ncoa2 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of NCOA2 mRNA CTD PMID:33387578 Ncoa2 Rat guggulsterone multiple interactions ISO NCOA2 (Homo sapiens) 6480464 pregna-4 more ... CTD PMID:27773686 Ncoa2 Rat GW 1929 multiple interactions ISO NCOA2 (Homo sapiens) 6480464 GW 1929 promotes the reaction [NCOA2 protein binds to PPARG protein] CTD PMID:32407875 Ncoa2 Rat hexadecanoic acid increases phosphorylation ISO NCOA2 (Homo sapiens) 6480464 Palmitic Acid results in increased phosphorylation of NCOA2 protein CTD PMID:28073184 Ncoa2 Rat Isradipine multiple interactions ISO NCOA2 (Homo sapiens) 6480464 Isradipine inhibits the reaction [Chenodeoxycholic Acid promotes the reaction [NCOA2 protein modified form binds to NR1H4 protein]] CTD PMID:27773686 Ncoa2 Rat ivermectin multiple interactions ISO NCOA2 (Homo sapiens) 6480464 Ivermectin inhibits the reaction [Chenodeoxycholic Acid promotes the reaction [NCOA2 protein modified form binds to NR1H4 protein]] CTD PMID:27773686 Ncoa2 Rat lacidipine multiple interactions ISO NCOA2 (Homo sapiens) 6480464 lacidipine inhibits the reaction [Chenodeoxycholic Acid promotes the reaction [NCOA2 protein modified form binds to NR1H4 protein]] CTD PMID:27773686 Ncoa2 Rat lead diacetate decreases expression EXP 6480464 lead acetate results in decreased expression of NCOA2 mRNA CTD PMID:22641619 Ncoa2 Rat lead diacetate multiple interactions ISO NCOA2 (Homo sapiens) 6480464 lead acetate promotes the reaction [VDR protein binds to NCOA2 protein] CTD PMID:21229763 Ncoa2 Rat linalyl acetate multiple interactions ISO NCOA2 (Homo sapiens) 6480464 NCOA2 protein promotes the reaction [linalyl acetate results in increased activity of ESR1 protein] CTD PMID:31393563 Ncoa2 Rat linoleic acid multiple interactions ISO NCOA2 (Homo sapiens) 6480464 Linoleic Acid promotes the reaction [PPARA protein binds to NCOA2 protein] CTD PMID:19263263 Ncoa2 Rat lipopolysaccharide multiple interactions ISO NCOA2 (Homo sapiens) 6480464 coenzyme Q10 inhibits the reaction [Lipopolysaccharides results in increased expression of NCOA2 mRNA] CTD PMID:21370964 Ncoa2 Rat lipopolysaccharide decreases expression ISO Ncoa2 (Mus musculus) 6480464 Lipopolysaccharides results in decreased expression of NCOA2 mRNA CTD PMID:16847310 Ncoa2 Rat lipopolysaccharide increases expression ISO NCOA2 (Homo sapiens) 6480464 Lipopolysaccharides results in increased expression of NCOA2 mRNA CTD PMID:21370964 Ncoa2 Rat manganese atom multiple interactions ISO NCOA2 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of NCOA2 mRNA CTD PMID:39836092 Ncoa2 Rat manganese(0) multiple interactions ISO NCOA2 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of NCOA2 mRNA CTD PMID:39836092 Ncoa2 Rat manganese(II) chloride multiple interactions ISO NCOA2 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of NCOA2 mRNA CTD PMID:39836092 Ncoa2 Rat methidathion decreases expression ISO Ncoa2 (Mus musculus) 6480464 methidathion results in decreased expression of NCOA2 mRNA CTD PMID:34813904 Ncoa2 Rat methotrexate affects expression ISO Ncoa2 (Mus musculus) 6480464 Methotrexate affects the expression of NCOA2 mRNA CTD PMID:18502557 Ncoa2 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of NCOA2 gene CTD PMID:35440735 Ncoa2 Rat methyl salicylate multiple interactions ISO NCOA2 (Homo sapiens) 6480464 methyl salicylate inhibits the reaction [afimoxifene inhibits the reaction [ESRRG protein binds to NCOA2 protein]] CTD PMID:23583298 Ncoa2 Rat methylparaben multiple interactions ISO NCOA2 (Homo sapiens) 6480464 methylparaben inhibits the reaction [afimoxifene inhibits the reaction [ESRRG protein binds to NCOA2 protein]] CTD PMID:23583298 Ncoa2 Rat methylseleninic acid multiple interactions ISO NCOA2 (Homo sapiens) 6480464 methylselenic acid inhibits the reaction [Dihydrotestosterone promotes the reaction [NCOA2 protein binds to KLK3 promoter]] CTD PMID:16648561 Ncoa2 Rat mifepristone multiple interactions ISO NCOA2 (Homo sapiens) 6480464 [Mifepristone binds to AR protein] promotes the reaction [NCOA2 protein binds to KLK3 enhancer] and [Mifepristone binds to AR protein] promotes the reaction [NCOA2 protein binds to KLK3 promoter] CTD PMID:15308689 Ncoa2 Rat milbemycin multiple interactions ISO NCOA2 (Homo sapiens) 6480464 moxidectin inhibits the reaction [Chenodeoxycholic Acid promotes the reaction [NCOA2 protein modified form binds to NR1H4 protein]] CTD PMID:27773686 Ncoa2 Rat N-benzoyl-L-alanine multiple interactions ISO NCOA2 (Homo sapiens) 6480464 N-benzoylalanine promotes the reaction [THRA protein binds to NCOA2 protein] and N-benzoylalanine promotes the reaction [THRB protein binds to NCOA2 protein] CTD PMID:31566444 Ncoa2 Rat nicardipine multiple interactions ISO NCOA2 (Homo sapiens) 6480464 Nicardipine inhibits the reaction [Chenodeoxycholic Acid promotes the reaction [NCOA2 protein modified form binds to NR1H4 protein]] CTD PMID:27773686 Ncoa2 Rat nimodipine multiple interactions ISO NCOA2 (Homo sapiens) 6480464 Nimodipine inhibits the reaction [Chenodeoxycholic Acid promotes the reaction [NCOA2 protein modified form binds to NR1H4 protein]] CTD PMID:27773686 Ncoa2 Rat oxybenzone multiple interactions ISO NCOA2 (Homo sapiens) 6480464 oxybenzone promotes the reaction [NCOA2 protein binds to PPARG protein] CTD PMID:32407875 Ncoa2 Rat oxybenzone increases expression ISO NCOA2 (Homo sapiens) 6480464 oxybenzone results in increased expression of NCOA2 mRNA CTD PMID:36581016 Ncoa2 Rat ozone multiple interactions ISO NCOA2 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of NCOA2 mRNA more ... CTD PMID:32699268 Ncoa2 Rat ozone decreases expression EXP 6480464 Ozone results in decreased expression of NCOA2 mRNA CTD PMID:35737395 Ncoa2 Rat p-tert-Amylphenol multiple interactions ISO NCOA2 (Homo sapiens) 6480464 4-tert-octylphenol promotes the reaction [ESR1 protein binds to NCOA2 protein] and 4-tert-octylphenol promotes the reaction [ESR2 protein binds to NCOA2 protein] CTD PMID:10964929 Ncoa2 Rat paracetamol decreases expression ISO NCOA2 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of NCOA2 mRNA CTD PMID:29067470 Ncoa2 Rat pentanal decreases expression ISO NCOA2 (Homo sapiens) 6480464 pentanal results in decreased expression of NCOA2 mRNA CTD PMID:26079696 Ncoa2 Rat pirinixic acid multiple interactions ISO NCOA2 (Homo sapiens) 6480464 pirinixic acid promotes the reaction [PPARA protein binds to NCOA2 protein] CTD PMID:19263263 Ncoa2 Rat potassium chromate decreases expression ISO NCOA2 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of NCOA2 mRNA CTD PMID:22079256 Ncoa2 Rat potassium chromate multiple interactions ISO NCOA2 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of NCOA2 mRNA CTD PMID:22079256 Ncoa2 Rat progesterone multiple interactions ISO Ncoa2 (Mus musculus) 6480464 NCOA2 protein affects the reaction [Progesterone results in decreased expression of BMP2 mRNA] more ... CTD PMID:17556502 Ncoa2 Rat progesterone increases expression ISO Ncoa2 (Mus musculus) 6480464 Progesterone results in increased expression of NCOA2 protein CTD PMID:17556502 Ncoa2 Rat propylparaben multiple interactions ISO NCOA2 (Homo sapiens) 6480464 propylparaben inhibits the reaction [afimoxifene inhibits the reaction [ESRRG protein binds to NCOA2 protein]] CTD PMID:23583298 Ncoa2 Rat quercetin decreases expression ISO NCOA2 (Homo sapiens) 6480464 Quercetin results in decreased expression of NCOA2 mRNA CTD PMID:21632981 Ncoa2 Rat rac-lactic acid decreases expression ISO NCOA2 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of NCOA2 mRNA CTD PMID:30851411 Ncoa2 Rat raloxifene multiple interactions ISO NCOA2 (Homo sapiens) 6480464 Raloxifene Hydrochloride promotes the reaction [NCOA2 protein binds to IGF1 promoter] and Raloxifene Hydrochloride promotes the reaction [NCOA2 protein binds to PTGS2 promoter] CTD PMID:17872375 Ncoa2 Rat raloxifene increases expression ISO NCOA2 (Homo sapiens) 6480464 Raloxifene Hydrochloride results in increased expression of NCOA2 protein CTD PMID:16739346 Ncoa2 Rat resveratrol multiple interactions ISO NCOA2 (Homo sapiens) 6480464 fulvestrant inhibits the reaction [[TNF protein co-treated with resveratrol] promotes the reaction [NCOA2 protein binds to IL6 promoter]] more ... CTD PMID:15084758 and PMID:24771768 Ncoa2 Rat rifampicin multiple interactions ISO NCOA2 (Homo sapiens) 6480464 Rifampin promotes the reaction [NCOA2 protein binds to HNF4A protein] CTD PMID:21292004 Ncoa2 Rat Selamectin multiple interactions ISO NCOA2 (Homo sapiens) 6480464 selamectin inhibits the reaction [Chenodeoxycholic Acid promotes the reaction [NCOA2 protein modified form binds to NR1H4 protein]] CTD PMID:27773686 Ncoa2 Rat selenium atom multiple interactions ISO NCOA2 (Homo sapiens) 6480464 [Selenium co-treated with Vitamin E] results in decreased expression of NCOA2 mRNA CTD PMID:19244175 Ncoa2 Rat selenium atom decreases expression ISO NCOA2 (Homo sapiens) 6480464 Selenium results in decreased expression of NCOA2 mRNA CTD PMID:19244175 Ncoa2 Rat sodium arsenite decreases methylation ISO Ncoa2 (Mus musculus) 6480464 sodium arsenite results in decreased methylation of NCOA2 gene CTD PMID:32068019 Ncoa2 Rat sodium arsenite multiple interactions ISO NCOA2 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of NCOA2 mRNA CTD PMID:39836092 Ncoa2 Rat sodium arsenite increases expression ISO NCOA2 (Homo sapiens) 6480464 sodium arsenite results in increased expression of NCOA2 mRNA CTD PMID:38568856 Ncoa2 Rat