Ager (advanced glycosylation end product-specific receptor)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Ager (advanced glycosylation end product-specific receptor) Rattus norvegicus

Analyze

Symbol:

Ager

Name:

advanced glycosylation end product-specific receptor

RGD ID:

69258

Description:

Enables S100 protein binding activity and high mobility group box 1 binding activity. Involved in several processes, including positive regulation of apoptotic process; regulation of cell migration; and response to hexose. Located in several cellular components, including basal plasma membrane; cell surface; and neuronal cell body. Used to study several diseases, including diabetic retinopathy; impotence; renal fibrosis; thromboangiitis obliterans; and type 2 diabetes mellitus. Biomarker of several diseases, including bone disease (multiple); cardiovascular system disease (multiple); diabetic encephalopathy; gastrointestinal system disease (multiple); and lung disease (multiple). Human ortholog(s) of this gene implicated in several diseases, including autoimmune disease (multiple); cardiovascular system disease (multiple); cystic fibrosis; kidney failure (multiple); and lupus nephritis. Orthologous to human AGER (advanced glycosylation end-product specific receptor); PARTICIPATES IN Ras mediated signaling pathway; receptor for advanced glycation end-products signaling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4,6-trinitrobenzenesulfonic acid; 3,4-dihydroxybenzaldehyde.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

advanced glycosylation end product-specific receptor variant 2; advanced glycosylation end product-specific receptor variant 3; advanced glycosylation end product-specific receptor variant 4; advanced glycosylation end product-specific receptor variant 5; RAGE; receptor for advanced glycosylation end products

RGD Orthologs

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	20	4,148,150 - 4,151,361 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	4,147,890 - 4,151,078 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	20	4,854,742 - 4,857,677 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	20	4,216,494 - 4,219,429 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	20	4,747,395 - 4,750,329 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	20	4,363,152 - 4,366,079 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	4,363,152 - 4,366,079 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	20	6,442,508 - 6,445,435 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	20	4,250,613 - 4,253,540 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	20	4,250,839 - 4,253,767 (-)	NCBI
Celera	20	3,879,126 - 3,882,053 (+)	NCBI		Celera
Cytogenetic Map	20	p12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Acute Coronary Syndrome (ISO)

acute kidney failure (ISO)

Acute Lung Injury (IEP)

adult respiratory distress syndrome (IEP)

Albuminuria (IDA,ISO)

Alzheimer's disease (IDA,IEP,ISO)

Aortic Calcification (IEP)

aortic disease (IEP)

aspergillosis (ISO)

asthma (IDA,IEP,ISO)

atherosclerosis (IEP,ISO)

atrial fibrillation (ISO)

bacterial pneumonia (ISO)

Brain Injuries (IEP,ISO)

brain ischemia (IEP)

Breast Neoplasms (ISO)

Cardiac Fibrosis (IEP)

cardiovascular system disease (IEP,ISO)

carotid artery disease (IEP,ISO)

Carotid Artery Injuries (IMP)

cerebral infarction (ISO)

chorioamnionitis (ISO)

Chronic Allograft Dysfunction (IEP)

chronic kidney disease (ISO)

chronic obstructive pulmonary disease (ISO)

clear cell renal cell carcinoma (ISO)

colorectal carcinoma (IEP)

congestive heart failure (ISO)

contact dermatitis (ISO)

Cor pulmonale (ISO)

coronary artery disease (ISO)

Coronary Disease (ISO)

cystic fibrosis (ISO)

diabetes mellitus (ISO)

diabetic angiopathy (ISO)

Diabetic Cardiomyopathies (IDA,IEP)

diabetic encephalopathy (IEP)

Diabetic Foot (ISO)

Diabetic Nephropathies (IDA,IEP,ISO)

diabetic neuropathy (ISO)

diabetic retinopathy (IDA,IEP,ISO)

end stage renal disease (ISO)

Epidermal Hyperplasia (ISO)

Experimental Autoimmune Myocarditis (IEP)

Experimental Colitis (IEP)

Experimental Diabetes Mellitus (IDA,IEP,ISO)

Fibrosis (IDA)

gastrointestinal system disease (IDA,IEP)

genetic disease (ISO)

glomerulosclerosis (ISO)

Hyperalgesia (IEP,IMP,ISO)

hyperglycemia (ISO)

Hyperoxia (IEP)

hypertension (IEP,ISO)

Hypertrophy (ISO)

impotence (IDA)

Inflammation (ISO)

inflammatory bowel disease (ISO)

intracranial aneurysm (IEP)

invasive aspergillosis (ISO)

invasive ductal carcinoma (ISO)

JMP syndrome (ISO)

Kawasaki disease (ISO)

kidney disease (ISO)

Left Ventricular Hypertrophy (ISO)

leishmaniasis (ISO)

Lewy body dementia (ISO)

liver cirrhosis (ISO)

Liver Reperfusion Injury (IEP)

Lung Injury (IEP)

Lung Neoplasms (ISO)

lung non-small cell carcinoma (ISO)

lupus nephritis (ISO)

melanoma (ISO)

middle cerebral artery infarction (IEP,ISO)

mild cognitive impairment (ISO)

morbid obesity (ISO)

multiple sclerosis (ISO)

myocardial infarction (IEP,ISO)

Myocardial Ischemia (ISO)

Myocardial Reperfusion Injury (IEP)

Neointima (ISO)

neovascular inflammatory vitreoretinopathy (ISO)

Neuralgia (ISO)

obesity (ISO)

occupational asthma (ISO)

optic nerve disease (ISO)

osteoarthritis (IEP,ISO)

osteoporosis (IEP,ISO)

ovarian carcinoma (ISO)

pancreas disease (ISO)

pancreatic cancer (ISO)

periodontitis (IEP,ISO)

Peripheral Nerve Injuries (ISO)

Peritoneal Fibrosis (IDA)

polycystic kidney disease (ISO)

proliferative diabetic retinopathy (ISO)

prostate cancer (ISO)

proteinuria (ISO)

psoriasis (ISO)

pulmonary emphysema (ISO)

pulmonary fibrosis (IEP,ISO)

pulmonary hypertension (ISO)

renal fibrosis (IDA,ISO)

rheumatoid arthritis (ISO)

rosacea (ISO)

schistosomiasis (ISO)

schizophrenia (ISO)

schizotypal personality disorder (ISO)

Sepsis (IMP)

Skin Neoplasms (ISO)

Spinal Cord Injuries (IEP)

Stroke (IDA,ISO)

Subarachnoid Hemorrhage (IEP)

systemic lupus erythematosus (ISO)

systemic scleroderma (ISO)

Takayasu's arteritis (ISO)

thromboangiitis obliterans (IDA,IEP)

Tongue Neoplasms (IDA)

toxic shock syndrome (ISO)

transient cerebral ischemia (IEP,ISO)

tuberculosis (ISO)

type 1 diabetes mellitus (ISO)

type 2 diabetes mellitus (IDA,IEP,ISO)

uremia (IEP)

ureteral obstruction (ISO)

Vascular Calcification (ISO)

vascular skin disease (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-Nornicotine (ISO)

(-)-anisomycin (ISO)

