Erp29 (endoplasmic reticulum protein 29)

Gene: Erp29 (endoplasmic reticulum protein 29) Rattus norvegicus

Analyze

Symbol:

Erp29

Name:

endoplasmic reticulum protein 29

RGD ID:

619781

Description:

Enables protein homodimerization activity and protein-folding chaperone binding activity. Predicted to be involved in several processes, including negative regulation of protein secretion; regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway; and regulation of gene expression. Located in smooth endoplasmic reticulum. Orthologous to human ERP29 (endoplasmic reticulum protein 29); PARTICIPATES IN codeine and morphine pharmacodynamics pathway; codeine and morphine pharmacokinetics pathway; etoposide pharmacodynamics pathway; INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,4,6-trinitrotoluene.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

endoplasmic reticulum protein ERp29; endoplasmic reticulum resident protein 29; endoplasmic reticulum resident protein 31; endoplasmic retuclum protein 29; ERp31

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ERP29 (endoplasmic reticulum protein 29)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Erp29 (endoplasmic reticulum protein 29)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Erp29 (endoplasmic reticulum protein 29)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ERP29 (endoplasmic reticulum protein 29)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ERP29 (endoplasmic reticulum protein 29)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Erp29 (endoplasmic reticulum protein 29)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ERP29 (endoplasmic reticulum protein 29)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ERP29 (endoplasmic reticulum protein 29)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Erp29 (endoplasmic reticulum protein 29)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	ERP29 (endoplasmic reticulum protein 29)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Erp29 (endoplasmic reticulum protein 29)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	wbl	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	erp29	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	40,750,177 - 40,756,607 (+)	NCBI		GRCr8
mRatBN7.2	12	35,089,698 - 35,095,952 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	35,089,707 - 35,096,376 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	12	36,262,678 - 36,268,916 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	36,873,883 - 36,880,123 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	35,926,324 - 35,932,562 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	40,619,377 - 40,625,884 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	40,619,377 - 40,625,883 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	12	42,486,492 - 42,492,999 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	12	36,225,110 - 36,231,363 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	12	36,085,146 - 36,094,834 (+)	NCBI
Celera	12	36,754,491 - 36,760,744 (+)	NCBI		Celera
Cytogenetic Map	12	q16	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

hepatocellular carcinoma (ISO)

lung adenocarcinoma (ISO)

Neoplasm Metastasis (ISO)

Prostatic Neoplasms (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,6-tribromophenol (ISO)

2,4,6-trinitrotoluene (EXP)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

2,4-dinitrotoluene (EXP)

2-methyl-2-[4-(1,2,3,4-tetrahydronaphthalen-1-yl)phenoxy]propanoic acid (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

3H-1,2-dithiole-3-thione (EXP)

4,4'-sulfonyldiphenol (EXP)

5-fluorouracil (ISO)

5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP)

6-propyl-2-thiouracil (EXP)

7,12-dimethyltetraphene (EXP)

acrylamide (ISO)

alachlor (EXP)

amiodarone (EXP)

amitriptyline (EXP)

amitrole (EXP)

ammonium chloride (EXP)

amphetamine (ISO)

apigenin (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

benzbromarone (EXP)

benzo[a]pyrene (ISO)

bexarotene (EXP)

bis(2-ethylhexyl) phthalate (EXP)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bisphenol F (EXP,ISO)

bromobenzene (EXP)

buspirone (EXP)

cadmium dichloride (EXP)

calycosin (ISO)

carbon nanotube (ISO)

clofibrate (EXP,ISO)

clofibric acid (EXP)

clomipramine (EXP)

CU-O LINKAGE (ISO)

decabromodiphenyl ether (ISO)

desferrioxamine B (ISO)

dexamethasone (EXP,ISO)

diazinon (ISO)

dicrotophos (ISO)

dopamine (EXP)

doxorubicin (ISO)

ethanol (ISO)

eurycomanone (ISO)

fenoldopam (EXP)

fenthion (ISO)

ferric ammonium citrate (ISO)

flutamide (EXP)

folic acid (ISO)

gentamycin (EXP)

glafenine (EXP)

hyaluronic acid (EXP)

hydrogen peroxide (EXP)

hypochlorous acid (ISO)

imipramine (EXP)

indometacin (ISO)

isoflavones (EXP)

isoprenaline (ISO)

ivermectin (ISO)

ketoconazole (EXP)

