Symbol:
Nme2
Name:
NME/NM23 nucleoside diphosphate kinase 2
RGD ID:
619877
Description:
Enables several functions, including identical protein binding activity; intermediate filament binding activity; and kinase activity. Involved in several processes, including cellular response to glucose stimulus; response to growth hormone; and ribonucleoside triphosphate biosynthetic process. Located in intermediate filament; mitochondrial membrane; and perinuclear region of cytoplasm. Human ortholog(s) of this gene implicated in teratoma. Orthologous to several human genes including NME2 (NME/NM23 nucleoside diphosphate kinase 2); PARTICIPATES IN adefovir pharmacokinetics pathway; de novo pyrimidine biosynthetic pathway; Glut1 deficiency syndrome pathway; INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 4,4'-sulfonyldiphenol.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
expressed in non-metastatic cells 2; histidine protein kinase NDKB; NDK B; NDKB; NDP kinase alpha; NDP kinase B; nm23-2; non-metastatic cells 2, protein (NM23B) expressed in; nucleoside diphosphate kinase; nucleoside diphosphate kinase B; P18; p18-12d
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Related Pseudogenes:
Nme2-ps1
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 79,394,999 - 79,400,418 (-) NCBI GRCr8 mRatBN7.2 10 78,898,097 - 78,903,514 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 20 11,179,488 - 11,179,919 (-) Ensembl mRatBN7.2 Ensembl mRatBN7.2 Ensembl 10 78,897,770 - 78,903,538 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 83,508,941 - 83,514,439 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 83,007,040 - 83,012,538 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 78,478,407 - 78,483,899 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 81,648,216 - 81,653,717 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 81,648,216 - 81,653,717 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 81,478,178 - 81,483,679 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 82,582,766 - 82,588,269 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 82,597,135 - 82,602,639 (-) NCBI Celera 10 77,694,496 - 77,700,026 (-) NCBI Celera Cytogenetic Map 10 q26 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Nme2 Rat (+)-catechin multiple interactions ISO NME2 (Homo sapiens) 6480464 [Catechin co-treated with Grape Seed Proanthocyanidins] results in decreased expression of NME2 mRNA CTD PMID:24763279 Nme2 Rat 1,2-dimethylhydrazine multiple interactions ISO Nme2 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of NME2 mRNA CTD PMID:22206623 Nme2 Rat 17beta-estradiol multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of NME2 mRNA CTD PMID:26496021 Nme2 Rat 17beta-estradiol decreases expression ISO Nme2 (Mus musculus) 6480464 Estradiol results in decreased expression of NME2 mRNA CTD PMID:39298647 Nme2 Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of NME2 mRNA CTD PMID:32145629 Nme2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of NME2 mRNA and Tetrachlorodibenzodioxin results in decreased expression of NME2 protein CTD PMID:16548065 and PMID:32109520 Nme2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of NME2 mRNA CTD PMID:33387578 Nme2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of NME2 mRNA CTD PMID:34747641 Nme2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Nme2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of NME2 mRNA CTD PMID:21570461 Nme2 Rat 2,4,6-tribromophenol increases expression ISO NME2 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Nme2 Rat 2-bromohexadecanoic acid multiple interactions ISO NME2 (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of NME2 protein] CTD PMID:38195004 Nme2 Rat 3,3',5,5'-tetrabromobisphenol A increases expression ISO NME2 (Homo sapiens) 6480464 tetrabromobisphenol A results in increased expression of NME2 protein CTD PMID:31675489 Nme2 Rat 4,4'-diaminodiphenylmethane decreases expression ISO Nme2 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of NME2 mRNA CTD PMID:18648102 Nme2 Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of NME2 mRNA CTD PMID:36041667 Nme2 Rat 4-hydroxynon-2-enal decreases expression ISO NME2 (Homo sapiens) 6480464 4-hydroxy-2-nonenal results in decreased expression of NME2 mRNA CTD PMID:12419474 Nme2 Rat 4-nonylphenol multiple interactions ISO Nme2 (Mus musculus) 6480464 [Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with 4-nonylphenol co-treated with 4-tert-octylphenol] results in increased expression of NME2 mRNA CTD PMID:30698749 Nme2 Rat 4-tert-Octylphenol multiple interactions ISO Nme2 (Mus musculus) 6480464 [Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with 4-nonylphenol co-treated with 4-tert-octylphenol] results in increased expression of NME2 mRNA CTD PMID:30698749 Nme2 Rat 5-aza-2'-deoxycytidine affects methylation ISO NME2 (Homo sapiens) 6480464 Decitabine affects the methylation of NME2 gene CTD PMID:17630775 Nme2 Rat 5-azacytidine increases expression EXP 6480464 Azacitidine results in increased expression of NME2 protein CTD PMID:17105402 Nme2 Rat 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole affects expression EXP 6480464 Omeprazole affects the expression of NME2 mRNA CTD PMID:19483382 Nme2 Rat 6-propyl-2-thiouracil affects expression EXP 6480464 Propylthiouracil affects the expression of NME2 mRNA CTD PMID:19483382 Nme2 Rat 9-cis-retinoic acid decreases expression ISO NME2 (Homo sapiens) 6480464 Alitretinoin results in decreased expression of NME2 protein CTD PMID:28886987 Nme2 Rat actinomycin D multiple interactions ISO NME2 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of NME2 protein CTD PMID:38460933 Nme2 Rat all-trans-retinoic acid multiple interactions ISO NME2 (Homo sapiens) 6480464 Tretinoin promotes the reaction [tributyltin results in decreased expression of NME2 protein] and Tretinoin promotes the reaction [triphenyltin chloride results in decreased expression of NME2 protein] CTD PMID:30806631 Nme2 Rat all-trans-retinoic acid decreases expression ISO NME2 (Homo sapiens) 6480464 Tretinoin results in decreased expression of NME2 protein CTD PMID:28886987 and PMID:30806631 Nme2 Rat amiodarone affects expression EXP 6480464 Amiodarone affects the expression of NME2 mRNA CTD PMID:19483382 Nme2 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of NME2 mRNA CTD PMID:30047161 