succimer multiple interactions ISO Ncoa2 (Mus musculus) 6480464 [Succimer binds to Magnetite Nanoparticles] which results in decreased expression of NCOA2 mRNA CTD PMID:21641980 Ncoa2 Rat tamoxifen multiple interactions ISO NCOA2 (Homo sapiens) 6480464 Tamoxifen inhibits the reaction [ESR1 protein binds to NCOA2 protein] and Tamoxifen promotes the reaction [NCOA2 protein binds to KLRC3 gene] CTD PMID:17395694 and PMID:23665804 Ncoa2 Rat tamoxifen increases expression ISO NCOA2 (Homo sapiens) 6480464 Tamoxifen results in increased expression of NCOA2 mRNA and Tamoxifen results in increased expression of NCOA2 protein CTD PMID:16739346 and PMID:20332317 Ncoa2 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of NCOA2 mRNA CTD PMID:31150632 Ncoa2 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of NCOA2 mRNA] CTD PMID:31150632 Ncoa2 Rat thyroxine multiple interactions ISO NCOA2 (Homo sapiens) 6480464 Thyroxine promotes the reaction [THRA protein binds to NCOA2 protein] and Thyroxine promotes the reaction [THRB protein binds to NCOA2 protein] CTD PMID:31566444 Ncoa2 Rat tiratricol multiple interactions ISO NCOA2 (Homo sapiens) 6480464 3 more ... CTD PMID:31566444 Ncoa2 Rat titanium dioxide increases expression ISO Ncoa2 (Mus musculus) 6480464 titanium dioxide results in increased expression of NCOA2 mRNA CTD PMID:23557971 Ncoa2 Rat titanium dioxide increases methylation ISO Ncoa2 (Mus musculus) 6480464 titanium dioxide results in increased methylation of NCOA2 gene CTD PMID:35295148 Ncoa2 Rat toxaphene multiple interactions ISO NCOA2 (Homo sapiens) 6480464 Toxaphene inhibits the reaction [NCOA2 protein results in increased activity of ESRRA protein] CTD PMID:10493499 Ncoa2 Rat trichostatin A affects expression ISO NCOA2 (Homo sapiens) 6480464 trichostatin A affects the expression of NCOA2 mRNA CTD PMID:28542535 Ncoa2 Rat triclosan decreases expression ISO NCOA2 (Homo sapiens) 6480464 Triclosan results in decreased expression of NCOA2 mRNA CTD PMID:30510588 Ncoa2 Rat trimellitic anhydride increases expression ISO Ncoa2 (Mus musculus) 6480464 trimellitic anhydride results in increased expression of NCOA2 mRNA CTD PMID:19042947 Ncoa2 Rat triptonide affects expression ISO Ncoa2 (Mus musculus) 6480464 triptonide affects the expression of NCOA2 mRNA CTD PMID:33045310 Ncoa2 Rat troglitazone decreases expression ISO Ncoa2 (Mus musculus) 6480464 troglitazone results in decreased expression of NCOA2 mRNA CTD PMID:28973697 Ncoa2 Rat tungsten decreases expression ISO Ncoa2 (Mus musculus) 6480464 Tungsten results in decreased expression of NCOA2 mRNA CTD PMID:30912803 Ncoa2 Rat valproic acid decreases expression ISO NCOA2 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of NCOA2 mRNA CTD PMID:23179753 and PMID:28001369 Ncoa2 Rat valproic acid affects splicing EXP 6480464 Valproic Acid affects the splicing of NCOA2 mRNA CTD PMID:29427782 Ncoa2 Rat valproic acid increases methylation ISO NCOA2 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of NCOA2 gene CTD PMID:29154799 Ncoa2 Rat vitamin E multiple interactions ISO NCOA2 (Homo sapiens) 6480464 [Selenium co-treated with Vitamin E] results in decreased expression of NCOA2 mRNA CTD PMID:19244175 Ncoa2 Rat vitamin E decreases expression ISO NCOA2 (Homo sapiens) 6480464 Vitamin E results in decreased expression of NCOA2 mRNA CTD PMID:19244175 Ncoa2 Rat vorinostat decreases expression ISO NCOA2 (Homo sapiens) 6480464 vorinostat results in decreased expression of NCOA2 mRNA CTD PMID:27188386 Ncoa2 Rat wogonin multiple interactions ISO Ncoa2 (Mus musculus) 6480464 wogonin inhibits the reaction [Ovalbumin results in increased expression of NCOA2 mRNA] CTD PMID:37004399 Ncoa2 Rat zearalenone multiple interactions ISO NCOA2 (Homo sapiens) 6480464 Zearalenone analog promotes the reaction [ESR1 protein binds to and results in increased activity of NCOA2 protein] more ... CTD PMID:15084758 and PMID:28807876
Imported Annotations - PID (archival)
(+)-schisandrin B (EXP) (-)-epigallocatechin 3-gallate (ISO) (R)-linalyl acetate (ISO) (S)-colchicine (ISO) 1,1,1-trichloro-2,2-bis(4-hydroxyphenyl)ethane (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (EXP,ISO) 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one (ISO) 17beta-hydroxy-5alpha-androstan-3-one (ISO) 2,2'-Dihydroxy-4-methoxybenzophenone (ISO) 2,3,4,5-Tetrachloro-4'-biphenylol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2-[(2,4-dichlorophenyl)methyl]-4-(2,4,4-trimethylpentan-2-yl)phenol (EXP) 2-hydroxypropanoic acid (ISO) 22,23-dihydroavermectin B1a (ISO) 3,3',5'-triiodo-L-thyronine (ISO) 3,3',5,5'-tetraiodothyroacetic acid (ISO) 3,3',5-triiodo-L-thyronine (ISO) 3,3'-diindolylmethane (ISO) 3,3,4,4,5,5,6,6,7,7,8,8,9,9,10,10,10-heptadecafluoro-1-decanol (ISO) 3,4-methylenedioxymethamphetamine (ISO) 3beta-hydroxycholest-5-en-26-oic acid (ISO) 4'-epidoxorubicin (ISO) 4,4'-sulfonyldiphenol (ISO) 4-terpineol (ISO) 4-tert-Octylphenol (ISO) acetamide (EXP) Acetyl tributyl citrate (ISO) acrolein (ISO) acrylamide (ISO) afimoxifene (ISO) aflatoxin B1 (ISO) all-trans-acitretin (ISO) all-trans-retinoic acid (ISO) alpha-pinene (ISO) alpha-terpineol (ISO) ammonium chloride (EXP) amphetamine (EXP) androst-4-ene-3,17-dione (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) arsenous acid (ISO) atrazine (ISO) benidipine (ISO) benzo[a]pyrene (ISO) Benzo[ghi]perylene (ISO) Benzyl parahydroxybenzoate (ISO) beta-lapachone (ISO) bezafibrate (ISO) bicalutamide (ISO) bisphenol A (EXP,ISO) bisphenol AF (EXP,ISO) bisphenol F (ISO) butamben (ISO) butanal (ISO) Butylparaben (ISO) cadmium atom (ISO) cadmium dichloride (EXP,ISO) caffeine (ISO) calcitriol (ISO) chenodeoxycholic acid (ISO) cholesterol (ISO) cilnidipine (ISO) clevidipine (ISO) cobalt dichloride (ISO) coenzyme Q10 (ISO) coumarin (ISO) coumestrol (ISO) Cuprizon (EXP) cyproterone acetate (ISO) daidzein (ISO) daunorubicin (ISO) DDT (EXP) dexamethasone (ISO) diarsenic trioxide (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP) dicrotophos (ISO) diethylstilbestrol (ISO) dioxygen (ISO) Doramectin (ISO) doxorubicin (ISO) elemental selenium (ISO) emamectin (ISO) emodin (ISO) entinostat (ISO) eprinomectin (ISO) ethanol (ISO) Ethyl salicylate (ISO) ethylparaben (ISO) Falecalcitriol (ISO) felodipine (ISO) flavonol (ISO) FR900359 (ISO) fulvestrant (ISO) furan (EXP) galangin (ISO) geldanamycin (ISO) genistein (EXP,ISO) gentamycin (EXP) guggulsterone (ISO) GW 1929 (ISO) hexadecanoic acid (ISO) Isradipine (ISO) ivermectin (ISO) lacidipine (ISO) lead diacetate (EXP,ISO) linalyl acetate (ISO) linoleic acid (ISO) lipopolysaccharide (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methidathion (ISO) methotrexate (ISO) methoxychlor (EXP) methyl salicylate (ISO) methylparaben (ISO) methylseleninic acid (ISO) mifepristone (ISO) milbemycin (ISO) N-benzoyl-L-alanine (ISO) nicardipine (ISO) nimodipine (ISO) oxybenzone (ISO) ozone (EXP,ISO) p-tert-Amylphenol (ISO) paracetamol (ISO) pentanal (ISO) pirinixic acid (ISO) potassium chromate (ISO) progesterone (ISO) propylparaben (ISO) quercetin (ISO) rac-lactic acid (ISO) raloxifene (ISO) resveratrol (ISO) rifampicin (ISO) Selamectin (ISO) selenium atom (ISO) sodium arsenite (ISO) succimer (ISO) tamoxifen (ISO) tetrachloromethane (EXP) thyroxine (ISO) tiratricol (ISO) titanium dioxide (ISO) toxaphene (ISO) trichostatin A (ISO) triclosan (ISO) trimellitic anhydride (ISO) triptonide (ISO) troglitazone (ISO) tungsten (ISO) valproic acid (EXP,ISO) vitamin E (ISO) vorinostat (ISO) wogonin (ISO) zearalenone (ISO)
Biological Process
cellular response to hormone stimulus (IBA) cellular response to Thyroglobulin triiodothyronine (IEA,ISO) cerebellum development (IEP) circadian regulation of gene expression (IEA,ISO,ISS) circadian rhythm (IEA,ISO) locomotor rhythm (IEA,ISO) male gonad development (IEP) negative regulation of DNA-templated transcription (IEA,ISO) negative regulation of smoothened signaling pathway (IEA,ISO) negative regulation of transcription by RNA polymerase II (IEA,ISO) positive regulation of DNA-templated transcription (IEA) positive regulation of female receptivity (IMP) positive regulation of nuclear receptor-mediated glucocorticoid signaling pathway (IMP) positive regulation of transcription by RNA polymerase II (IBA,IEA,IMP,ISO) regulation of DNA-templated transcription (IEA,ISO) regulation of gene expression (IEA,ISO) regulation of glucose metabolic process (IEA,ISO) regulation of lipid metabolic process (IEA,ISO,ISS) response to estradiol (IEP) response to progesterone (IEA,ISO) rhythmic process (IEA)
Molecular Function
aryl hydrocarbon receptor binding (IEA,ISO) chromatin binding (IEA,ISO) DNA polymerase binding (IPI) nuclear estrogen receptor binding (IPI) nuclear glucocorticoid receptor binding (IPI) nuclear receptor binding (IBA,IEA,IPI,ISO) nuclear retinoic acid receptor binding (IPI) nuclear retinoid X receptor binding (IPI) nuclear thyroid hormone receptor binding (IPI) protein binding (ISO) protein dimerization activity (IEA) protein domain specific binding (IEA,ISO) protein-containing complex binding (IPI) RNA polymerase II cis-regulatory region sequence-specific DNA binding (IEA,ISO) RNA polymerase II intronic transcription regulatory region sequence-specific DNA binding (IEA,ISO) RNA polymerase II-specific DNA-binding transcription factor binding (IEA,ISO) signaling receptor binding (IEA,ISO) transcription coactivator activity (IBA,IEA,ISO,ISS) transcription regulator inhibitor activity (IEA,ISO)
1.