(-)-cotinine (ISO)

(-)-epigallocatechin 3-gallate (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

2,2,2-tetramine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,6-trinitrobenzenesulfonic acid (EXP)

3,4-dihydroxybenzaldehyde (EXP,ISO)

3,4-methylenedioxymethamphetamine (ISO)

3-phenylprop-2-enal (EXP)

6-propyl-2-thiouracil (EXP)

acrolein (EXP,ISO)

acrylamide (ISO)

acteoside (ISO)

agomelatine (EXP)

aldehydo-D-glucose (EXP,ISO)

aldehydo-D-ribose (ISO)

all-trans-retinol (EXP)

allyl isothiocyanate (ISO)

alpha-D-galactose (EXP,ISO)

aminoguanidine (ISO)

amitrole (EXP)

ammonium chloride (EXP)

ampicillin (ISO)

anthocyanin (ISO)

anthra[1,9-cd]pyrazol-6(2H)-one (ISO)

aristolochic acid A (ISO)

arsane (EXP)

arsenic atom (EXP)

azathioprine (ISO)

benazepril (EXP)

benzo[a]pyrene (ISO)

berberine (EXP)

Bergenin (ISO)

bis(2-chloroethyl) sulfide (EXP)

bisphenol A (EXP,ISO)

Bisphenol A diglycidyl ether (EXP)

bleomycin A2 (EXP)

bortezomib (EXP)

butanal (ISO)

C60 fullerene (ISO)

cadmium dichloride (EXP)

calcitriol (EXP)

calycosin (EXP)

carbamazepine (ISO)

carbon nanotube (ISO)

carnosine (ISO)

chlorohydrocarbon (ISO)

cholesterol (ISO)

cisplatin (ISO)

curcumin (EXP)

D-glucose (EXP,ISO)

D-ribofuranose (ISO)

dapagliflozin (EXP)

dichlorine (EXP,ISO)

diclofenac (ISO)

dicloxacillin (ISO)

dioxygen (EXP)

disodium selenite (EXP)

estriol (ISO)

ethanol (ISO)

Ethyl pyruvate (ISO)

febuxostat (EXP)

flutamide (ISO)

fructose (EXP)

fulvestrant (ISO)

furan (EXP)

galactose (EXP,ISO)

galanthamine (EXP)

gallic acid (EXP)

genistein (EXP)

gentamycin (EXP)

geraniol (EXP)

glucose (EXP,ISO)

graphene oxide (ISO)

hesperetin (EXP)

Honokiol (ISO)

hydrogen peroxide (EXP)

indoprofen (ISO)

leflunomide (ISO)

linoleic acid (EXP)

lipopolysaccharide (EXP,ISO)

losartan (EXP)

luteolin (ISO)

LY294002 (EXP)

lycopene (ISO)

mangiferin (EXP)

mebendazole (ISO)

melatonin (ISO)

mesalamine (EXP)

metformin (EXP)

methimazole (EXP)

methylglyoxal (ISO)

methylmercury chloride (EXP)

naphthalene (ISO)

nitrofen (EXP)

oleanolic acid (ISO)

oxidopamine (EXP)

ozone (EXP)

paracetamol (EXP,ISO)

paraquat (EXP)

pentanal (ISO)

pentetrazol (EXP)

permethrin (ISO)

phorbol 13-acetate 12-myristate (ISO)

pioglitazone (EXP)

potassium dichromate (ISO)

pregnenolone 16alpha-carbonitrile (EXP)

procyanidin B2 (EXP)

procyanidin B3 (ISO)

propanal (ISO)

protein kinase inhibitor (EXP)

Pyridostigmine bromide (ISO)

quercetin (ISO)

reactive oxygen species (EXP)

resveratrol (ISO)

rotenone (ISO)

rutin (ISO)

SB 203580 (EXP)

silver atom (ISO)

silver(0) (ISO)

simvastatin (ISO)

sodium arsenite (EXP,ISO)

sodium fluoride (EXP)

streptozocin (EXP,ISO)

sulfadimethoxine (EXP)

sulfasalazine (EXP)

testosterone (ISO)

thioacetamide (EXP,ISO)

titanium dioxide (ISO)

toluene 2,4-diisocyanate (ISO)

trichloroethene (EXP)

triptonide (ISO)

tris(2-butoxyethyl) phosphate (ISO)

troglitazone (ISO)

vinclozolin (EXP)

zinc atom (EXP,ISO)

zinc(0) (EXP,ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

astrocyte activation (IEA,ISO)

astrocyte development (ISO)

cell adhesion (IEA)

cellular response to amyloid-beta (IEA,ISO)

cellular response to fatty acid (IEP)

cellular response to glucose stimulus (IEP)

cellular response to hydrogen peroxide (IEP)

cellular response to organic cyclic compound (IEP)

cellular response to xenobiotic stimulus (IEP)

glucose mediated signaling pathway (IEA,ISO)

glycoprotein metabolic process (IEP)

induction of positive chemotaxis (IEA,ISO)

inflammatory response (ISO)

learning or memory (IEA,ISO)

lung development (IEP)

microglial cell activation (IEA,ISO)

negative regulation of blood circulation (IEA,ISO)

negative regulation of cell adhesion (IMP)

negative regulation of collagen biosynthetic process (IMP)

negative regulation of connective tissue replacement involved in inflammatory response wound healing (ISO)

negative regulation of endothelial cell migration (IMP)

negative regulation of endothelial cell proliferation (IMP)

negative regulation of interleukin-10 production (IEA,ISO)

negative regulation of long-term synaptic depression (IEA,ISO)

negative regulation of long-term synaptic potentiation (IEA,ISO)

negative regulation of osteoblast proliferation (IEP)

negative regulation of protein phosphorylation (IMP)

neuron projection development (IEA,IGI,IMP,ISO)

positive regulation of activated T cell proliferation (IEA,ISO)

positive regulation of apoptotic process (IMP)

positive regulation of autophagy (IMP)

positive regulation of cell migration (IMP)

positive regulation of cellular process (IMP)

positive regulation of chemokine production (ISO)

positive regulation of dendritic cell differentiation (IEA,ISO)

positive regulation of endothelial cell apoptotic process (IMP)

positive regulation of endothelin production (IEA,ISO)

positive regulation of epithelial to mesenchymal transition (IMP)

positive regulation of ERK1 and ERK2 cascade (IEA,ISO)

positive regulation of fibroblast migration (IMP)

positive regulation of fibroblast proliferation (IMP)

positive regulation of gene expression (IMP)

positive regulation of heterotypic cell-cell adhesion (IEA,ISO)

positive regulation of interleukin-1 beta production (IEA,ISO)

positive regulation of interleukin-12 production (IEA,ISO)

positive regulation of interleukin-6 production (IEA,ISO)

positive regulation of JNK cascade (IEA,ISO)

positive regulation of monocyte chemotactic protein-1 production (IEA,ISO)

positive regulation of monocyte extravasation (IEA,ISO)

positive regulation of neuron apoptotic process (IMP)

positive regulation of non-canonical NF-kappaB signal transduction (IEA,ISO)

positive regulation of p38MAPK cascade (IEA,ISO)