Nme2 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of NME2 mRNA CTD PMID:16483693 Nme2 Rat arsenite(3-) multiple interactions ISO NME2 (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to NME2 mRNA] and arsenite promotes the reaction [G3BP1 protein binds to NME2 protein] CTD PMID:32406909 Nme2 Rat astaxanthin multiple interactions ISO Nme2 (Mus musculus) 6480464 astaxanthine inhibits the reaction [LEPR gene mutant form results in increased expression of NME2 mRNA] CTD PMID:16964424 Nme2 Rat benzbromarone affects expression EXP 6480464 Benzbromarone affects the expression of NME2 mRNA CTD PMID:19483382 Nme2 Rat benzo[a]pyrene increases methylation ISO NME2 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of NME2 promoter CTD PMID:27901495 Nme2 Rat benzo[a]pyrene increases expression ISO NME2 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of NME2 protein CTD PMID:33278487 Nme2 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Nme2 (Mus musculus) 6480464 [Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with 4-nonylphenol co-treated with 4-tert-octylphenol] results in increased expression of NME2 mRNA CTD PMID:30698749 Nme2 Rat bis(2-ethylhexyl) phthalate increases expression ISO Nme2 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of NME2 mRNA CTD PMID:33754040 Nme2 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of NME2 mRNA and [bisphenol A co-treated with Estradiol] results in decreased expression of NME2 mRNA CTD PMID:26496021 and PMID:36041667 Nme2 Rat bisphenol A decreases expression ISO Nme2 (Mus musculus) 6480464 bisphenol A results in decreased expression of NME2 protein CTD PMID:35999755 Nme2 Rat bisphenol A decreases expression ISO NME2 (Homo sapiens) 6480464 bisphenol A results in decreased expression of NME2 protein CTD PMID:31675489 Nme2 Rat bisphenol A increases expression ISO Nme2 (Mus musculus) 6480464 bisphenol A results in increased expression of NME2 mRNA CTD PMID:33221593 and PMID:38074096 Nme2 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of NME2 mRNA CTD PMID:32145629 Nme2 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of NME2 mRNA CTD PMID:25181051 more ... Nme2 Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of NME2 mRNA CTD PMID:36041667 Nme2 Rat bleomycin A2 increases expression EXP 6480464 Bleomycin results in increased expression of NME2 protein CTD PMID:25933445 Nme2 Rat Butylbenzyl phthalate multiple interactions ISO Nme2 (Mus musculus) 6480464 [Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with 4-nonylphenol co-treated with 4-tert-octylphenol] results in increased expression of NME2 mRNA CTD PMID:30698749 Nme2 Rat cadmium atom multiple interactions ISO NME2 (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of NME2 protein] and [Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of NME2 protein CTD PMID:38195004 Nme2 Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of NME2 mRNA CTD PMID:33453195 Nme2 Rat cadmium dichloride multiple interactions ISO NME2 (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of NME2 protein] and [Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of NME2 protein CTD PMID:38195004 Nme2 Rat cadmium dichloride increases expression ISO Nme2 (Mus musculus) 6480464 Cadmium Chloride results in increased expression of NME2 mRNA CTD PMID:24982889 Nme2 Rat caffeine increases phosphorylation ISO NME2 (Homo sapiens) 6480464 Caffeine results in increased phosphorylation of NME2 protein CTD PMID:35688186 Nme2 Rat calcitriol decreases expression ISO NME2 (Homo sapiens) 6480464 Calcitriol results in decreased expression of NME2 mRNA CTD PMID:15951637 and PMID:16847355 Nme2 Rat cannabidiol multiple interactions ISO NME2 (Homo sapiens) 6480464 [Cuprizone co-treated with Cannabidiol] results in decreased expression of NME2 protein CTD PMID:34122009 Nme2 Rat capsaicin increases expression ISO NME2 (Homo sapiens) 6480464 Capsaicin results in increased expression of NME2 mRNA CTD PMID:21310942 Nme2 Rat carbon nanotube increases expression ISO Nme2 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Nme2 Rat choline multiple interactions ISO Nme2 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of NME2 gene CTD PMID:20938992 Nme2 Rat clofibrate affects expression EXP 6480464 Clofibrate affects the expression of NME2 mRNA CTD PMID:19483382 Nme2 Rat clofibric acid multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of NME2 mRNA CTD PMID:17602206 Nme2 Rat cocaine affects expression ISO NME2 (Homo sapiens) 6480464 Cocaine affects the expression of NME2 protein CTD PMID:19393250 Nme2 Rat cromoglycate(2-) affects binding EXP 4107023 Chromoglycate binds to Nme2 protein RGD Nme2 Rat Cuprizon multiple interactions ISO NME2 (Homo sapiens) 6480464 [Cuprizone co-treated with Cannabidiol] results in decreased expression of NME2 protein CTD PMID:34122009 Nme2 Rat decabromodiphenyl ether decreases expression ISO NME2 (Homo sapiens) 6480464 decabromobiphenyl ether results in decreased expression of NME2 protein CTD PMID:31675489 Nme2 Rat dexamethasone decreases expression ISO Nme2 (Mus musculus) 6480464 Dexamethasone results in decreased expression of NME2 protein CTD PMID:33567340 Nme2 Rat dextran sulfate decreases expression ISO Nme2 (Mus musculus) 6480464 Dextran Sulfate results in decreased expression of NME2 protein CTD PMID:35999755 Nme2 Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of NME2 mRNA CTD PMID:21266533 Nme2 Rat dibutyl phthalate multiple interactions ISO Nme2 (Mus musculus) 6480464 [Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with 4-nonylphenol co-treated with 4-tert-octylphenol] results in increased expression of NME2 mRNA CTD PMID:30698749 Nme2 Rat dichlorine multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] results in decreased expression of NME2 mRNA CTD PMID:18636392 Nme2 Rat diethylstilbestrol increases expression ISO NME2 (Homo sapiens) 6480464 Diethylstilbestrol results in increased expression of NME2 mRNA CTD PMID:15766595 Nme2 Rat disodium selenite decreases expression ISO NME2 (Homo sapiens) 6480464 Sodium Selenite results in decreased expression of NME2 mRNA CTD PMID:16705456 Nme2 Rat doxorubicin decreases expression ISO Nme2 (Mus musculus) 6480464 Doxorubicin results in decreased expression of NME2 protein CTD PMID:16144979 Nme2 Rat doxorubicin decreases expression ISO NME2 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of