L-ethionine (EXP)

lovastatin (ISO)

Mesaconitine (EXP)

methidathion (ISO)

methimazole (EXP)

methotrexate (ISO)

microcystin RR (ISO)

N-nitrosodiethylamine (EXP)

N-nitrosomorpholine (EXP)

nafenopin (EXP)

Nonylphenol (EXP)

omeprazole (EXP)

paracetamol (ISO)

paraquat (EXP)

perfluorooctanoic acid (EXP)

phenobarbital (EXP)

pirinixic acid (EXP)

potassium chromate (ISO)

potassium dichromate (EXP)

pregnenolone 16alpha-carbonitrile (EXP)

quercetin (ISO)

SB 431542 (ISO)

senecionine (ISO)

sodium arsenite (ISO)

sodium dichromate (EXP,ISO)

Soman (EXP)

sulfadimethoxine (EXP)

sunitinib (ISO)

T-2 toxin (EXP)

tanespimycin (ISO)

tert-butyl hydroperoxide (ISO)

tetrachloroethene (ISO)

tetrachloromethane (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

troglitazone (EXP)

trovafloxacin (EXP)

tunicamycin (ISO)

valproic acid (ISO)

warfarin (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

intracellular protein transport (TAS)

negative regulation of gene expression (ISO)

negative regulation of protein secretion (ISO)

positive regulation of gene expression (ISO)

positive regulation of protein phosphorylation (ISO)

protein folding (TAS)

protein secretion (IEA)

regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway (ISO)

response to endoplasmic reticulum stress (NAS)

Cellular Component

cell surface (ISO)

endoplasmic reticulum (IBA,ISO)

endoplasmic reticulum lumen (TAS)

melanosome (IEA)

smooth endoplasmic reticulum (IDA)

Molecular Function

protein binding (IPI,ISO)

protein homodimerization activity (IPI)

protein-folding chaperone binding (IPI)

Molecular Pathway Annotations Click to see Annotation Detail View

codeine and morphine pharmacodynamics pathway (ISO)

codeine and morphine pharmacokinetics pathway (ISO)

Endoplasmic Reticulum-associated degradation pathway (IEA)

etoposide pharmacodynamics pathway (ISO)

etoposide pharmacokinetics pathway (ISO)

ibuprofen pharmacodynamics pathway (ISO)

ibuprofen pharmacokinetics pathway (ISO)

irinotecan pharmacodynamics pathway (ISO)

irinotecan pharmacokinetics pathway (ISO)

paracetamol pharmacokinetics pathway (ISO)

phenytoin pharmacodynamics pathway (ISO)

retinol metabolic pathway (ISO)

sorafenib pharmacokinetics pathway (ISO)

vitamin A deficiency pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Functional proteomics: The goalposts are moving.	Hubbard MJ Proteomics 2002 Sep;2(9):1069-78.
3.	An interaction map of endoplasmic reticulum chaperones and foldases.	Jansen G, etal., Mol Cell Proteomics. 2012 Sep;11(9):710-23. doi: 10.1074/mcp.M111.016550. Epub 2012 Jun 4.
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	A stress-inducible rat liver endoplasmic reticulum protein, ERp29.	Mkrtchian S, etal., Eur J Biochem 1998 Jan 15;251(1-2):304-13.
6.	Oligomerization properties of ERp29, an endoplasmic reticulum stress protein.	Mkrtchian S, etal., FEBS Lett. 1998 Jul 24;431(3):322-6.
7.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
9.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
10.	GOA pipeline	RGD automated data pipeline
11.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
12.	Genomic organization and promoter characterization of the gene encoding a putative endoplasmic reticulum chaperone, ERp29.	Sargsyan E, etal., Gene 2002 Feb 20;285(1-2):127-39.
13.	Identification of ERp29, an endoplasmic reticulum lumenal protein, as a new member of the thyroglobulin folding complex.	Sargsyan E, etal., J Biol Chem 2002 May 10;277(19):17009-15.