positive regulation of phagocytosis, engulfment (IMP)

positive regulation of potassium ion transmembrane transporter activity (IMP)

positive regulation of protein phosphorylation (IEA,IMP,ISO)

positive regulation of reactive oxygen species metabolic process (IMP)

positive regulation of smooth muscle cell migration (IMP)

positive regulation of smooth muscle cell proliferation (IMP)

positive regulation of tumor necrosis factor production (IEA,ISO)

positive regulation of type B pancreatic cell apoptotic process (IMP)

protein localization to membrane (IEA,ISO)

receptor signaling pathway via JAK-STAT (IMP)

regulation of CD4-positive, alpha-beta T cell activation (IEA,ISO)

regulation of inflammatory response (IBA,IEA,ISO)

regulation of long-term synaptic potentiation (ISO)

regulation of p38MAPK cascade (IBA,ISO)

regulation of spontaneous synaptic transmission (IEA,ISO)

regulation of T cell mediated cytotoxicity (IEA,ISO)

response to activity (IEP)

response to amyloid-beta (ISO)

response to fructose (IEP)

response to genistein (IEP)

response to hyperoxia (IEP)

response to hypoxia (IEA,ISO)

response to methylglyoxal (IEP)

response to selenite ion (IEP)

response to vitamin A (IEP)

transcytosis (IEA,ISO)

transdifferentiation (IEP)

transport across blood-brain barrier (IEA,ISO)

Cellular Component

apical plasma membrane (IEA,ISO)

axon (IDA)

basal plasma membrane (IDA)

cell junction (IEA,ISO)

cell surface (IDA)

extracellular region (ISO)

extracellular space (IDA,ISO)

fibrillar center (IEA,ISO)

membrane (IEA)

neuronal cell body (IDA)

plasma membrane (IBA,ISO)

Molecular Function

advanced glycation end-product binding (ISO)

amyloid-beta binding (IEA,ISO)

heparin binding (ISO)

high mobility group box 1 binding (IPI)

identical protein binding (IEA,ISO)

laminin receptor activity (IBA)

molecular adaptor activity (ISO)

protein binding (IPI,ISO)

protein-containing complex binding (IEA,ISO)

S100 protein binding (IEA,IPI,ISO)

signaling receptor activity (IBA,IEA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

Ras mediated signaling pathway (IMP)

receptor for advanced glycation end-products signaling pathway (IMP)