NME2 mRNA CTD PMID:29803840 Nme2 Rat doxorubicin affects expression ISO Nme2 (Mus musculus) 6480464 Doxorubicin affects the expression of NME2 protein CTD PMID:21251210 Nme2 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of NME2 mRNA CTD PMID:29391264 Nme2 Rat ethanol increases expression EXP 6480464 Ethanol results in increased expression of NME2 protein CTD PMID:23702218 Nme2 Rat fentin chloride decreases expression ISO NME2 (Homo sapiens) 6480464 triphenyltin chloride results in decreased expression of NME2 protein CTD PMID:30806631 Nme2 Rat fentin chloride multiple interactions ISO NME2 (Homo sapiens) 6480464 Tretinoin promotes the reaction [triphenyltin chloride results in decreased expression of NME2 protein] CTD PMID:30806631 Nme2 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of NME2 mRNA CTD PMID:24136188 Nme2 Rat folic acid multiple interactions ISO Nme2 (Mus musculus) 6480464 [1 more ... CTD PMID:20938992 and PMID:22206623 Nme2 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of NME2 mRNA CTD PMID:22061828 Nme2 Rat glafenine increases expression EXP 6480464 Glafenine results in increased expression of NME2 mRNA CTD PMID:24136188 Nme2 Rat glyphosate decreases expression ISO Nme2 (Mus musculus) 6480464 Glyphosate results in decreased expression of NME2 mRNA CTD PMID:37087751 Nme2 Rat hyaluronic acid multiple interactions EXP 6480464 Hyaluronic Acid analog inhibits the reaction [Hydrogen Peroxide results in decreased expression of NME2 protein] CTD PMID:23178681 Nme2 Rat hyaluronic acid decreases expression EXP 6480464 Hyaluronic Acid analog results in decreased expression of NME2 protein CTD PMID:23178681 Nme2 Rat hydrogen peroxide multiple interactions EXP 6480464 Hyaluronic Acid analog inhibits the reaction [Hydrogen Peroxide results in decreased expression of NME2 protein] CTD PMID:23178681 Nme2 Rat hydrogen peroxide decreases expression EXP 6480464 Hydrogen Peroxide results in decreased expression of NME2 protein CTD PMID:23178681 Nme2 Rat indometacin increases expression EXP 6480464 Indomethacin results in increased expression of NME2 mRNA CTD PMID:36868495 Nme2 Rat L-ethionine affects expression EXP 6480464 Ethionine affects the expression of NME2 mRNA CTD PMID:19483382 Nme2 Rat L-methionine multiple interactions ISO Nme2 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of NME2 gene CTD PMID:20938992 Nme2 Rat lithium atom increases expression EXP 6480464 Lithium results in increased expression of NME2 protein CTD PMID:18296634 Nme2 Rat lithium hydride increases expression EXP 6480464 Lithium results in increased expression of NME2 protein CTD PMID:18296634 Nme2 Rat Mesaconitine increases expression EXP 6480464 mesaconitine results in increased expression of NME2 protein CTD PMID:37182599 Nme2 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of NME2 mRNA CTD PMID:30047161 Nme2 Rat methylmercury chloride increases expression ISO NME2 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of NME2 mRNA CTD PMID:34089799 Nme2 Rat mifepristone multiple interactions ISO NME2 (Homo sapiens) 6480464 Mifepristone inhibits the reaction [Progesterone results in increased expression of NME2 mRNA] CTD PMID:15674352 Nme2 Rat N-nitrosodiethylamine increases expression ISO Nme2 (Mus musculus) 6480464 Diethylnitrosamine results in increased expression of NME2 protein CTD PMID:15928304 Nme2 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of NME2 mRNA CTD PMID:17602206 Nme2 Rat Nonylphenol increases expression EXP 6480464 nonylphenol results in increased expression of NME2 protein CTD PMID:19260726 Nme2 Rat Nutlin-3 multiple interactions ISO NME2 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of NME2 protein CTD PMID:38460933 Nme2 Rat ochratoxin A decreases expression ISO NME2 (Homo sapiens) 6480464 ochratoxin A results in decreased expression of NME2 protein CTD PMID:26861962 Nme2 Rat omeprazole affects expression EXP 6480464 Omeprazole affects the expression of NME2 mRNA CTD PMID:19483382 Nme2 Rat ozone multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] results in decreased expression of NME2 mRNA CTD PMID:18636392 Nme2 Rat ozone multiple interactions ISO Nme2 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of NME2 mRNA CTD PMID:34911549 Nme2 Rat p-tert-Amylphenol multiple interactions ISO Nme2 (Mus musculus) 6480464 [Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with 4-nonylphenol co-treated with 4-tert-octylphenol] results in increased expression of NME2 mRNA CTD PMID:30698749 Nme2 Rat paracetamol affects expression ISO Nme2 (Mus musculus) 6480464 Acetaminophen affects the expression of NME2 mRNA CTD PMID:17562736 Nme2 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of NME2 mRNA CTD PMID:33387578 Nme2 Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of NME2 mRNA CTD PMID:32680482 Nme2 Rat PCB138 decreases expression EXP 6480464 2 more ... CTD PMID:21673325 Nme2 Rat pirinixic acid affects expression EXP 6480464 pirinixic acid affects the expression of NME2 mRNA CTD PMID:19483382 Nme2 Rat pregnenolone 16alpha-carbonitrile increases expression ISO Nme2 (Mus musculus) 6480464 Pregnenolone Carbonitrile results in increased expression of NME2 mRNA CTD PMID:28903501 Nme2 Rat progesterone increases expression ISO NME2 (Homo sapiens) 6480464 Progesterone results in increased expression of NME2 mRNA CTD PMID:15674352 Nme2 Rat progesterone multiple interactions ISO NME2 (Homo sapiens) 6480464 Mifepristone inhibits the reaction [Progesterone results in increased expression of NME2 mRNA] CTD PMID:15674352 Nme2 Rat propiconazole increases expression EXP 6480464 propiconazole results in increased expression of NME2 mRNA CTD PMID:30047161 Nme2 Rat pyrimidifen increases expression ISO NME2 (Homo sapiens) 6480464 pyrimidifen results in increased expression of NME2 mRNA CTD PMID:33512557 Nme2 Rat quinoline increases expression ISO NME2 (Homo sapiens) 6480464 quinoline analog results in increased expression of NME2 protein CTD PMID:18645022 Nme2 Rat rotenone increases expression ISO NME2 (Homo sapiens) 6480464 Rotenone results in increased expression of NME2 mRNA CTD PMID:33512557 Nme2 Rat sarin affects expression EXP 6480464 Sarin affects the expression of NME2 protein CTD PMID:28973502 Nme2 Rat silicon dioxide affects secretion ISO NME2 (Homo sapiens) 6480464 Silicon Dioxide analog affects the secretion of NME2 protein