Acute disruption of select steroid receptor coactivators prevents reproductive behavior in rats and unmasks genetic adaptation in knockout mice.
Apostolakis EM, etal., Mol Endocrinol. 2002 Jul;16(7):1511-23.
2.
The mutational landscape of prostate cancer.
Barbieri CE, etal., Eur Urol. 2013 Oct;64(4):567-76. doi: 10.1016/j.eururo.2013.05.029. Epub 2013 May 18.
3.
Androgen receptor coregulators and their involvement in the development and progression of prostate cancer.
Chmelar R, etal., Int J Cancer. 2007 Feb 15;120(4):719-33.
4.
Phosphorylation of the AMPA receptor subunit GluR2 differentially regulates its interaction with PDZ domain-containing proteins.
Chung HJ, etal., J Neurosci. 2000 Oct 1;20(19):7258-67.
5.
Coactivator SRC-2-dependent metabolic reprogramming mediates prostate cancer survival and metastasis.
Dasgupta S, etal., J Clin Invest. 2015 Mar 2;125(3):1174-88. doi: 10.1172/JCI76029. Epub 2015 Feb 9.
6.
MOZ-TIF2-induced acute myeloid leukemia requires the MOZ nucleosome binding motif and TIF2-mediated recruitment of CBP.
Deguchi K, etal., Cancer Cell. 2003 Mar;3(3):259-71.
7.
Genetic and Environmental Models of Circadian Disruption Link SRC-2 Function to Hepatic Pathology.
Fleet T, etal., J Biol Rhythms. 2016 Oct;31(5):443-60. doi: 10.1177/0748730416657921. Epub 2016 Jul 17.
8.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
9.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
10.
Estrogen receptor alpha/beta, AIB1, and TIF2 in colorectal carcinogenesis: do coregulators have prognostic significance?
Grivas PD, etal., Int J Colorectal Dis. 2009 Jun;24(6):613-22. doi: 10.1007/s00384-009-0647-9. Epub 2009 Feb 6.
11.
Coregulators in nuclear estrogen receptor action: from concept to therapeutic targeting.
Hall JM and McDonnell DP, Mol Interv. 2005 Dec;5(6):343-57.
12.
Differential regulation of steroid nuclear receptor coregulator expression between normal and neoplastic prostate epithelial cells.
Heemers HV, etal., Prostate. 2010 Jun 15;70(9):959-70.
13.
CASK associates with glutamate receptor interacting protein and signaling molecules.
Hong CJ and Hsueh YP, Biochem Biophys Res Commun. 2006 Dec 22;351(3):771-6. Epub 2006 Oct 30.
14.
Uterine progesterone signaling is a target for metformin therapy in PCOS-like rats.
Hu M, etal., J Endocrinol. 2018 May;237(2):123-137. doi: 10.1530/JOE-18-0086. Epub 2018 Mar 13.
15.
Differential expression of p160 steroid receptor coactivators in the rat testis and epididymis.
Igarashi-Migitaka J, etal., Eur J Endocrinol. 2005 Oct;153(4):595-604.
16.
Novel glucocorticoid receptor coactivator effector mechanisms.
Jenkins BD, etal., Trends Endocrinol Metab. 2001 Apr;12(3):122-6.
17.
Sustained expression of steroid receptor coactivator SRC-2/TIF-2 is associated with better prognosis in malignant pleural mesothelioma.
Jennings CJ, etal., J Thorac Oncol. 2012 Jan;7(1):243-8. doi: 10.1097/JTO.0b013e31822f6544.
18.
Interaction of DNA polymerase beta with GRIP1 during meiosis.
Jonason AS, etal., Chromosoma. 2001 Nov;110(6):402-10. Epub 2001 Sep 12.
19.
Subfertility linked to combined luteal insufficiency and uterine progesterone resistance.
Konno T, etal., Endocrinology. 2010 Sep;151(9):4537-50. Epub 2010 Jul 21.
20.
Prognostic implications of genetic variants in advanced non-small cell lung cancer: a genome-wide association study.
Lee Y, etal., Carcinogenesis. 2013 Feb;34(2):307-13. doi: 10.1093/carcin/bgs356. Epub 2012 Nov 8.
21.