References

References - curated

#	Reference Title	Reference Citation
1.	The relationship between receptor for advanced glycation end products expression and the severity of periodontal disease in the gingiva of diabetic and non diabetic periodontitis patients.	Abbass MM, etal., Arch Oral Biol. 2012 Jul 12.
2.	Proteomic analysis of lung tissues from patients with pulmonary arterial hypertension.	Abdul-Salam VB, etal., Circulation. 2010 Nov 16;122(20):2058-67. doi: 10.1161/CIRCULATIONAHA.110.972745. Epub 2010 Nov 1.
3.	Regulation of human melanoma growth and metastasis by AGE-AGE receptor interactions.	Abe R, etal., J Invest Dermatol. 2004 Feb;122(2):461-7.
4.	Identification of a functional interaction of HMGB1 with Receptor for Advanced Glycation End-products in a model of neuropathic pain.	Allette YM, etal., Brain Behav Immun. 2014 Jul 8. pii: S0889-1591(14)00364-X. doi: 10.1016/j.bbi.2014.06.199.
5.	Increased expression of advanced glycation end-products and their receptor, and activation of nuclear factor kappa-B in lacrimal glands of diabetic rats.	Alves M, etal., Diabetologia. 2005 Dec;48(12):2675-81. Epub 2005 Nov 8.
6.	Association analysis of nine candidate gene polymorphisms in Indian patients with type 2 diabetic retinopathy.	Balasubbu S, etal., BMC Med Genet. 2010 Nov 10;11:158. doi: 10.1186/1471-2350-11-158.
7.	-374 T/A RAGE Polymorphism Is Associated with Chronic Kidney Disease Progression in Subjects Affected by Nephrocardiovascular Disease.	Baragetti I, etal., PLoS One. 2013 Apr 4;8(4):e60089. doi: 10.1371/journal.pone.0060089. Print 2013.
8.	Down-regulation of the receptor for advanced glycation end-products (RAGE) supports non-small cell lung carcinoma.	Bartling B, etal., Carcinogenesis. 2005 Feb;26(2):293-301. Epub 2004 Nov 11.
9.	The genetic association database.	Becker KG, etal., Nat Genet. 2004 May;36(5):431-2.
10.	Predicting diabetic nephropathy using a multifactorial genetic model.	Blech I, etal., PLoS One. 2011 Apr 14;6(4):e18743. doi: 10.1371/journal.pone.0018743.
11.	The soluble form of the receptor of advanced glycation endproducts increases after bariatric surgery in morbid obesity.	Brix JM, etal., Int J Obes (Lond). 2012 Nov;36(11):1412-7. doi: 10.1038/ijo.2012.107. Epub 2012 Jul 17.
12.	Receptor for advanced-glycation end products: key modulator of myocardial ischemic injury.	Bucciarelli LG, etal., Circulation. 2006 Mar 7;113(9):1226-34. Epub 2006 Feb 27.
13.	RAGE and modulation of ischemic injury in the diabetic myocardium.	Bucciarelli LG, etal., Diabetes. 2008 Jul;57(7):1941-51. Epub 2008 Apr 16.
14.	Association of increased S100B, S100A6 and S100P in serum levels with acute coronary syndrome and also with the severity of myocardial infarction in cardiac tissue of rat models with ischemia-reperfusion injury.	Cai XY, etal., Atherosclerosis. 2011 Aug;217(2):536-42. Epub 2011 May 27.
15.	Arterial calcification is driven by RAGE in Enpp1-/- mice.	Cecil DL and Terkeltaub RA, J Vasc Res. 2011;48(3):227-35. doi: 10.1159/000318805. Epub 2010 Nov 23.
16.	Glycated matrix up-regulates inflammatory signaling similarly to Porphyromonas gingivalis lipopolysaccharide.	Chang PC, etal., J Periodontal Res. 2013 Apr;48(2):184-93. doi: 10.1111/j.1600-0765.2012.01519.x. Epub 2012 Aug 26.
17.	Puerarin enhances superoxide dismutase activity and inhibits RAGE and VEGF expression in retinas of STZ-induced early diabetic rats.	Chen F, etal., Asian Pac J Trop Med. 2012 Nov;5(11):891-6. doi: 10.1016/S1995-7645(12)60166-7.
18.	C-reactive protein down-regulates endothelial nitric oxide synthase expression and promotes apoptosis in endothelial progenitor cells through receptor for advanced glycation end-products.	Chen J, etal., Gene. 2012 Apr 1;496(2):128-35. doi: 10.1016/j.gene.2011.12.039. Epub 2012 Jan 18.
19.	Advanced glycation end-products activate extracellular signal-regulated kinase via the oxidative stress-EGF receptor pathway in renal fibroblasts.	Chen SC, etal., J Cell Biochem. 2010 Jan 1;109(1):38-48. doi: 10.1002/jcb.22376.
20.	Ancestral haplotype 8.1 and lung disease severity in European cystic fibrosis patients.	Corvol H, etal., J Cyst Fibros. 2012 Jan;11(1):63-7. Epub 2011 Oct 10.
21.	APPswe/Abeta regulation of osteoclast activation and RAGE expression in an age-dependent manner.	Cui S, etal., J Bone Miner Res. 2011 May;26(5):1084-98. doi: 10.1002/jbmr.299.
22.	Genetically-determined hyperfunction of the S100B/RAGE axis is a risk factor for aspergillosis in stem cell transplant recipients.	Cunha C, etal., PLoS One. 2011;6(11):e27962. doi: 10.1371/journal.pone.0027962. Epub 2011 Nov 17.
23.	The effects of vitamin A supplementation for 3 months on adult rat nigrostriatal axis: increased monoamine oxidase enzyme activity, mitochondrial redox dysfunction, increased beta-amyloid(1-40) peptide and TNF-alpha contents, and susceptibility of mitochondria to an in vitro H2O2 challenge.	de Oliveira MR, etal., Brain Res Bull. 2012 Mar 10;87(4-5):432-44. doi: 10.1016/j.brainresbull.2012.01.005. Epub 2012 Jan 18.
24.	Schistosoma mansoni infection causes oxidative stress and alters receptor for advanced glycation endproduct (RAGE) and tau levels in multiple organs in mice.	de Oliveira RB, etal., Int J Parasitol. 2013 Apr;43(5):371-9. doi: 10.1016/j.ijpara.2012.12.006. Epub 2013 Jan 29.
25.	Inhibition of the interaction of AGE-RAGE prevents hyperglycemia-induced fibrosis of the peritoneal membrane.	De Vriese AS, etal., J Am Soc Nephrol. 2003 Aug;14(8):2109-18.
26.	Myofibroblast transdifferentiation of mesothelial cells is mediated by RAGE and contributes to peritoneal fibrosis in uraemia.	De Vriese AS, etal., Nephrol Dial Transplant. 2006 Sep;21(9):2549-55. Epub 2006 Jun 6.
27.	RAGE mediates amyloid-beta peptide transport across the blood-brain barrier and accumulation in brain.	Deane R, etal., Nat Med 2003 Jul;9(7):907-13.
28.	Interaction between advanced glycation end products formation and vascular responses in femoral and coronary arteries from exercised diabetic rats.	Delbin MA, etal., PLoS One. 2012;7(12):e53318. doi: 10.1371/journal.pone.0053318. Epub 2012 Dec 28.
29.	The -374A allele of the receptor for advanced glycation end products gene is associated with a decreased risk of ischemic heart disease in African-Brazilians with type 2 diabetes.	dos Santos KG, etal., Mol Genet Metab. 2005 Jun;85(2):149-56. Epub 2005 Mar 24.
30.	Levels of soluble advanced glycation end product-receptors and other soluble serum markers as indicators of diabetic neuropathy in the foot.	El-Mesallamy HO, etal., J Investig Med. 2011 Dec;59(8):1233-8.