CTD PMID:25895662 Nme2 Rat sodium arsenite decreases expression ISO NME2 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of NME2 mRNA CTD PMID:34032870 and PMID:38568856 Nme2 Rat sodium dodecyl sulfate decreases expression ISO NME2 (Homo sapiens) 6480464 Sodium Dodecyl Sulfate results in decreased expression of NME2 protein CTD PMID:21469165 Nme2 Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of NME2 mRNA CTD PMID:30047161 Nme2 Rat T-2 toxin affects expression EXP 6480464 T-2 Toxin affects the expression of NME2 protein CTD PMID:26141394 Nme2 Rat tebufenpyrad increases expression ISO NME2 (Homo sapiens) 6480464 4-chloro-N-((4-(1 and 1-dimethylethyl)phenyl)methyl)-3-ethyl-1-methyl-1H-pyrazole-5-carboxamide results in increased expression of NME2 mRNA CTD PMID:33512557 Nme2 Rat tert-butyl hydroperoxide decreases expression ISO NME2 (Homo sapiens) 6480464 tert-Butylhydroperoxide results in decreased expression of NME2 mRNA CTD PMID:12419474 Nme2 Rat testosterone decreases expression ISO NME2 (Homo sapiens) 6480464 Testosterone results in decreased expression of NME2 mRNA CTD PMID:33359661 Nme2 Rat tetrachloroethene decreases expression ISO Nme2 (Mus musculus) 6480464 Tetrachloroethylene results in decreased expression of NME2 mRNA CTD PMID:28973375 Nme2 Rat thapsigargin increases expression EXP 6480464 Thapsigargin results in increased expression of NME2 protein CTD PMID:35544339 Nme2 Rat thioacetamide affects expression EXP 6480464 Thioacetamide affects the expression of NME2 mRNA CTD PMID:19483382 Nme2 Rat titanium dioxide increases expression ISO Nme2 (Mus musculus) 6480464 titanium dioxide results in increased expression of NME2 mRNA CTD PMID:23557971 and PMID:27760801 Nme2 Rat titanium dioxide increases methylation ISO Nme2 (Mus musculus) 6480464 titanium dioxide results in increased methylation of NME2 promoter CTD PMID:35295148 Nme2 Rat tributylstannane decreases expression ISO NME2 (Homo sapiens) 6480464 tributyltin results in decreased expression of NME2 protein CTD PMID:30806631 Nme2 Rat tributylstannane multiple interactions ISO NME2 (Homo sapiens) 6480464 Tretinoin promotes the reaction [tributyltin results in decreased expression of NME2 protein] CTD PMID:30806631 Nme2 Rat triphenylstannane decreases expression ISO NME2 (Homo sapiens) 6480464 triphenyltin analog results in decreased expression of NME2 protein CTD PMID:31634547 Nme2 Rat trovafloxacin decreases expression EXP 6480464 trovafloxacin results in decreased expression of NME2 mRNA CTD PMID:24136188 Nme2 Rat tungsten increases expression ISO Nme2 (Mus musculus) 6480464 Tungsten results in increased expression of NME2 mRNA CTD PMID:30912803 Nme2 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of NME2 mRNA CTD PMID:23034163 Nme2 Rat zinc atom increases expression EXP 6480464 Zinc deficiency results in increased expression of NME2 mRNA CTD PMID:11717422 Nme2 Rat zinc(0) increases expression EXP 6480464 Zinc deficiency results in increased expression of NME2 mRNA CTD PMID:11717422
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
(+)-catechin (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-tribromophenol (ISO) 2-bromohexadecanoic acid (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (EXP) 4-hydroxynon-2-enal (ISO) 4-nonylphenol (ISO) 4-tert-Octylphenol (ISO) 5-aza-2'-deoxycytidine (ISO) 5-azacytidine (EXP) 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP) 6-propyl-2-thiouracil (EXP) 9-cis-retinoic acid (ISO) actinomycin D (ISO) all-trans-retinoic acid (ISO) amiodarone (EXP) amitrole (EXP) ammonium chloride (EXP) arsenite(3-) (ISO) astaxanthin (ISO) benzbromarone (EXP) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (EXP) bleomycin A2 (EXP) Butylbenzyl phthalate (ISO) cadmium atom (ISO) cadmium dichloride (EXP,ISO) caffeine (ISO) calcitriol (ISO) cannabidiol (ISO) capsaicin (ISO) carbon nanotube (ISO) choline (ISO) clofibrate (EXP) clofibric acid (EXP) cocaine (ISO) cromoglycate(2-) (EXP) Cuprizon (ISO) decabromodiphenyl ether (ISO) dexamethasone (ISO) dextran sulfate (ISO) dibutyl phthalate (EXP,ISO) dichlorine (EXP) diethylstilbestrol (ISO) disodium selenite (ISO) doxorubicin (ISO) endosulfan (EXP) ethanol (EXP) fentin chloride (ISO) flutamide (EXP) folic acid (ISO) gentamycin (EXP) glafenine (EXP) glyphosate (ISO) hyaluronic acid (EXP) hydrogen peroxide (EXP) indometacin (EXP) L-ethionine (EXP) L-methionine (ISO) lithium atom (EXP) lithium hydride (EXP) Mesaconitine (EXP) methimazole (EXP) methylmercury chloride (ISO) mifepristone (ISO) N-nitrosodiethylamine (EXP,ISO) Nonylphenol (EXP) Nutlin-3 (ISO) ochratoxin A (ISO) omeprazole (EXP) ozone (EXP,ISO) p-tert-Amylphenol (ISO) paracetamol (EXP,ISO) paraquat (EXP) PCB138 (EXP) pirinixic acid (EXP) pregnenolone 16alpha-carbonitrile (ISO) progesterone (ISO) propiconazole (EXP) pyrimidifen (ISO) quinoline (ISO) rotenone (ISO) sarin (EXP) silicon dioxide (ISO) sodium arsenite (ISO) sodium dodecyl sulfate (ISO) sulfadimethoxine (EXP) T-2 toxin (EXP) tebufenpyrad (ISO) tert-butyl hydroperoxide (ISO) testosterone (ISO) tetrachloroethene (ISO) thapsigargin (EXP) thioacetamide (EXP) titanium dioxide (ISO) tributylstannane (ISO) triphenylstannane (ISO) trovafloxacin (EXP) tungsten (ISO) vinclozolin (EXP) zinc atom (EXP) zinc(0) (EXP)
Biological Process
adenylate cyclase-activating G protein-coupled receptor signaling pathway (IMP) cellular response to fatty acid (IEP) cellular response to glucose stimulus (IEP) cellular response to oxidative stress (IEP) CTP biosynthetic process (IDA,IEA) GTP biosynthetic process (IDA,IEA) integrin-mediated signaling pathway (ISO,ISS) negative regulation of apoptotic process (ISO,ISS) negative regulation of myeloid leukocyte differentiation (IDA) nucleoside triphosphate biosynthetic process (ISO) nucleotide metabolic process (IEA) positive regulation of DNA-templated transcription (ISO,ISS) positive regulation of epithelial cell proliferation (ISO,ISS) positive regulation of keratinocyte differentiation (ISO,ISS) positive regulation of neuron projection development (IMP) positive regulation of transcription by RNA polymerase II (ISO,ISS) protein autophosphorylation (IDA) regulation of apoptotic process (IBA) regulation of epidermis development (ISO,ISS) response to growth hormone (IEP) UTP biosynthetic process (IDA,IEA)
1.
Inhibition of nucleoside diphosphate kinase (NDPK/nm23) by cAMP analogues.