Mechanistic principles in NR box-dependent interaction between nuclear hormone receptors and the coactivator TIF2.
Leers J, etal., Mol Cell Biol 1998 Oct;18(10):6001-13.
22.
GRIP1 in GABAergic synapses.
Li RW, etal., J Comp Neurol. 2005 Jul 18;488(1):11-27.
23.
Knockdown of NCOA2 Inhibits the Growth and Progression of Gastric Cancer by Affecting the Wnt Signaling Pathway-Related Protein Expression.
Lin Z, etal., Technol Cancer Res Treat. 2020 Jan-Dec;19:1533033820928072. doi: 10.1177/1533033820928072.
24.
Coactivator and corepressor gene expression in rat cerebellum during postnatal development and the effect of altered thyroid status.
Martinez de Arrieta C, etal., Endocrinology. 2000 May;141(5):1693-8.
25.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
26.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
27.
The human glucocorticoid receptor: molecular basis of biologic function.
Nicolaides NC, etal., Steroids. 2010 Jan;75(1):1-12. Epub 2009 Oct 7.
28.
A Sleeping Beauty mutagenesis screen reveals a tumor suppressor role for Ncoa2/Src-2 in liver cancer.
O'Donnell KA, etal., Proc Natl Acad Sci U S A. 2012 May 22;109(21):E1377-86. doi: 10.1073/pnas.1115433109. Epub 2012 May 3.
29.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
30.
GOA pipeline
RGD automated data pipeline
31.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
32.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
33.
Dynamic and combinatorial control of gene expression by nuclear retinoic acid receptors (RARs).
Rochette-Egly C and Germain P, Nucl Recept Signal. 2009 May 8;7:e005.
34.
SRC-2-mediated coactivation of anti-tumorigenic target genes suppresses MYC-induced liver cancer.
Suresh S, etal., PLoS Genet. 2017 Mar 8;13(3):e1006650. doi: 10.1371/journal.pgen.1006650. eCollection 2017 Mar.
35.
Recruitment of the p160 coactivators by the glucocorticoid receptor: dependence on the promoter context and cell type but not hypoxic conditions.
Trousson A, etal., J Steroid Biochem Mol Biol. 2007 May;104(3-5):305-11. Epub 2007 Mar 23.
36.
Estrogen signaling in colorectal carcinoma microenvironment: expression of ERbeta1, AIB-1, and TIF-2 is upregulated in cancer-associated myofibroblasts and correlates with disease progression.
Tzelepi V, etal., Virchows Arch. 2009 Apr;454(4):389-99. doi: 10.1007/s00428-009-0740-z. Epub 2009 Mar 7.
37.
Regulation of alpha 2(I) collagen expression in stellate cells by retinoic acid and retinoid X receptors through interactions with their cofactors.
Wang L, etal., Arch Biochem Biophys. 2004 Aug 1;428(1):92-8.
38.
Alterations of estradiol-induced histone H3 acetylation in the preoptic area and anteroventral periventricular nucleus of middle-aged female rats.
Xu W, etal., Biochem Biophys Res Commun. 2019 Aug 27;516(3):894-899. doi: 10.1016/j.bbrc.2019.06.145. Epub 2019 Jul 1.
39.
Interactions of the mineralocorticoid receptor--within and without.
Yang J and Fuller PJ, Mol Cell Endocrinol. 2012 Mar 24;350(2):196-205. doi: 10.1016/j.mce.2011.07.001. Epub 2011 Jul 18.
40.
Steroid receptor coactivator-2 expression in brain and physical associations with steroid receptors.
Yore MA, etal., Neuroscience. 2010 Sep 1;169(3):1017-28. Epub 2010 Jun 2.
41.
Disruption of NCOA2 by recurrent fusion with LACTB2 in colorectal cancer.
Yu J, etal., Oncogene. 2016 Jan 14;35(2):187-95. doi: 10.1038/onc.2015.72. Epub 2015 Mar 30.