31.	Receptor for advanced glycation endproducts (RAGE) exhibits highly differential cellular and subcellular localisation in rat and human lung.	Fehrenbach H, etal., Cell Mol Biol (Noisy-le-grand). 1998 Nov;44(7):1147-57.
32.	Expression of high-mobility group box 1 and of receptor for advanced glycation end products in chronic obstructive pulmonary disease.	Ferhani N, etal., Am J Respir Crit Care Med. 2010 May 1;181(9):917-27. Epub 2010 Feb 4.
33.	Determinants of thromboxane biosynthesis in rheumatoid arthritis: Role of RAGE and oxidant stress.	Ferrante E, etal., Free Radic Biol Med. 2010 Sep 1;49(5):857-64. doi: 10.1016/j.freeradbiomed.2010.06.009. Epub 2010 Jun 10.
34.	Association of polymorphisms in the RAGE gene with serum CRP levels and coronary artery disease in the Chinese Han population.	Gao J, etal., J Hum Genet. 2010 Oct;55(10):668-75. Epub 2010 Jul 29.
35.	Expression of HMGB1 and RAGE in rat and human brains after traumatic brain injury.	Gao TL, etal., J Trauma Acute Care Surg. 2012 Mar;72(3):643-9. doi: 10.1097/TA.0b013e31823c54a6.
36.	RAGE-mediated interstitial fibrosis in neonatal obstructive nephropathy is independent of NF-kappaB activation.	Gasparitsch M, etal., Kidney Int. 2013 May 15. doi: 10.1038/ki.2013.171.
37.	Increased tau phosphorylation and receptor for advanced glycation endproducts (RAGE) in the brain of mice infected with Leishmania amazonensis.	Gasparotto J, etal., Brain Behav Immun. 2014 Jul 8. pii: S0889-1591(14)00389-4. doi: 10.1016/j.bbi.2014.06.204.
38.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
39.	RAGE signaling sustains inflammation and promotes tumor development.	Gebhardt C, etal., J Exp Med. 2008 Feb 18;205(2):275-85. doi: 10.1084/jem.20070679. Epub 2008 Jan 21.
40.	Vitamin A (retinol) up-regulates the receptor for advanced glycation endproducts (RAGE) through p38 and Akt oxidant-dependent activation.	Gelain DP, etal., Toxicology. 2011 Oct 28;289(1):38-44. doi: 10.1016/j.tox.2011.07.008. Epub 2011 Jul 23.
41.	The possible role of esRAGE and sRAGE in the natural history of diabetic nephropathy in childhood.	Giannini C, etal., Pediatr Nephrol. 2012 Feb;27(2):269-75. doi: 10.1007/s00467-011-1988-5. Epub 2011 Aug 26.
42.	The pleiotropic actions of rosuvastatin confer renal benefits in the diabetic Apo-E knockout mouse.	Giunti S, etal., Am J Physiol Renal Physiol. 2010 Sep;299(3):F528-35. doi: 10.1152/ajprenal.00127.2010. Epub 2010 Jun 16.
43.	The - 429 T/C and - 374 T/A gene polymorphisms of the receptor of advanced glycation end products gene are not risk factors for diabetic retinopathy in Caucasians with type 2 diabetes.	Globocnik Petrovic M, etal., Klin Monbl Augenheilkd. 2003 Dec;220(12):873-6.
44.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
45.	Expression of receptor for advanced glycation end products (RAGE) on the surface of circulating endothelial cells is upregulated in Kawasaki disease.	Gong F, etal., Pediatr Res. 2012 Jun;71(6):720-4. doi: 10.1038/pr.2012.27. Epub 2012 Feb 15.
46.	Modulation of RAGE isoforms expression in the brain and plasma of rats exposed to transient focal cerebral ischemia.	Greco R, etal., Neurochem Res. 2012 Jul;37(7):1508-16. doi: 10.1007/s11064-012-0778-1. Epub 2012 Apr 19.
47.	High-glucose and advanced glycosylation end products increased podocyte permeability via PI3-K/Akt signaling.	Ha TS J Mol Med (Berl). 2010 Apr;88(4):391-400. doi: 10.1007/s00109-009-0575-8. Epub 2010 Jan 8.
48.	Targeted reduction of advanced glycation improves renal function in obesity.	Harcourt BE, etal., Kidney Int. 2011 Jul;80(2):190-8. doi: 10.1038/ki.2011.57. Epub 2011 Mar 16.
49.	Genotyping of -374A/T, -429A/G, and 63 bp Ins/del polymorphisms of RAGE by rapid one-step hexaprimer amplification refractory mutation system polymerase chain reaction in breast cancer patients.	Hashemi M, etal., Nucleosides Nucleotides Nucleic Acids. 2012 May;31(5):401-10. doi: 10.1080/15257770.2012.665545.
50.	Intrathecal Lentivirus-mediated Transfer of Interleukin-10 Attenuates Chronic Constriction Injury-induced Neuropathic Pain through Modulation of Spinal High-mobility Group Box 1 in Rats.	He Z, etal., Pain Physician. 2013 Sep-Oct;16(5):E615-25.
51.	The receptor for advanced glycation end products (RAGE) is a cellular binding site for amphoterin. Mediation of neurite outgrowth and co-expression of rage and amphoterin in the developing nervous system.	Hori O, etal., J Biol Chem 1995 Oct 27;270(43):25752-61.
52.	ERK and Akt signaling pathways are involved in advanced glycation end product-induced autophagy in rat vascular smooth muscle cells.	Hu P, etal., Int J Mol Med. 2012 Apr;29(4):613-8. doi: 10.3892/ijmm.2012.891. Epub 2012 Jan 23.
53.	Role of receptor for advanced glycation end-product (RAGE) and the JAK/STAT-signaling pathway in AGE-induced collagen production in NRK-49F cells.	Huang JS, etal., J Cell Biochem. 2001;81(1):102-13.
54.	Effects of novel polymorphisms in the RAGE gene on transcriptional regulation and their association with diabetic retinopathy.	Hudson BI, etal., Diabetes. 2001 Jun;50(6):1505-11.
55.	Hypoxia promotes danger-mediated inflammation via receptor for advanced glycation end products in cystic fibrosis.	Iannitti RG, etal., Am J Respir Crit Care Med. 2013 Dec 1;188(11):1338-50. doi: 10.1164/rccm.201305-0986OC.
56.	Receptor for advanced glycation end products (RAGE) and its ligand, amphoterin are overexpressed and associated with prostate cancer development.	Ishiguro H, etal., Prostate. 2005 Jun 15;64(1):92-100.
57.	Amyloid-beta-induced astrocytic phagocytosis is mediated by CD36, CD47 and RAGE.	Jones RS, etal., J Neuroimmune Pharmacol. 2013 Mar;8(1):301-11. doi: 10.1007/s11481-012-9427-3. Epub 2012 Dec 14.
58.	DNA aptamer raised against AGEs blocks the progression of experimental diabetic nephropathy.	Kaida Y, etal., Diabetes. 2013 Apr 29.
59.	Genetic predisposition to advanced glycation end products toxicity is related to prognosis of chronic hemodialysis patients.	Kalousova M, etal., Kidney Blood Press Res. 2010;33(1):30-6. doi: 10.1159/000285845. Epub 2010 Feb 23.
60.	Association of RAGE gene polymorphisms with type 2 diabetes mellitus, diabetic retinopathy and diabetic nephropathy.	Kang P, etal., Gene. 2012 May 25;500(1):1-9. doi: 10.1016/j.gene.2012.03.056. Epub 2012 Mar 23.
61.	Polymorphisms in the RAGE gene influence susceptibility to diabetes-associated microvascular dermatoses in NIDDM.	Kankova K, etal., J Diabetes Complications. 2001 Jul-Aug;15(4):185-92.
62.	Polymorphisms 1704G/T, 2184A/G, and 2245G/A in the rage gene are not associated with diabetic retinopathy in NIDDM: pilot study.	Kankova K, etal., Retina. 2002 Feb;22(1):119-21.