Anciaux K, etal., FEBS Lett. 1997 Jan 2;400(1):75-9.
2.
Interactions of phocein with nucleoside-diphosphate kinase, Eps15, and Dynamin I.
Baillat G, etal., J Biol Chem 2002 May 24;277(21):18961-6.
3.
Growth hormone (GH) action in the developing lung: changes in lung proteins after adenoviral GH overexpression.
Beyea JA, etal., Dev Dyn. 2005 Oct;234(2):404-12.
4.
Capturing proteins that bind polyunsaturated fatty acids: demonstration using arachidonic acid and eicosanoids.
Brock TG Lipids. 2008 Feb;43(2):161-9. Epub 2007 Dec 15.
5.
Recombinant rat nucleoside diphosphate kinase isoforms (alpha and beta): purification, properties and application to immunological detection of native isoforms in rat tissues.
Fukuchi T, etal., Biochim Biophys Acta. 1994 Mar 16;1205(1):113-22.
6.
Decreased expression of nucleoside diphosphate kinase alpha isoform, an nm23-H2 gene homolog, is associated with metastatic potential of rat mammary-adenocarcinoma cells.
Fukuda M, etal., Int J Cancer. 1996 Feb 8;65(4):531-7.
7.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
8.
Oligomeric structure and autophosphorylation of nucleoside diphosphate kinase from rat mucosal mast cells.
Hemmerich S and Pecht I, Biochemistry. 1992 May 19;31(19):4580-7.
9.
A cromoglycate binding protein from rat mast cells of a leukemia line is a nucleoside diphosphate kinase.
Hemmerich S, etal., Biochemistry 1992 May 19;31(19):4574-9.
10.
Regulation of cardiac cAMP synthesis and contractility by nucleoside diphosphate kinase B/G protein beta gamma dimer complexes.
Hippe HJ, etal., Circ Res. 2007 Apr 27;100(8):1191-9. Epub 2007 Mar 15.
11.
De novo synthesis of pyrimidine nucleotides; emerging interfaces with signal transduction pathways.
Huang M and Graves LM, Cell Mol Life Sci. 2003 Feb;60(2):321-36.
12.
Overexpression of nucleoside diphosphate kinases induces neurite outgrowth and their substitution to inactive forms leads to suppression of nerve growth factor- and dibutyryl cyclic AMP-induced effects in PC12D cells.
Ishijima Y, etal., FEBS Lett. 1999 Feb 19;445(1):155-9.
13.
M-LDH serves as a regulatory subunit of the cytosolic substrate-channelling complex in vivo.
Jovanovic S, etal., J Mol Biol. 2007 Aug 10;371(2):349-61. Epub 2007 Jun 2.
14.
Analysis of nm23 gene expressions in human bladder and renal cancers.
Kanayama H, etal., Int J Urol. 1994 Dec;1(4):324-31.
15.
NM23-H2 involves in negative regulation of Diva and Bcl2L10 in apoptosis signaling.
Kang Y, etal., Biochem Biophys Res Commun. 2007 Jul 20;359(1):76-82. doi: 10.1016/j.bbrc.2007.05.090. Epub 2007 May 24.
16.
KEGG: Kyoto Encyclopedia of Genes and Genomes
KEGG
17.
Isolation and characterization of a cDNA clone encoding rat nucleoside diphosphate kinase.
Kimura N, etal., J Biol Chem 1990 Sep 15;265(26):15744-9.
18.
Expression of nm23-H1 and nm23-H2 proteins in prostate carcinoma.
Konishi N, etal., Jpn J Cancer Res. 1993 Oct;84(10):1050-4.
19.
Localization and characterization of the mitochondrial isoform of the nucleoside diphosphate kinase in the pancreatic beta cell: evidence for its complexation with mitochondrial succinyl-CoA synthetase.
Kowluru A, etal., Arch Biochem Biophys. 2002 Feb 15;398(2):160-9.
20.
The human Nm23/nucleoside diphosphate kinases.
Lacombe ML, etal., J Bioenerg Biomembr. 2000 Jun;32(3):247-58.
21.
Increased activity of membrane-associated nucleoside diphosphate kinase and inhibition of cAMP synthesis in failing human myocardium.
Lutz S, etal., Cardiovasc Res. 2001 Jan;49(1):48-55.
22.
Expression of metastasis-related nm23-H1 and nm23-H2 genes in ovarian carcinomas: correlation with clinicopathology, EGFR, c-erbB-2, and c-erbB-3 genes, and sex steroid receptor expression.
Mandai M, etal., Cancer Res. 1994 Apr 1;54(7):1825-30.
23.
Nm23 expression in endometrial and cervical cancer: inverse correlation with lymph node involvement and myometrial invasion.
Marone M, etal., Br J Cancer. 1996 Oct;74(7):1063-8.
24.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
25.
Allelic loss and somatic differentiation in human male germ cell tumors.
Murty VV, etal., Oncogene. 1994 Aug;9(8):2245-51.
26.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
27.
Menin, a gene product responsible for multiple endocrine neoplasia type 1, interacts with the putative tumor metastasis suppressor nm23.
Ohkura N, etal., Biochem Biophys Res Commun. 2001 Apr 20;282(5):1206-10.
28.
A new function of Nm23/NDP kinase as a differentiation inhibitory factor, which does not require it's kinase activity.
Okabe-Kado J, etal., FEBS Lett. 1995 Apr 24;363(3):311-5.
29.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
30.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
31.
NM23-H2, an estrogen receptor beta-associated protein, shows diminished expression with progression of atherosclerosis.
Rayner K, etal., Am J Physiol Regul Integr Comp Physiol. 2007 Feb;292(2):R743-50. Epub 2006 Aug 3.
32.
GOA pipeline
RGD automated data pipeline
33.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
34.
Activated microglia modulate astroglial enzymes involved in oxidative and inflammatory stress and increase the resistance of astrocytes to oxidative stress in vitro.
Rohl C, etal., Glia. 2008 Aug 1;56(10):1114-26.
35.
Nucleoside diphosphate kinase beta (Nm23-R1/NDPKbeta) is associated with intermediate filaments and becomes upregulated upon cAMP-induced differentiation of rat C6 glioma.
Roymans D, etal., Exp Cell Res. 2000 Nov 25;261(1):127-38.
36.
Alterations of the metastasis suppressor gene nm23 and the proto-oncogene c-myc in human testicular germ cell tumors.
Schmidt B, etal., J Urol. 1997 Nov;158(5):2000-5.
37.
Reduced metastatic potential and c-myc overexpression of colon adenocarcinoma cells (Colon 26 line) transfected with nm23-R2/rat nucleoside diphosphate kinase alpha isoform.