Additional References at PubMed

PMID:9037184	PMID:9738895	PMID:10727933	PMID:11435111	PMID:12477932	PMID:15281078	PMID:15572350	PMID:15865205	PMID:16380091	PMID:17267685	PMID:17296603	PMID:18395818
PMID:19321666	PMID:19946888	PMID:19995400	PMID:22064321	PMID:23376485	PMID:24370996	PMID:24512454	PMID:24794144	PMID:25204493	PMID:34123712

Genomics

Comparative Map Data

Erp29
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	40,750,177 - 40,756,607 (+)	NCBI		GRCr8
mRatBN7.2	12	35,089,698 - 35,095,952 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	35,089,707 - 35,096,376 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	12	36,262,678 - 36,268,916 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	36,873,883 - 36,880,123 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	35,926,324 - 35,932,562 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	40,619,377 - 40,625,884 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	40,619,377 - 40,625,883 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	12	42,486,492 - 42,492,999 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	12	36,225,110 - 36,231,363 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	12	36,085,146 - 36,094,834 (+)	NCBI
Celera	12	36,754,491 - 36,760,744 (+)	NCBI		Celera
Cytogenetic Map	12	q16	NCBI

ERP29
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	12	112,013,426 - 112,023,449 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	12	112,013,348 - 112,023,449 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	12	112,451,230 - 112,461,253 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	110,935,535 - 110,945,407 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	12	110,913,981 - 110,923,343	NCBI
Celera	12	112,076,622 - 112,086,494 (+)	NCBI		Celera
Cytogenetic Map	12	q24.13	NCBI
HuRef	12	109,464,438 - 109,474,310 (+)	NCBI		HuRef
CHM1_1	12	112,419,401 - 112,429,273 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	12	111,990,331 - 112,000,354 (+)	NCBI		T2T-CHM13v2.0

Erp29
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	121,582,816 - 121,590,537 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	121,566,653 - 121,590,569 (-)	Ensembl		GRCm39 Ensembl
GRCm38	5	121,444,753 - 121,452,474 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	121,428,590 - 121,452,506 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	5	121,894,762 - 121,902,483 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	5	121,705,370 - 121,713,091 (-)	NCBI		MGSCv36	mm8
Celera	5	118,534,620 - 118,542,346 (-)	NCBI		Celera
Cytogenetic Map	5	F	NCBI
cM Map	5	61.8	NCBI

Erp29
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955482	8,572,227 - 8,579,946 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955482	8,572,227 - 8,579,589 (+)	NCBI	ChiLan1.0	ChiLan1.0

ERP29
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	10	120,104,319 - 120,114,293 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	12	120,098,070 - 120,110,685 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	12	109,610,692 - 109,620,390 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	12	113,004,125 - 113,013,674 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	12	113,004,125 - 113,013,674 (+)	Ensembl	panpan1.1		panPan2

ERP29
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	26	9,608,352 - 9,616,711 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	26	9,608,399 - 9,616,338 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	26	9,727,228 - 9,735,252 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	26	9,846,360 - 9,854,389 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	26	9,846,421 - 9,855,488 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	26	9,823,443 - 9,831,474 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	26	9,886,854 - 9,894,877 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	26	9,933,751 - 9,942,250 (+)	NCBI		UU_Cfam_GSD_1.0