63.	Angiotensin II type 1 receptor blocker attenuates diabetes-induced atrial structural remodeling.	Kato T, etal., J Cardiol. 2011 Sep;58(2):131-6. doi: 10.1016/j.jjcc.2011.06.003. Epub 2011 Jul 30.
64.	High mobility group box 1 is upregulated after spinal cord injury and is associated with neuronal cell apoptosis.	Kawabata H, etal., Spine (Phila Pa 1976). 2010 May 15;35(11):1109-15.
65.	Pentosidine as a biomarker for microvascular complications in type 2 diabetic patients.	Kerkeni M, etal., Diab Vasc Dis Res. 2013 May;10(3):239-45. doi: 10.1177/1479164112460253. Epub 2012 Oct 22.
66.	Plasma levels of soluble receptor for advanced glycation end products (sRAGE) and proinflammatory ligand for RAGE (EN-RAGE) are associated with carotid atherosclerosis in patients with peritoneal dialysis.	Kim JK, etal., Atherosclerosis. 2012 Jan;220(1):208-14. Epub 2011 Aug 5.
67.	High-mobility-group box protein 1 A box reduces development of sodium laurate-induced thromboangiitis obliterans in rats.	Kong X, etal., J Vasc Surg. 2013 Jan;57(1):194-204. doi: 10.1016/j.jvs.2012.06.083. Epub 2012 Oct 13.
68.	Abeta1-42-RAGE Interaction Disrupts Tight Junctions of the Blood-Brain Barrier Via Ca2+-Calcineurin Signaling.	Kook SY, etal., J Neurosci. 2012 Jun 27;32(26):8845-54.
69.	Analysis of AGE modified proteins and RAGE expression in HER2/neu negative invasive ductal carcinoma.	Korwar AM, etal., Biochem Biophys Res Commun. 2012 Mar 16;419(3):490-4. doi: 10.1016/j.bbrc.2012.02.039. Epub 2012 Feb 14.
70.	Soluble receptor for advanced glycation end-products (sRAGE) and polymorphisms of RAGE and glyoxalase I genes in patients with pancreas cancer.	Krechler T, etal., Clin Biochem. 2010 Apr 14.
71.	Activation of the receptor for advanced glycation end products triggers a p21(ras)-dependent mitogen-activated protein kinase pathway regulated by oxidant stress.	Lander HM, etal., J Biol Chem. 1997 Jul 11;272(28):17810-4.
72.	Effects of monascin on anti-inflammation mediated by Nrf2 activation in advanced glycation end product-treated THP-1 monocytes and methylglyoxal-treated wistar rats.	Lee BH, etal., J Agric Food Chem. 2013 Feb 13;61(6):1288-98. doi: 10.1021/jf305067n. Epub 2013 Jan 31.
73.	The effect of soluble RAGE on inhibition of angiotensin II-mediated atherosclerosis in apolipoprotein E deficient mice.	Lee D, etal., PLoS One. 2013 Aug 1;8(8):e69669. doi: 10.1371/journal.pone.0069669. Print 2013.
74.	Coenzyme Q10 ameliorates pain and cartilage degradation in a rat model of osteoarthritis by regulating nitric oxide and inflammatory cytokines.	Lee J, etal., PLoS One. 2013 Jul 22;8(7):e69362. doi: 10.1371/journal.pone.0069362. Print 2013.
75.	The protective effect of Salvia miltiorrhiza in an animal model of early experimentally induced diabetic nephropathy.	Lee SH, etal., J Ethnopharmacol. 2011 Oct 11;137(3):1409-14. doi: 10.1016/j.jep.2011.08.007. Epub 2011 Aug 11.
76.	Calcitriol modulates receptor for advanced glycation end products (RAGE) in diabetic hearts.	Lee TW, etal., Int J Cardiol. 2014 May 1;173(2):236-41. doi: 10.1016/j.ijcard.2014.02.041. Epub 2014 Feb 28.
77.	Keratinocyte-specific deletion of the receptor RAGE modulates the kinetics of skin inflammation in vivo.	Leibold JS, etal., J Invest Dermatol. 2013 Oct;133(10):2400-6. doi: 10.1038/jid.2013.185. Epub 2013 Apr 17.
78.	Circulating soluble receptor for advanced glycation end product (sRAGE) and left ventricular hypertrophy in patients with chronic kidney disease (CKD).	Leonardis D, etal., Nutr Metab Cardiovasc Dis. 2012 Sep;22(9):748-55. doi: 10.1016/j.numecd.2010.11.008. Epub 2011 Apr 5.
79.	Beneficial effects of a novel RAGE inhibitor on early diabetic retinopathy and tactile allodynia.	Li G, etal., Mol Vis. 2011;17:3156-65. Epub 2011 Dec 6.
80.	Expression and cell distribution of receptor for advanced glycation end-products in the rat cortex following experimental subarachnoid hemorrhage.	Li H, etal., Brain Res. 2014 Jan 16;1543:315-23. doi: 10.1016/j.brainres.2013.11.023. Epub 2013 Nov 26.
81.	A functional p.82G>S polymorphism in the RAGE gene is associated with multiple sclerosis in the Chinese population.	Li K, etal., Mult Scler. 2011 Aug;17(8):914-21. Epub 2011 Apr 20.
82.	Amyloid beta interaction with receptor for advanced glycation end products up-regulates brain endothelial CCR5 expression and promotes T cells crossing the blood-brain barrier.	Li M, etal., J Immunol. 2009 May 1;182(9):5778-88.
83.	Grape seed proanthocyanidins ameliorate diabetic nephropathy via modulation of levels of AGE, RAGE and CTGF.	Li X, etal., Nephron Exp Nephrol. 2009;111(2):e31-41. Epub 2009 Jan 13.
84.	Peroxisome proliferator-activated receptor delta downregulates the expression of the receptor for advanced glycation end products and pro-inflammatory cytokines in the kidney of streptozotocin-induced diabetic mice.	Liang YJ, etal., Eur J Pharm Sci. 2011 May 18;43(1-2):65-70. doi: 10.1016/j.ejps.2011.03.011. Epub 2011 Mar 31.
85.	Receptor for advanced glycation end products (RAGE) partially mediates HMGB1-ERKs activation in clear cell renal cell carcinoma.	Lin L, etal., J Cancer Res Clin Oncol. 2012 Jan;138(1):11-22. doi: 10.1007/s00432-011-1067-0. Epub 2011 Sep 24.
86.	The -374 T/A polymorphism in the gene encoding RAGE is associated with diabetic nephropathy and retinopathy in type 1 diabetic patients.	Lindholm E, etal., Diabetologia. 2006 Nov;49(11):2745-55. Epub 2006 Sep 13.
87.	HMGB1 in ischemic and non-ischemic liver after selective warm ischemia/reperfusion in rat.	Liu A, etal., Histochem Cell Biol. 2011 May;135(5):443-52. doi: 10.1007/s00418-011-0802-6. Epub 2011 Mar 24.
88.	Effect of tangweian jianji on upper gastrointestinal remodeling in streptozotocin-induced diabetic rats.	Liu GF, etal., World J Gastroenterol. 2012 Sep 21;18(35):4875-84.
89.	Regulation of beta-amyloid level in the brain of rats with cerebrovascular hypoperfusion.	Liu H, etal., Neurobiol Aging. 2012 Apr;33(4):826.e31-42. doi: 10.1016/j.neurobiolaging.2011.05.027. Epub 2011 Aug 3.
90.	Evaluation of the Effect of Different Doses of Low Energy Shock Wave Therapy on the Erectile Function of Streptozotocin (STZ)-Induced Diabetic Rats.	Liu J, etal., Int J Mol Sci. 2013 May 21;14(5):10661-73. doi: 10.3390/ijms140510661.
91.	Benazepril, an angiotensin-converting enzyme inhibitor, alleviates renal injury in spontaneously hypertensive rats by inhibiting advanced glycation end-product-mediated pathways.	Liu XP, etal., Clin Exp Pharmacol Physiol. 2009 Mar;36(3):287-96. Epub 2008 Nov 10.
92.	AGEs increased migration and inflammatory responses of adventitial fibroblasts via RAGE, MAPK and NF-kappaB pathways.	Liu Y, etal., Atherosclerosis. 2010 Jan;208(1):34-42. Epub 2009 Jun 17.