Tagashira H, etal., Int J Mol Med. 1998 Jul;2(1):65-8.
38.
Low cytosine triphosphate synthase 2 expression renders resistance to 5-fluorouracil in colorectal cancer.
Tan WL, etal., Cancer Biol Ther. 2011 Mar 15;11(6):599-608. Epub 2011 Mar 15.
39.
Gamendazole, an orally active indazole carboxylic acid male contraceptive agent, targets HSP90AB1 (HSP90BETA) and EEF1A1 (eEF1A), and stimulates Il1a transcription in rat Sertoli cells.
Tash JS, etal., Biol Reprod. 2008 Jun;78(6):1139-52. doi: 10.1095/biolreprod.107.062679. Epub 2008 Jan 23.
40.
Down-regulation of expression and function of nucleoside diphosphate kinase in insulin-secreting beta-cells under in vitro conditions of glucolipotoxicity.
Veluthakal R, etal., Mol Cell Biochem. 2009 Sep;329(1-2):121-9. Epub 2009 Apr 15.
41.
Expression of nm23-H1 and nm23-H2 protein in endometrial carcinoma.
Watanabe J, etal., Br J Cancer. 1995 Dec;72(6):1469-73.
42.
Mapping the high-affinity binding domain of 5-substituted benzimidazoles to the proximal N-terminus of the GluN2B subunit of the NMDA receptor.
Wee XK, etal., Br J Pharmacol. 2010 Jan 1;159(2):449-61. Epub 2010 Jan 15.
43.
12-O-tetradecanoylphorbol-13-acetate and UV radiation-induced nucleoside diphosphate protein kinase B mediates neoplastic transformation of epidermal cells.
Wei SJ, etal., J Biol Chem. 2004 Feb 13;279(7):5993-6004. Epub 2003 Nov 17.
Nme2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 79,394,999 - 79,400,418 (-) NCBI GRCr8 mRatBN7.2 10 78,898,097 - 78,903,514 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 20 11,179,488 - 11,179,919 (-) Ensembl mRatBN7.2 Ensembl mRatBN7.2 Ensembl 10 78,897,770 - 78,903,538 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 83,508,941 - 83,514,439 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 83,007,040 - 83,012,538 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 78,478,407 - 78,483,899 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 81,648,216 - 81,653,717 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 81,648,216 - 81,653,717 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 81,478,178 - 81,483,679 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 82,582,766 - 82,588,269 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 82,597,135 - 82,602,639 (-) NCBI Celera 10 77,694,496 - 77,700,026 (-) NCBI Celera Cytogenetic Map 10 q26 NCBI
NME2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 17 51,165,536 - 51,171,744 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 17 51,165,435 - 51,171,744 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 17 49,242,897 - 49,249,105 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 17 46,597,890 - 46,604,104 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 17 46,598,810 - 46,604,103 NCBI Celera 17 45,704,144 - 45,710,358 (+) NCBI Celera Cytogenetic Map 17 q21.33 NCBI HuRef 17 44,612,062 - 44,618,375 (+) NCBI HuRef CHM1_1 17 49,307,431 - 49,313,740 (+) NCBI CHM1_1 T2T-CHM13v2.0 17 52,032,848 - 52,039,047 (+) NCBI T2T-CHM13v2.0
Nme2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 93,840,640 - 93,847,082 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 93,840,640 - 93,847,085 (-) Ensembl GRCm39 Ensembl GRCm38 11 93,949,814 - 93,956,256 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 93,949,814 - 93,956,259 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 93,811,129 - 93,817,321 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 93,765,904 - 93,772,097 (-) NCBI MGSCv36 mm8 Celera 11 103,564,861 - 103,571,040 (-) NCBI Celera Cytogenetic Map 11 D NCBI cM Map 11 58.88 NCBI
NME2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 19 67,353,449 - 67,359,441 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 17 72,160,643 - 72,166,512 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 17 45,255,982 - 45,261,541 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 17 50,126,867 - 50,131,776 (+) NCBI panpan1.1 PanPan1.1 panPan2
NME2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 9 27,002,114 - 27,005,740 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 9 27,001,733 - 27,015,934 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 9 26,330,716 - 26,333,823 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 9 27,795,956 - 27,799,595 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 9 27,795,346 - 27,799,595 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 9 26,562,504 - 26,565,610 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 9 26,822,054 - 26,825,171 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 9 26,952,138 - 26,955,247 (+) NCBI UU_Cfam_GSD_1.0
Nme2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405602 26,435,190 - 26,440,351 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936490 10,633,454 - 10,649,914 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936490 10,634,788 - 10,640,182 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
NME2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 12 27,439,260 - 27,445,027 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 12 27,439,529 - 27,445,025 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 12 27,507,399 - 27,513,382 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
LOC103242911 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 16 42,176,690 - 42,182,041 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 16 42,176,524 - 42,182,019 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666077 12,886,379 - 12,891,712 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
.