Erp29
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	154,940,483 - 154,948,059 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936558	4,531,471 - 4,538,943 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936558	4,531,397 - 4,538,943 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ERP29
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	39,687,000 - 39,695,752 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	14	39,687,028 - 39,695,748 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	42,178,792 - 42,187,512 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ERP29
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	11	107,244,359 - 107,255,293 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	11	107,244,335 - 107,256,499 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666037	137,833,226 - 137,844,448 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Erp29
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624747	20,166,371 - 20,175,012 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624747	20,167,197 - 20,174,914 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Erp29
36 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	312
Count of miRNA genes:	210
Interacting mature miRNAs:	229
Transcripts:	ENSRNOT00000001822
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
7411660	Foco28	Food consumption QTL 28	10.9	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
9590086	Insglur6	Insulin/glucose ratio QTL 6	18.97	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	12	1	42110980	Rat
8694179	Bw150	Body weight QTL 150	2.9	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	12	1	42110980	Rat
7411586	Foco5	Food consumption QTL 5	5.4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
7411595	Foco9	Food consumption QTL 9	4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
7411545	Bw128	Body weight QTL 128	5.2	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	12	1	42110980	Rat
9590147	Scort7	Serum corticosterone level QTL 7	13.61	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	12	1	42110980	Rat
2303575	Insul14	Insulin level QTL 14	4		blood insulin amount (VT:0001560)	blood insulin level (CMO:0000349)	12	1	42450532	Rat
737979	Pia22	Pristane induced arthritis QTL 22	53.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	1	44465750	Rat
634351	Apr5	Acute phase response QTL 5	6.7		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	12	1	44503507	Rat
2302042	Pia38	Pristane induced arthritis QTL 38	3.5	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	12	1	44503507	Rat
634350	Apr4	Acute phase response QTL 4	6		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	1172005	46172005	Rat
8552918	Pigfal7	Plasma insulin-like growth factor 1 level QTL 7			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564495	46669029	Rat
7411547	Bw129	Body weight QTL 129		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	5564495	46669029	Rat
7411597	Foco10	Food consumption QTL 10		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
7411641	Foco19	Food consumption QTL 19	27.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
8552964	Pigfal17	Plasma insulin-like growth factor 1 level QTL 17	3.5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564495	46669029	Rat
7411588	Foco6	Food consumption QTL 6		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
8552912	Pigfal6	Plasma insulin-like growth factor 1 level QTL 6	5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564498	46669029	Rat
10059594	Kidm46	Kidney mass QTL 46	3.79	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	12	6107579	46669029	Rat
1302792	Scl21	Serum cholesterol level QTL 21	3.8	0.0011	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	12	7196730	46669029	Rat
1549829	Scl48	Serum cholesterol level QTL 48	5		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	12	9603277	46669029	Rat
2293699	Bss49	Bone structure and strength QTL 49	5.61	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	12	10474137	46669029	Rat
2300186	Bmd59	Bone mineral density QTL 59	7.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	12	10474137	46669029	Rat
1331761	Bp218	Blood pressure QTL 218	2.973		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	11073825	45055165	Rat
61404	Bw120	Body weight QTL 120	5.1		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	12	12351619	46669029	Rat
1641928	Alcrsp5	Alcohol response QTL 5			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	12	12812385	46669029	Rat
2303569	Gluco44	Glucose level QTL 44	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	12812385	46669029	Rat
1549902	Bp269	Blood pressure QTL 269			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	13182736	46669029	Rat
1549912	Bp268	Blood pressure QTL 268			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	13182736	46669029	Rat
2302060	Pia37	Pristane induced arthritis QTL 37	6.1	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	12	13198157	46669029	Rat
61421	Cia12	Collagen induced arthritis QTL 12	4.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	13635523	35682913	Rat
631543	Bp83	Blood pressure QTL 83	5.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	15550826	38478808	Rat
631560	Apr1	Acute phase response QTL 1	6.1		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	19144362	46669029	Rat
737822	Alc10	Alcohol consumption QTL 10	2.2		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	12	19610870	40218516	Rat
5684888	Pia42	Pristane induced arthritis QTL 42			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	19610870	42828880	Rat
61324	Eae5	Experimental allergic encephalomyelitis QTL 5	14		nervous system integrity trait (VT:0010566)	percentage of study population developing relapsing-remitting experimental autoimmune encephalomyelitis during a period of time (CMO:0001402)	12	19610870	46669029	Rat
1298081	Cia25	Collagen induced arthritis QTL 25	4.7		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	19610889	35682913	Rat
70213	Niddm27	Non-insulin dependent diabetes mellitus QTL 27	3.72		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	19835789	38193007	Rat
7411643	Foco20	Food consumption QTL 20		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	20328819	46669029	Rat
70169	Eae13	Experimental allergic encephalomyelitis QTL 13		0.032	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	12	24139202	36638073	Rat
1556747	Calcic1	Intracellular calcium level QTL 1		3.6	platelet calcium amount (VT:0010500)	platelet intracellular calcium level (CMO:0000922)	12	28064433	40130419	Rat
1300175	Cm5	Cardiac mass QTL 5	3.78		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	12	28064433	45899022	Rat
1600386	Calcic2	Intracellular calcium level QTL 2		0.001	platelet physiology trait (VT:0005464)	platelet intracellular calcium level (CMO:0000922)	12	28064433	46669029	Rat
1331787	Rf41	Renal function QTL 41	2.998		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	12	28064557	40218380	Rat
631829	Alc6	Alcohol consumption QTL 6	4.7		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	12	28607526	37691617	Rat
1300162	Bp188	Blood pressure QTL 188	3.19		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	32103174	45899022	Rat