93.	Cerebroprotective effects of ibuprofen on diabetic encephalopathy in rats.	Liu YW, etal., Pharmacol Biochem Behav. 2014 Feb;117:128-36. doi: 10.1016/j.pbb.2013.11.027. Epub 2013 Dec 1.
94.	Suppression of methylglyoxal hyperactivity by mangiferin can prevent diabetes-associated cognitive decline in rats.	Liu YW, etal., Psychopharmacology (Berl). 2013 Mar 26.
95.	Developmental expression of the receptor for advanced glycation end-products (RAGE) and its response to hyperoxia in the neonatal rat lung.	Lizotte PP, etal., BMC Dev Biol. 2007 Mar 7;7:15.
96.	Effects of atorvastatin on progression of diabetic nephropathy and local RAGE and soluble RAGE expressions in rats.	Lu L, etal., J Zhejiang Univ Sci B. 2011 Aug;12(8):652-9. doi: 10.1631/jzus.B1101004.
97.	RAGE is expressed in pyramidal cells of the hippocampus following moderate hypoxic-ischemic brain injury in rats.	Ma L, etal., Brain Res. 2003 Mar 21;966(2):167-74.
98.	Serum levels of soluble receptor for advanced glycation end products (sRAGE) in Takayasu's arteritis.	Mahajan N, etal., Int J Cardiol. 2010 Dec 3;145(3):589-91. doi: 10.1016/j.ijcard.2010.05.075. Epub 2010 Jun 26.
99.	Fisetin lowers methylglyoxal dependent protein glycation and limits the complications of diabetes.	Maher P, etal., PLoS One. 2011;6(6):e21226. doi: 10.1371/journal.pone.0021226. Epub 2011 Jun 27.
100.	Retinal upregulation of inflammatory and proangiogenic markers in a model of neonatal diabetic rats fed on a high-fat-diet.	Mancini JE, etal., BMC Ophthalmol. 2013 Apr 15;13(1):14.
101.	Receptor for advanced glycation end products (RAGE) polymorphisms are associated with systemic lupus erythematosus and disease severity in lupus nephritis.	Martens H, etal., Lupus. 2012 Apr 18.
102.	Relation between development of nephropathy and the p22phox C242T and receptor for advanced glycation end product G1704T gene polymorphisms in type 2 diabetic patients.	Matsunaga-Irie S, etal., Diabetes Care. 2004 Feb;27(2):303-7.
103.	RAGE-dependent activation of the oncoprotein Pim1 plays a critical role in systemic vascular remodeling processes.	Meloche J, etal., Arterioscler Thromb Vasc Biol. 2011 Sep;31(9):2114-24. doi: 10.1161/ATVBAHA.111.230573. Epub 2011 Jun 16.
104.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
105.	Soluble receptor for advanced glycation end products in COPD: relationship with emphysema and chronic cor pulmonale: a case-control study.	Miniati M, etal., Respir Res. 2011 Mar 30;12:37.
106.	Deletion of bone marrow-derived receptor for advanced glycation end products inhibits atherosclerotic plaque progression.	Morris-Rosenfeld S, etal., Eur J Clin Invest. 2011 Nov;41(11):1164-71. doi: 10.1111/j.1365-2362.2011.02514.x. Epub 2011 Mar 21.
107.	Glucose degradation products result in cardiovascular toxicity in a rat model of renal failure.	Muller-Krebs S, etal., Perit Dial Int. 2010 Jan-Feb;30(1):35-40. doi: 10.3747/pdi.2009.00031.
108.	Calcium channel blocker inhibition of AGE and RAGE axis limits renal injury in nondiabetic patients with stage I or II chronic kidney disease.	Nakamura T, etal., Clin Cardiol. 2011 Jun;34(6):372-7. doi: 10.1002/clc.20885. Epub 2011 Mar 22.
109.	Effects of icodextrin peritoneal dialysis solution on the peritoneal membrane in the STZ-induced diabetic rat model with partial nephrectomy.	Nakao A, etal., Nephrol Dial Transplant. 2010 May;25(5):1479-88. doi: 10.1093/ndt/gfp479. Epub 2009 Sep 16.
110.	Endogenous soluble receptor of advanced glycation end-products (esRAGE) is negatively associated with vascular calcification in non-diabetic hemodialysis patients.	Nasrallah MM, etal., Int Urol Nephrol. 2012 Aug;44(4):1193-9. doi: 10.1007/s11255-011-0007-x. Epub 2011 Jun 4.
111.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
112.	2245G/A polymorphism of the receptor for advanced glycation end-products (RAGE) gene is associated with diabetic retinopathy in the Malaysian population.	Ng ZX, etal., Br J Ophthalmol. 2012 Feb;96(2):289-92. doi: 10.1136/bjophthalmol-2011-300658. Epub 2011 Nov 24.
113.	Association analysis of -429T/C and -374T/A polymorphisms of receptor of advanced glycation end products (RAGE) gene in Malaysian with type 2 diabetic retinopathy.	Ng ZX, etal., Diabetes Res Clin Pract. 2012 Mar;95(3):372-7. doi: 10.1016/j.diabres.2011.11.005. Epub 2011 Dec 9.
114.	Lack of association between Gly82Ser, 1704G/T and 2184A/G of RAGE gene polymorphisms and retinopathy susceptibility in Malaysian diabetic patients.	Ng ZX, etal., Genet Mol Res. 2012 Mar 1;11(1):455-61. doi: 10.4238/2012.March.1.2.
115.	Neamine induces neuroprotection after acute ischemic stroke in type one diabetic rats.	Ning R, etal., Neuroscience. 2014 Jan 17;257:76-85. doi: 10.1016/j.neuroscience.2013.10.071. Epub 2013 Nov 8.
116.	Anti-high mobility group box-1 antibody therapy for traumatic brain injury.	Okuma Y, etal., Ann Neurol. 2012 Sep;72(3):373-84. doi: 10.1002/ana.23602. Epub 2012 Aug 22.
117.	Glycyrrhizin inhibits traumatic brain injury by reducing HMGB1-RAGE interaction.	Okuma Y, etal., Neuropharmacology. 2014 Oct;85:18-26. doi: 10.1016/j.neuropharm.2014.05.007. Epub 2014 May 20.
118.	Upregulation of RAGE and its ligands in proliferative retinal disease.	Pachydaki SI, etal., Exp Eye Res. 2006 May;82(5):807-15. Epub 2005 Dec 20.
119.	Genistein modulates NF-kappaB-associated renal inflammation, fibrosis and podocyte abnormalities in fructose-fed rats.	Palanisamy N, etal., Eur J Pharmacol. 2011 Sep 30;667(1-3):355-64. doi: 10.1016/j.ejphar.2011.06.011. Epub 2011 Jun 17.
120.	The relationship between RAGE gene four common polymorphisms and breast cancer risk in northeastern Han Chinese.	Pan H, etal., Sci Rep. 2014 Mar 12;4:4355. doi: 10.1038/srep04355.
121.	Effects of specific genes activating RAGE on polycystic kidney disease.	Park EY, etal., Am J Nephrol. 2010;32(2):169-78. doi: 10.1159/000315859. Epub 2010 Jul 6.
122.	The functional -374 T/A RAGE gene polymorphism is associated with proteinuria and cardiovascular disease in type 1 diabetic patients.	Pettersson-Fernholm K, etal., Diabetes. 2003 Mar;52(3):891-4.
123.	Selenium downregulates RAGE and NFkappaB expression in diabetic rats.	Pillai SS, etal., Biol Trace Elem Res. 2012 Oct;149(1):71-7. doi: 10.1007/s12011-012-9401-1. Epub 2012 Apr 5.
124.	Relation between polymorphisms of receptor for advanced glycation end products (RAGE) and cardiovascular diseases in Chinese patients with diabetic nephropathy.	Poon PY, etal., Clin Nephrol. 2010 Jan;73(1):44-50.
125.	Association analysis of ADPRT1, AKR1B1, RAGE, GFPT2 and PAI-1 gene polymorphisms with chronic renal insufficiency among Asian Indians with type-2 diabetes.	Prasad P, etal., BMC Med Genet. 2010 Mar 31;11:52. doi: 10.1186/1471-2350-11-52.