Predicted Target Of
Count of predictions: 29 Count of miRNA genes: 28 Interacting mature miRNAs: 29 Transcripts: ENSRNOT00000003611 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
1549846 Scl47 Serum cholesterol level QTL 47 3.6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 10 50574707 95574707 Rat 1298069 Bp168 Blood pressure QTL 168 5.5 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 10 26521957 98003205 Rat 2293669 Bmd33 Bone mineral density QTL 33 4.5 0.0001 femur strength trait (VT:0010010) femoral neck polar moment of inertia (CMO:0001670) 10 49444551 81709989 Rat 631552 Vetf2 Vascular elastic tissue fragility QTL 2 4.5 0.0002 aorta elastic tissue integrity trait (VT:0010556) artery internal elastic lamina non-tumorous lesion count (CMO:0001913) 10 41142633 86142633 Rat 61449 Ciaa2 CIA Autoantibody QTL 2 7.1 blood autoantibody amount (VT:0003725) calculated serum anti-type 2 collagen antibody titer (CMO:0001279) 10 63221094 107211142 Rat 61325 Aia5 Adjuvant induced arthritis QTL 5 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1298078 Stresp5 Stress response QTL 5 2.99 0.00025 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 42045676 104670812 Rat 2293679 Bmd30 Bone mineral density QTL 30 3.5 0.0001 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 10 49444551 81709989 Rat 1549831 Bss6 Bone structure and strength QTL 6 4 lumbar vertebra strength trait (VT:0010574) vertebra ultimate force (CMO:0001678) 10 57576521 102576521 Rat 70164 Bw21 Body weight QTL 21 4.36 0.00005 body mass (VT:0001259) body weight (CMO:0000012) 10 53797494 98952626 Rat 61463 Bp12 Blood pressure QTL 12 6.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 41333258 86333258 Rat 2298548 Neuinf7 Neuroinflammation QTL 7 3.4 nervous system integrity trait (VT:0010566) spinal cord RT1-B protein level (CMO:0002132) 10 72224939 107211142 Rat 1579919 Bp281 Blood pressure QTL 281 0.01 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 74372084 94965338 Rat 1302404 Cia27 Collagen induced arthritis QTL 27 2.6 0.0045 joint integrity trait (VT:0010548) experimental arthritis severity measurement (CMO:0001459) 10 76452683 107211142 Rat 1300107 Rf18 Renal function QTL 18 3.41 urine output (VT:0003620) timed urine volume (CMO:0000260) 10 78775516 98279596 Rat 8694173 Bw149 Body weight QTL 149 4.38 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 10 44441699 89441699 Rat 2300218 Hpcl2 Hepatic cholesterol level QTL 2 liver cholesterol amount (VT:0010498) liver cholesterol level (CMO:0001597) 10 45029650 95600334 Rat 1554317 Bmd4 Bone mineral density QTL 4 9.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 19816042 99406971 Rat 70171 Cari1 Carrageenan-induced inflammation QTL 1 4.9 0.0005 hypodermis integrity trait (VT:0010550) inflammatory exudate volume (CMO:0001429) 10 53797385 107211142 Rat 10450495 Bp383 Blood pressure QTL 383 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 76246085 94965338 Rat 61354 Pia10 Pristane induced arthritis QTL 10 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2292617 Ept18 Estrogen-induced pituitary tumorigenesis QTL 18 3.9 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 10 73453136 96120911 Rat 2301967 Cm73 Cardiac mass QTL 73 4.55 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 10 14487011 89062041 Rat 2313103 Bss80 Bone structure and strength QTL 80 2 0.0001 tibia strength trait (VT:1000284) tibia midshaft endosteal cross-sectional area (CMO:0001716) 10 62057807 107057807 Rat 2293646 Bss25 Bone structure and strength QTL 25 10.96 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 10 69738412 107211142 Rat 2303118 Mamtr7 Mammary tumor resistance QTL 7 0.003 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 9658275 104670812 Rat 70188 BpQTLcluster1 Blood pressure QTL cluster 1 4.864 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 42323132 87323132 Rat 2300172 Bmd57 Bone mineral density QTL 57 9.8 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 10 69738412 107211142 Rat 724516 Uae17 Urinary albumin excretion QTL 17 3.6 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 10 78210622 85220348 Rat 70193 Mcs7 Mammary carcinoma susceptibility QTL 7 2.38 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 10 72224939 107211142 Rat 2313105 Bss79 Bone structure and strength QTL 79 1.8 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 10 62057807 107057807 Rat 9589030 Epfw9 Epididymal fat weight QTL 9 19.24 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 10 44441699 89441699 Rat 1357344 Bp249 Blood pressure QTL 249 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 66743655 98003205 Rat 2316949 Gluco60 Glucose level QTL 60 3.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 14487011 107057807 Rat 2293652 Bmd22 Bone mineral density QTL 22 4.9 0.0001 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 10 49444551 81709989 Rat 70198 BpQTLcluster9 Blood pressure QTL cluster 9 2.94 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 42323132 87323132 Rat 2306970 Anxrr22 Anxiety related response QTL 22 5.95 fear/anxiety-related behavior trait (VT:1000241) number of periods of voluntary immobility (CMO:0001045) 10 61345276 98211570 Rat 1359017 Hrtrt21 Heart rate QTL 21 2.4 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 10 51772940 96772940 Rat 2293663 Bss33 Bone structure and strength QTL 33 9.34 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 10 69738412 107211142 Rat 7387312 Bw125 Body weight QTL 125 3 0.0047 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight (CMO:0000356) 10 64890616 107211142 Rat 2312672 Insul15 Insulin level QTL 15 0.01 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 10 57134272 102134272 Rat 2317029 Aia19 Adjuvant induced arthritis QTL 19 2.98 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 10 66978955 107211142 Rat 724556 Pur2 Proteinuria QTL 2 5.5 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 10 22427500 90627625 Rat 2306793 Ean5 Experimental allergic neuritis QTL 5 4.7 nervous system integrity trait (VT:0010566) IFNG-secreting splenocyte count (CMO:0002122) 10 72552416 93995749 Rat 61387 Bp1 Blood pressure QTL 1 5.1 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 10 51770177 107211142 Rat 2317039 Aia6 Adjuvant induced arthritis QTL 6 4.31 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 10 66978955 107211142 Rat 70223 Bp57 Blood pressure QTL 57 5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 1 80676123 Rat 2317043 Aia7 Adjuvant induced arthritis QTL 7 3.82 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 10 37565079 82565079 Rat 2317042 Aia20 Adjuvant induced arthritis QTL 20 3.38 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 10 37565079 82565079 Rat 2298481 Eau9 Experimental allergic uveoretinitis QTL 9 0.0169 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 10 65927233 82565079 Rat 61396 Bp9 Blood pressure QTL 9 4.8 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 68420376 107211142 Rat 1358915 Stresp7 Stress response QTL 7 3.52 blood norepinephrine amount (VT:0005663) plasma norepinephrine level (CMO:0001010) 10 78899655 87307728 Rat 70363 Bp71 Blood pressure QTL 71 0.04 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 61345276 81714865 Rat 61402 Niddm3 Non-insulin dependent diabetes mellitus QTL 3 4.58 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 61345413 82564856 