Markers in Region

D12Rat79

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	35,088,399 - 35,088,624 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	40,617,783 - 40,618,007	NCBI	Rnor6.0
Rnor_5.0	12	42,484,898 - 42,485,122	UniSTS	Rnor5.0
RGSC_v3.4	12	36,223,785 - 36,224,090	RGD	RGSC3.4
RGSC_v3.4	12	36,223,812 - 36,224,036	UniSTS	RGSC3.4
RGSC_v3.1	12	36,087,200 - 36,087,424	RGD
Celera	12	36,753,165 - 36,753,389	UniSTS
RH 3.4 Map	12	619.4	UniSTS
RH 3.4 Map	12	619.4	RGD
SHRSP x BN Map	12	44.35	UniSTS
SHRSP x BN Map	12	44.35	RGD
Cytogenetic Map	12	q16	UniSTS

RH128633

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	35,095,170 - 35,095,838 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	40,625,103 - 40,625,770	NCBI	Rnor6.0
Rnor_5.0	12	42,492,218 - 42,492,885	UniSTS	Rnor5.0
RGSC_v3.4	12	36,230,582 - 36,231,249	UniSTS	RGSC3.4
Celera	12	36,759,963 - 36,760,630	UniSTS
Cytogenetic Map	12	q16	UniSTS

RH129307

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	35,095,640 - 35,095,838 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	40,625,573 - 40,625,770	NCBI	Rnor6.0
Rnor_5.0	12	42,492,688 - 42,492,885	UniSTS	Rnor5.0
RGSC_v3.4	12	36,231,052 - 36,231,249	UniSTS	RGSC3.4
Celera	12	36,760,433 - 36,760,630	UniSTS
RH 3.4 Map	12	613.2	UniSTS
Cytogenetic Map	12	q16	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	42	57	41	19	41	2	4	74	35	41	11	2
Low		1					6	7					6
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_053961	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063271020	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AY004254	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC091129	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473973	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ211664	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ213671	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ218939	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220022	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ233694	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ234786	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000012	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U36482	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	Y10264	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000001822 ⟹ ENSRNOP00000001822

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	35,089,707 - 35,096,376 (+)	Ensembl
Rnor_6.0 Ensembl	12	40,619,377 - 40,625,883 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000081016 ⟹ ENSRNOP00000072413

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	12	40,619,392 - 40,625,590 (+)	Ensembl

RefSeq Acc Id:

NM_053961 ⟹ NP_446413

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	40,750,354 - 40,756,607 (+)	NCBI
mRatBN7.2	12	35,089,698 - 35,095,952 (+)	NCBI
Rnor_6.0	12	40,619,377 - 40,625,884 (+)	NCBI
Rnor_5.0	12	42,486,492 - 42,492,999 (+)	NCBI
RGSC_v3.4	12	36,225,110 - 36,231,363 (+)	RGD
Celera	12	36,754,491 - 36,760,744 (+)	RGD