Ncoa2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 10,618,712 - 10,852,776 (+) NCBI GRCr8 mRatBN7.2 5 5,835,642 - 6,069,693 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 5,835,706 - 6,067,451 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 8,132,076 - 8,209,657 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 9,770,968 - 9,848,544 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 9,460,403 - 9,538,097 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 5,466,544 - 5,696,540 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 5,616,483 - 5,694,598 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 10,306,581 - 10,538,264 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 5,197,891 - 5,275,776 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 5,197,890 - 5,273,000 (+) NCBI Celera 5 5,570,901 - 5,648,759 (+) NCBI Celera Cytogenetic Map 5 q11 NCBI
NCOA2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 8 70,109,782 - 70,456,446 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 8 70,109,782 - 70,403,808 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 8 71,022,017 - 71,316,452 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 8 71,186,821 - 71,478,574 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 8 71,186,820 - 71,478,574 NCBI Celera 8 67,021,935 - 67,313,703 (-) NCBI Celera Cytogenetic Map 8 q13.3 NCBI HuRef 8 66,517,566 - 66,809,329 (-) NCBI HuRef CHM1_1 8 71,079,808 - 71,371,655 (-) NCBI CHM1_1 T2T-CHM13v2.0 8 70,539,621 - 70,834,144 (-) NCBI T2T-CHM13v2.0
Ncoa2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 13,209,329 - 13,444,451 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 13,209,329 - 13,444,307 (-) Ensembl GRCm39 Ensembl GRCm38 1 13,139,105 - 13,374,227 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 13,139,105 - 13,374,083 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 13,129,240 - 13,364,164 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 13,127,689 - 13,359,278 (-) NCBI MGSCv36 mm8 Celera 1 13,103,226 - 13,334,430 (-) NCBI Celera Cytogenetic Map 1 A3 NCBI cM Map 1 4.12 NCBI
Ncoa2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955444 9,313,447 - 9,584,913 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955444 9,313,748 - 9,587,109 (+) NCBI ChiLan1.0 ChiLan1.0
NCOA2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 7 85,839,497 - 86,141,138 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 8 61,469,337 - 61,770,965 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 8 66,632,139 - 66,929,526 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 8 68,293,012 - 68,480,104 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 8 68,293,018 - 68,400,479 (-) Ensembl panpan1.1 panPan2
NCOA2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 29 19,253,849 - 19,471,640 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 29 19,222,842 - 19,545,371 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 29 19,511,986 - 19,805,562 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 29 19,347,144 - 19,643,120 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 29 19,347,185 - 19,642,297 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 29 19,386,646 - 19,682,493 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 29 19,452,837 - 19,748,399 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 29 19,733,575 - 20,029,399 (-) NCBI UU_Cfam_GSD_1.0
Ncoa2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405303 59,680,707 - 59,940,562 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936496 14,844,855 - 15,016,454 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936496 14,844,923 - 15,102,922 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
NCOA2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 4 64,954,238 - 65,246,572 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 4 64,888,029 - 65,245,757 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 4 70,584,741 - 70,791,313 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
NCOA2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 8 65,855,232 - 66,151,733 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 8 65,855,235 - 66,040,947 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666039 75,279,759 - 75,586,607 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Ncoa2
.
Predicted Target Of
Count of predictions: 110 Count of miRNA genes: 94 Interacting mature miRNAs: 96 Transcripts: ENSRNOT00000011026 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
2312562 Pur18 Proteinuria QTL 18 2.6 0.001 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 5 2138965 32656739 Rat 1576314 Eutr1 Estrogen induced uterine response QTL 1 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 2138965 166875058 Rat 8662454 Vetf3 Vascular elastic tissue fragility QTL 3 27.4 artery integrity trait (VT:0010639) number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562) 5 2282226 69540447 Rat 70212 Niddm25 Non-insulin dependent diabetes mellitus QTL 25 3.54 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 5 1 131345958 Rat 631551 Vetf1 Vascular elastic tissue fragility QTL 1 5 0.0001 aorta elastic tissue integrity trait (VT:0010556) artery internal elastic lamina non-tumorous lesion count (CMO:0001913) 5 2282226 5904428 Rat 1300117 Hrtrt8 Heart rate QTL 8 3.49 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 5 3844018 47869213 Rat 61462 Niddm10 Non-insulin dependent diabetes mellitus QTL 10 3.9 0.001 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 5 5112159 47171491 Rat 1331756 Rf34 Renal function QTL 34 4.16275 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 5 1 90450412 Rat 2313085 Bss59 Bone structure and strength QTL 59 2.9 0.0001 long bone metaphysis morphology trait (VT:0000133) tibia midshaft total cross-sectional area (CMO:0001715) 5 3844018 26141981 Rat 1331771 Rf35 Renal function QTL 35 4.36965 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 5 729470 86724018 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000011026 ⟹ ENSRNOP00000011026