Rat 1331791 Cm31 Cardiac mass QTL 31 3.84606 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 29299504 107211142 Rat 70364 Bp72 Blood pressure QTL 72 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 51121100 96121100 Rat 10450498 Bp384 Blood pressure QTL 384 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 67750049 107211142 Rat 4889492 Pancm2 Pancreatic morphology QTL 2 3.2 pancreatic beta cell morphology trait (VT:0005217) ratio of insulin-positive cell area to total area of splenic region of pancreas (CMO:0001814) 10 76748906 107211142 Rat 6893366 Bw106 Body weight QTL 106 0.3 0.47 body mass (VT:0001259) body weight (CMO:0000012) 10 70199100 107211142 Rat 2293698 Bss43 Bone structure and strength QTL 43 5.33 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 10 59209888 104209888 Rat 631530 Tls3 T-lymphoma susceptibility QTL 3 0 0.0001 thymus integrity trait (VT:0010555) percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911) 10 51774612 95600334 Rat 1354608 Cm33 Cardiac mass QTL 33 2.8 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 10 54809292 99809292 Rat 1558643 Cm44 Cardiac mass QTL 44 4.8 0.0000368 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 61345276 99703528 Rat 631535 Cm51 Cardiac mass QTL 51 3 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 10 51786282 91669536 Rat 1576319 Cia29 Collagen induced arthritis QTL 29 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 33973921 78973921 Rat 631267 Cia20 Collagen induced arthritis QTL 20 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2293705 Bmd25 Bone mineral density QTL 25 7.1 0.0001 femur mineral mass (VT:0010011) compact volumetric bone mineral density (CMO:0001730) 10 49444551 81709989 Rat 1576308 Schws1 Schwannoma susceptibility QTL 1 0.0041 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 10 40035094 102359817 Rat 631269 Cia22 Collagen induced arthritis QTL 22 8.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 631268 Cia21 Collagen induced arthritis QTL 21 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 14487011 104060283 Rat 7207811 Bmd90 Bone mineral density QTL 90 5.2 femur size trait (VT:1000369) femoral neck cross-sectional area (CMO:0001697) 10 49444551 81709989 Rat 631270 Cia23 Collagen induced arthritis QTL 23 3.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 7411614 Foco18 Food consumption QTL 18 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 10 44441699 89441699 Rat 2325836 Bp346 Blood pressure QTL 346 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 76246085 84007272 Rat 6893336 Cm75 Cardiac mass QTL 75 0.1 0.87 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 10 61345276 99703528 Rat 12880053 Cm104 Cardiac mass QTL 104 0.009 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 10 73452992 83463334 Rat 631547 Bp87 Blood pressure QTL 87 4.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 47369470 92369470 Rat 61427 Cia16 Collagen induced arthritis QTL 16 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 6357896 96121100 Rat 2292438 Bp311 Blood pressure QTL 311 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 76246085 107211142 Rat 2312662 Slep8 Serum leptin concentration QTL 8 0.05 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 10 57134272 102134272 Rat 12880050 Am10 Aortic mass QTL 10 0.016 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 10 74372084 84007272 Rat 6893342 Cm78 Cardiac mass QTL 78 0.1 0.88 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 10 42876766 79813922 Rat 1358188 Ept9 Estrogen-induced pituitary tumorigenesis QTL 9 3.9 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 10 73453136 96120911 Rat 631537 Oia4 Oil induced arthritis QTL 4 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 75631887 87055282 Rat 1642980 Bp300 Blood pressure QTL 300 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 68383129 107211142 Rat 631542 Bp82 Blood pressure QTL 82 6.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 26521957 98952741 Rat 2312668 Scl65 Serum cholesterol level QTL 65 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 10 57134272 102134272 Rat
D10Mgh23
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 78,899,655 - 78,899,894 (+) MAPPER mRatBN7.2 mRatBN7.2 10 78,899,655 - 78,899,805 (+) MAPPER mRatBN7.2 Rnor_6.0 10 81,649,775 - 81,649,924 NCBI Rnor6.0 Rnor_6.0 10 81,649,775 - 81,650,013 NCBI Rnor6.0 Rnor_5.0 10 81,479,737 - 81,479,886 UniSTS Rnor5.0 Rnor_5.0 10 81,479,737 - 81,479,975 UniSTS Rnor5.0 RGSC_v3.1 10 82,598,694 - 82,598,844 RGD Celera 10 77,696,055 - 77,696,204 UniSTS Celera 10 77,696,055 - 77,696,293 UniSTS RH 2.0 Map 10 835.7 RGD Cytogenetic Map 10 q26 UniSTS
RH135179
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 78,902,553 - 78,902,753 (+) MAPPER mRatBN7.2 Rnor_6.0 10 81,652,671 - 81,652,870 NCBI Rnor6.0 Rnor_5.0 10 81,482,633 - 81,482,832 UniSTS Rnor5.0 RGSC_v3.4 10 82,587,223 - 82,587,422 UniSTS RGSC3.4 Celera 10 77,698,980 - 77,699,179 UniSTS RH 3.4 Map 10 631.4 UniSTS Cytogenetic Map 10 q26 UniSTS
PMC312758P3
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 78,903,324 - 78,903,444 (+) MAPPER mRatBN7.2 Rnor_6.0 10 81,653,442 - 81,653,561 NCBI Rnor6.0 Rnor_5.0 10 81,483,404 - 81,483,523 UniSTS Rnor5.0 RGSC_v3.4 10 82,587,994 - 82,588,113 UniSTS RGSC3.4 Celera 10 77,699,751 - 77,699,870 UniSTS Cytogenetic Map 10 q26 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000003611 ⟹ ENSRNOP00000003611
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 78,897,770 - 78,903,538 (-) Ensembl Rnor_6.0 Ensembl 10 81,648,216 - 81,653,717 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000037297 ⟹ ENSRNOP00000087780
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 20 11,179,488 - 11,179,919 (-) Ensembl
RefSeq Acc Id:
NM_031833 ⟹ NP_114021
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 79,394,999 - 79,400,418 (-) NCBI mRatBN7.2 10 78,898,097 - 78,903,514 (-) NCBI Rnor_6.0 10 81,648,216 - 81,653,717 (-) NCBI Rnor_5.0 10 81,478,178 - 81,483,679 (-) NCBI RGSC_v3.4 10 82,582,766 - 82,588,269 (-) RGD Celera 10 77,694,496 - 77,700,026 (-) RGD
Sequence:
TGGCAAGATCAGGCAGGCTGAGCGTCCCGGGTTGGGCAGCGGGGTCCTCCGGGGTGTGGCGTCTCGCGTCCCGCCCCGCGCCCCTCCTCTCCGCGCGCCGGCTGGTGGTCGTTCTAGTCTCTGCTCTC
hide sequence
RefSeq Acc Id:
NP_114021 ⟸ NM_031833
- UniProtKB:
P19804 (UniProtKB/Swiss-Prot), A6HI34 (UniProtKB/TrEMBL), A0A8I6A4T4 (UniProtKB/TrEMBL)
- Sequence:
MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEK
hide sequence
Ensembl Acc Id:
ENSRNOP00000003611 ⟸ ENSRNOT00000003611
Ensembl Acc Id:
ENSRNOP00000087780 ⟸ ENSRNOT00000037297
RGD ID: 13697598 Promoter ID: EPDNEW_R8121 Type: initiation region Name: Nme2_1 Description: NME/NM23 nucleoside diphosphate kinase 2 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 10 81,653,604 - 81,653,664 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2012-10-05
Nme2
NME/NM23 nucleoside diphosphate kinase 2
Nme2
non-metastatic cells 2, protein (NM23B) expressed in
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-05-15
Nme2
non-metastatic cells 2, protein (NM23B) expressed in
Nme2
expressed in non-metastatic cells 2
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-01-20
Nme2
expressed in non-metastatic cells 2
nucleoside diphosphate kinase
Name updated
1299863 APPROVED
2002-08-07
Nme2
nucleoside diphosphate kinase
Symbol and Name status set to provisional
70820 PROVISIONAL