Sequence:

show sequence

CCACAATCCGGCGTGATGGCTGCCGCCGTTCCTGGCGCCGTTTCGCTCTCCCCACTGCTGTCCG
TTCTCCTTGGCCTGCTGCTCCTCTCTGCTCCTCATGGCGCCAGCGGCCTGCACACGAAGGGCGC
CCTTCCCTTGGACACAGTCACTTTCTACAAGGTCATTCCCAAAAGCAAGTTCGTCTTGGTGAAG
TTCGACACCCAGTACCCCTATGGAGAGAAGCAAGATGAGTTTAAGCGTCTGGCTGAGAACTCAG
CCTCCAGCGATGATCTCTTGGTGGCAGAGGTGGGGATCTCAGACTATGGTGACAAGCTGAACAT
GGAGCTGAGTGAGAAGTACAAGCTGGACAAAGAGAGCTACCCAGTCTTCTACCTCTTCCGGGAT
GGGGACTTTGAGAATCCTGTCCCATACAGCGGGGCAGTTAAAGTTGGAGCCATCCAGCGCTGGC
TCAAGGGGCAGGGAGTCTATCTGGGCATGCCTGGATGTCTGCCTGCGTACGATGCCCTGGCGGG
CCAGTTCATCGAGGCCTCCAGCAGAGAGGCCCGCCAGGCCATCCTGAAACAGGGGCAGGATGGC
CTCTCAGGTGTGAAGGAGACAGACAAGAAGTGGGCCAGTCAGTACCTGAAGATCATGGGGAAGA
TCTTGGACCAAGGTGAAGACTTCCCGGCCTCCGAGCTGGCCCGGATCAGTAAGCTCATTGAGAA
CAAGATGAGTGAGGGTAAGAAGGAAGAGCTGCAGAGGAGCCTCAACATCCTCACCGCCTTCCGC
AAGAAAGGCGCCGAGAAGGAGGAGCTGTGAGGGCACCAGGCTGCTAGGGTTTGCTGAGGGCGGG
GAGGGAGAGCCGCCTGCTGACTGTGGGGCCCTGTGGGTGGAGGGGGCAGTGGAGCAAAGCAGTC
CTGAGCCAGAGACCTGTGCCCCGAGTGCCTGGACACTGAGGCTGCTGAGACCATACCCTGGACA
TCCTTGGAGCAGTTTGTGGGGAGCCTGTGTGCCAAGACAAGATGGCTGTGCCCCCACAGGAGCT
GGTACTATAGAGGAAGGTCCTTGACAGGTATAGTTCTGATCAAATAAAAGTCTGTTTTGGTTAG
ATGAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_063271020 ⟹ XP_063127090

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	40,750,177 - 40,755,110 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_446413	(Get FASTA)	NCBI Sequence Viewer
	XP_063127090	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAC15239	(Get FASTA)	NCBI Sequence Viewer
	AAF93170	(Get FASTA)	NCBI Sequence Viewer
	AAH91129	(Get FASTA)	NCBI Sequence Viewer
	CAA71313	(Get FASTA)	NCBI Sequence Viewer
	EDM13737	(Get FASTA)	NCBI Sequence Viewer
	EDM13738	(Get FASTA)	NCBI Sequence Viewer
	EDM13739	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000001822
	ENSRNOP00000001822.3
	ENSRNOP00055019263
	ENSRNOP00060002150
	ENSRNOP00065008743
GenBank Protein	P52555	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_446413 ⟸ NM_053961
- Peptide Label:	precursor
- UniProtKB:	P80749 (UniProtKB/Swiss-Prot), Q5BKC2 (UniProtKB/Swiss-Prot), P52555 (UniProtKB/Swiss-Prot), A6J1E8 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAAAVPGAVSLSPLLSVLLGLLLLSAPHGASGLHTKGALPLDTVTFYKVIPKSKFVLVKFDTQY PYGEKQDEFKRLAENSASSDDLLVAEVGISDYGDKLNMELSEKYKLDKESYPVFYLFRDGDFEN PVPYSGAVKVGAIQRWLKGQGVYLGMPGCLPAYDALAGQFIEASSREARQAILKQGQDGLSGVK ETDKKWASQYLKIMGKILDQGEDFPASELARISKLIENKMSEGKKEELQRSLNILTAFRKKGAE KEEL hide sequence