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 5,847,334 - 6,067,451 (+) Ensembl Rnor_6.0 Ensembl 5 5,616,483 - 5,694,598 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000095919 ⟹ ENSRNOP00000092311
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 5,835,706 - 6,029,139 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000119206 ⟹ ENSRNOP00000093156
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 5,847,334 - 6,067,451 (+) Ensembl
RefSeq Acc Id:
NM_031822 ⟹ NP_114010
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 10,618,722 - 10,852,776 (+) NCBI mRatBN7.2 5 5,835,642 - 6,069,693 (+) NCBI Rnor_6.0 5 5,616,483 - 5,694,598 (+) NCBI Rnor_5.0 5 10,306,581 - 10,538,264 (+) NCBI RGSC_v3.4 5 5,197,891 - 5,275,776 (+) RGD Celera 5 5,570,901 - 5,648,759 (+) RGD
Sequence:
ATGAGTGGGATGGGAGAAAATACCTCTGACCCGTCCAGGGCAGAGACCAGAAAACGCAAGGAATGTCCGGACCAGCTCGGACCCAGCCCCAAAAGGAGCACGGAGAAACGTAACCGCGAGCAGGAAAA
hide sequence
RefSeq Acc Id:
XM_006237744 ⟹ XP_006237806
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 10,618,712 - 10,852,776 (+) NCBI mRatBN7.2 5 5,835,642 - 6,069,693 (+) NCBI Rnor_6.0 5 5,466,544 - 5,696,540 (+) NCBI Rnor_5.0 5 10,306,581 - 10,538,264 (+) NCBI
Sequence:
GCGGCCGCAGCCTGGGCTCCCGCGGCGGCGGCGGAGGTCAGCGCCGACGGCAGCCCGCACCTGA
hide sequence
RefSeq Acc Id:
XM_006237747 ⟹ XP_006237809
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 10,768,214 - 10,852,776 (+) NCBI mRatBN7.2 5 5,985,136 - 6,069,693 (+) NCBI Rnor_6.0 5 5,613,995 - 5,696,540 (+) NCBI Rnor_5.0 5 10,306,581 - 10,538,264 (+) NCBI
Sequence:
TTTACTATCTAGGAAGGGCTGAACTTTATTTTTTATGACATGTTGACAGATGATTCTAGAGAAA
hide sequence
RefSeq Acc Id:
XM_017593660 ⟹ XP_017449149
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 10,619,081 - 10,852,776 (+) NCBI mRatBN7.2 5 5,836,034 - 6,069,693 (+) NCBI Rnor_6.0 5 5,466,892 - 5,696,540 (+) NCBI
Sequence:
CCGGGCGAGAGAGCTCGGGAGTCGAGCCCCAGAGCGCGAGGCGGGCGGAGGCTGCAGCCCGCGG
hide sequence
RefSeq Acc Id:
XM_039110852 ⟹ XP_038966780
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 10,618,730 - 10,852,776 (+) NCBI mRatBN7.2 5 5,835,654 - 6,069,693 (+) NCBI
RefSeq Acc Id:
XM_039110853 ⟹ XP_038966781
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 10,618,712 - 10,852,776 (+) NCBI mRatBN7.2 5 5,835,642 - 6,069,693 (+) NCBI
RefSeq Acc Id:
XM_063288483 ⟹ XP_063144553
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 10,620,293 - 10,852,776 (+) NCBI
RefSeq Acc Id:
XM_063288484 ⟹ XP_063144554
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 10,746,663 - 10,852,776 (+) NCBI
RefSeq Acc Id:
XM_063288485 ⟹ XP_063144555
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 10,620,269 - 10,852,776 (+) NCBI
RefSeq Acc Id:
XM_063288486 ⟹ XP_063144556
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 10,620,087 - 10,852,776 (+) NCBI
RefSeq Acc Id:
NP_114010 ⟸ NM_031822
- UniProtKB:
Q9WUI9 (UniProtKB/Swiss-Prot), F1MA61 (UniProtKB/TrEMBL)
- Sequence:
MSGMGENTSDPSRAETRKRKECPDQLGPSPKRSTEKRNREQENKYIEELAELIFANFNDIDNFNFKPDKCAILKETVKQIRQIKEQEKAAAANIDEVQKSDVSSTGQGVIDKDALGPMMLEALDGFFF
hide sequence
RefSeq Acc Id:
XP_006237806 ⟸ XM_006237744
- Peptide Label:
isoform X1
- UniProtKB:
Q9WUI9 (UniProtKB/Swiss-Prot), F1MA61 (UniProtKB/TrEMBL)
- Sequence:
MSGMGENTSDPSRAETRKRKECPDQLGPSPKRSTEKRNREQENKYIEELAELIFANFNDIDNFN
hide sequence
RefSeq Acc Id:
XP_006237809 ⟸ XM_006237747
- Peptide Label:
isoform X1
- UniProtKB:
Q9WUI9 (UniProtKB/Swiss-Prot), F1MA61 (UniProtKB/TrEMBL)
- Sequence:
MSGMGENTSDPSRAETRKRKECPDQLGPSPKRSTEKRNREQENKYIEELAELIFANFNDIDNFNFKPDKCAILKETVKQIRQIKEQEKAAAANIDEVQKSDVSSTGQGVIDKDALGPMMLEALDGFFF
hide sequence
RefSeq Acc Id:
XP_017449149 ⟸ XM_017593660
- Peptide Label:
isoform X1
- UniProtKB:
Q9WUI9 (UniProtKB/Swiss-Prot), F1MA61 (UniProtKB/TrEMBL)
- Sequence:
MSGMGENTSDPSRAETRKRKECPDQLGPSPKRSTEKRNREQENKYIEELAELIFANFNDIDNFN
hide sequence
Ensembl Acc Id:
ENSRNOP00000011026 ⟸ ENSRNOT00000011026
RefSeq Acc Id:
XP_038966781 ⟸ XM_039110853
- Peptide Label:
isoform X2
- UniProtKB:
Q9WUI9 (UniProtKB/Swiss-Prot), A0A8I6AJ68 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038966780 ⟸ XM_039110852
- Peptide Label:
isoform X1
- UniProtKB:
Q9WUI9 (UniProtKB/Swiss-Prot), F1MA61 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000093156 ⟸ ENSRNOT00000119206
Ensembl Acc Id:
ENSRNOP00000092311 ⟸ ENSRNOT00000095919
RefSeq Acc Id:
XP_063144556 ⟸ XM_063288486
- Peptide Label:
isoform X1
- UniProtKB:
Q9WUI9 (UniProtKB/Swiss-Prot), F1MA61 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063144555 ⟸ XM_063288485
- Peptide Label:
isoform X1
- UniProtKB:
Q9WUI9 (UniProtKB/Swiss-Prot), F1MA61 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063144553 ⟸ XM_063288483
- Peptide Label:
isoform X1
- UniProtKB:
Q9WUI9 (UniProtKB/Swiss-Prot), F1MA61 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063144554 ⟸ XM_063288484
- Peptide Label:
isoform X1
- UniProtKB:
Q9WUI9 (UniProtKB/Swiss-Prot), F1MA61 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2021-03-09
Ncoa2
nuclear receptor coactivator 2
LOC102549300
uncharacterized LOC102549300
Data merged from RGD:7582276
737654 PROVISIONAL
2013-12-18
LOC102549300
uncharacterized LOC102549300
Symbol and Name status set to provisional
70820 PROVISIONAL
2004-02-26
Ncoa2
nuclear receptor coactivator 2
Symbol and Name status set to approved
625702 APPROVED
2002-08-07
Ncoa2
nuclear receptor coactivator 2
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_domains
contains three short conserved NR box motifs
633360