RefSeq Acc Id:

ENSRNOP00000072413 ⟸ ENSRNOT00000081016

RefSeq Acc Id:

ENSRNOP00000001822 ⟸ ENSRNOT00000001822

RefSeq Acc Id:	XP_063127090 ⟸ XM_063271020
- Peptide Label:	isoform X1

Protein Domains

Endoplasmic reticulum resident protein 29 C- ERp29 N-terminal

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P52555-F1-model_v2	AlphaFold	P52555	1-260	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13698655

Promoter ID:

EPDNEW_R9180

Type:

initiation region

Name:

Erp29_1

Description:

endoplasmic reticulum protein 29

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	12	40,619,337 - 40,619,397	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:619781	AgrOrtholog
BioCyc Gene	G2FUF-19211	BioCyc
Ensembl Genes	ENSRNOG00000001348	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
	ENSRNOG00055013763	UniProtKB/Swiss-Prot
	ENSRNOG00060002013	UniProtKB/Swiss-Prot
	ENSRNOG00065007665	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000001822	ENTREZGENE
	ENSRNOT00000001822.6	UniProtKB/Swiss-Prot
	ENSRNOT00055023659	UniProtKB/Swiss-Prot
	ENSRNOT00060003165	UniProtKB/Swiss-Prot
	ENSRNOT00065011982	UniProtKB/Swiss-Prot
Gene3D-CATH	1.20.1150.12	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Glutaredoxin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7308437	IMAGE-MGC_LOAD
InterPro	ERp29	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ERp29_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ERp29_C_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ERp29_N	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Thioredoxin-like_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:117030	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:108622	IMAGE-MGC_LOAD
NCBI Gene	117030	ENTREZGENE
PANTHER	ENDOPLASMIC RETICULUM PROTEIN ERP29	UniProtKB/TrEMBL
	ENDOPLASMIC RETICULUM RESIDENT PROTEIN 29	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR12211	UniProtKB/Swiss-Prot
Pfam	ERp29	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ERp29_N	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Erp29	PhenoGen
PIRSF	ER_p29	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	ER_TARGET	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000001348	RatGTEx
	ENSRNOG00055013763	RatGTEx
	ENSRNOG00060002013	RatGTEx
	ENSRNOG00065007665	RatGTEx
Superfamily-SCOP	ERP29 C domain-like	UniProtKB/TrEMBL, UniProtKB/Swiss-Prot
	SSF52833	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A6J1E8	ENTREZGENE, UniProtKB/TrEMBL
	A6J1F0_RAT	UniProtKB/TrEMBL
	ERP29_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	P80749	ENTREZGENE
	Q5BKC2	ENTREZGENE
UniProt Secondary	P80749	UniProtKB/Swiss-Prot
	Q5BKC2	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Name	Description	Reference	Status
2006-03-30	Erp29	endoplasmic reticulum protein 29	endoplasmic retuclum protein 29	Name updated	1299863	APPROVED
2004-12-14	Erp29	endoplasmic retuclum protein 29		Symbol and Name status set to approved	1299863	APPROVED
2002-08-07	Erp29	endoplasmic retuclum protein 29		Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_cellular_localization	soluble endoplasmic reticulum (ER) protein	70811
gene_domains	consists of two domains with the N-terminal domain resembling the a domain of human protein disulfide isomerase (PDI); C-terminal domain represents a novel all-helical fold, which is absent in human PDI but found in the P5-like PDIs	70811
gene_expression	expressed in all tissues examined	70811
gene_physical_interaction	associates with members of the thyroglobulin folding complex in the endoplasmic reticulum	728752
gene_process	may facilitate folding, posttranslational modifications and transport of the secretory proteins	70811
gene_process	may act as a chaperone in ovarian follicle cells, facilitating Golgi targeting of Pipe, an oligosaccharide-modifying enzyme involved in embryonic development	70811
gene_product	24.5 kDa protein	70811
gene_regulation	induced by ER stress and thyroid-stimulating hormone (TSH)	70811

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - CTD

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - CTD

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)