126.	Human RAGE GLY82SER dimorphism and HLA class II DRB1-DQA1-DQB1 haplotypes in type 1 diabetes.	Prevost G, etal., Eur J Immunogenet. 1999 Oct;26(5):343-8.
127.	RefSeq and LocusLink: NCBI gene-centered resources	Pruitt KD and Maglott DR, Nucleic Acids Res. 2001 Jan 1;29(1):137-40.
128.	Simvastatin suppresses apoptosis in vulnerable atherosclerotic plaques through regulating the expression of p(53), Bcl-2 and Bcl-xL.	Qin W, etal., Cardiovasc Drugs Ther. 2012 Feb;26(1):23-30. doi: 10.1007/s10557-011-6347-z.
129.	Lack of the receptor for advanced glycation end-products attenuates E. coli pneumonia in mice.	Ramsgaard L, etal., PLoS One. 2011;6(5):e20132. Epub 2011 May 23.
130.	Soluble receptor of advanced glycation end products levels are related to ischaemic aetiology and extent of coronary disease in chronic heart failure patients, independent of advanced glycation end products levels: New Roles for Soluble RAGE.	Raposeiras-Roubin S, etal., Eur J Heart Fail. 2010 Oct;12(10):1092-100. doi: 10.1093/eurjhf/hfq117. Epub 2010 Aug 3.
131.	Evidence for a role of advanced glycation end products in atrial fibrillation.	Raposeiras-Roubin S, etal., Int J Cardiol. 2012 Jun 14;157(3):397-402. Epub 2011 Jun 8.
132.	Neuropeptide pituitary adenylate cyclase-activating polypeptide (PACAP) slows down Alzheimer's disease-like pathology in amyloid precursor protein-transgenic mice.	Rat D, etal., FASEB J. 2011 Sep;25(9):3208-18. doi: 10.1096/fj.10-180133. Epub 2011 May 18.
133.	Deletion of the receptor for advanced glycation end products reduces glomerulosclerosis and preserves renal function in the diabetic OVE26 mouse.	Reiniger N, etal., Diabetes. 2010 Aug;59(8):2043-54. doi: 10.2337/db09-1766. Epub 2010 Jul 13.
134.	Advanced glycation end-products enhance calcification in vascular smooth muscle cells.	Ren X, etal., J Int Med Res. 2009 May-Jun;37(3):847-54.
135.	GOA pipeline	RGD automated data pipeline
136.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
137.	Clinical chorioamnionitis is characterized by changes in the expression of the alarmin HMGB1 and one of its receptors, sRAGE.	Romero R, etal., J Matern Fetal Neonatal Med. 2012 Jun;25(6):558-67.
138.	The association of receptor of advanced glycated end products and inflammatory mediators contributes to endothelial dysfunction in a prospective study of acute kidney injury patients with sepsis.	Sadik NA, etal., Mol Cell Biochem. 2012 Jan;359(1-2):73-81. doi: 10.1007/s11010-011-1001-4. Epub 2011 Aug 3.
139.	sRAGE and risk of diabetes, cardiovascular disease and death.	Selvin E, etal., Diabetes. 2013 Feb 8.
140.	Methylglyoxal promotes oxidative stress and endothelial dysfunction.	Sena CM, etal., Pharmacol Res. 2012 May;65(5):497-506. doi: 10.1016/j.phrs.2012.03.004. Epub 2012 Mar 16.
141.	Internalization of the receptor for advanced glycation end products (RAGE) is required to mediate intracellular responses.	Sevillano N, etal., J Biochem. 2009 Jan;145(1):21-30. Epub 2008 Oct 11.
142.	Advanced glycation end products (AGE) induce the receptor for AGE in the colonic mucosa of azoxymethane-injected Fischer 344 rats fed with a high-linoleic acid and high-glucose diet.	Shimomoto T, etal., J Gastroenterol. 2012 Oct;47(10):1073-83. doi: 10.1007/s00535-012-0572-5. Epub 2012 Mar 31.
143.	Involvement of formyl peptide receptors in receptor for advanced glycation end products (RAGE)--and amyloid beta 1-42-induced signal transduction in glial cells.	Slowik A, etal., Mol Neurodegener. 2012 Nov 20;7:55. doi: 10.1186/1750-1326-7-55.
144.	Inhibitory effect of receptor for advanced glycation end products (RAGE) on the TGF-beta-induced alveolar epithelial to mesenchymal transition.	Song JS, etal., Exp Mol Med. 2011 Sep 30;43(9):517-24.
145.	The danger signal S100B integrates pathogen- and danger-sensing pathways to restrain inflammation.	Sorci G, etal., PLoS Pathog. 2011 Mar;7(3):e1001315. Epub 2011 Mar 10.
146.	Combined effects of maternal inflammation and neonatal hyperoxia on lung fibrosis and RAGE expression in newborn rats.	Su CL, etal., Pediatr Res. 2014 Feb;75(2):273-80. doi: 10.1038/pr.2013.222. Epub 2013 Nov 13.
147.	Is the Gly82Ser polymorphism in the RAGE gene relevant to schizophrenia and the personality trait psychoticism?	Suchankova P, etal., J Psychiatry Neurosci. 2012 Feb;37(2):122-8.
148.	Soluble RAGE is deficient in neutrophilic asthma and COPD.	Sukkar MB, etal., Eur Respir J. 2012 Mar;39(3):721-9. Epub 2011 Sep 15.
149.	[Advanced oxidation protein products inhibit proliferation and differentiation of rat osteoblasts through oxidative stress].	Sun N, etal., Nan Fang Yi Ke Da Xue Xue Bao. 2013 Mar;33(3):356-9.
150.	Neutralization of receptor for advanced glycation end-products and high mobility group box-1 attenuates septic diaphragm dysfunction in rats with peritonitis.	Susa Y, etal., Crit Care Med. 2009 Sep;37(9):2619-24. doi: 10.1097/CCM.0b013e3181a930f7.
151.	The N-glycoform of sRAGE is the key determinant for its therapeutic efficacy to attenuate injury-elicited arterial inflammation and neointimal growth.	Tae HJ, etal., J Mol Med (Berl). 2013 Dec;91(12):1369-81. doi: 10.1007/s00109-013-1091-4. Epub 2013 Oct 17.
152.	Functional role of soluble receptor for advanced glycation end products in stroke.	Tang SC, etal., Arterioscler Thromb Vasc Biol. 2013 Mar;33(3):585-94. doi: 10.1161/ATVBAHA.112.300523. Epub 2013 Jan 3.
153.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
154.	Receptor for advanced glycation end products (RAGE)--soluble form (sRAGE) and gene polymorphisms in patients with breast cancer.	Tesarova P, etal., Cancer Invest. 2007 Dec;25(8):720-5.
155.	Identification of RARRES1 as a core regulator in liver fibrosis.	Teufel A, etal., J Mol Med (Berl). 2012 Dec;90(12):1439-47. doi: 10.1007/s00109-012-0919-7. Epub 2012 Jun 6.
156.	Inhibition of NADPH oxidase prevents advanced glycation end product-mediated damage in diabetic nephropathy through a protein kinase C-alpha-dependent pathway.	Thallas-Bonke V, etal., Diabetes. 2008 Feb;57(2):460-9. Epub 2007 Oct 24.
157.	Targeting the AGE-RAGE axis improves renal function in the context of a healthy diet low in advanced glycation end-product content.	Thallas-Bonke V, etal., Nephrology (Carlton). 2013 Jan;18(1):47-56. doi: 10.1111/j.1440-1797.2012.01665.x.
158.	Soluble receptor for AGE (RAGE) is a novel independent predictor of all-cause and cardiovascular mortality in type 1 diabetes.	Thomas MC, etal., Diabetologia. 2011 Oct;54(10):2669-77. doi: 10.1007/s00125-011-2186-5. Epub 2011 May 24.
159.	Mesenchymal stem cells protects hyperoxia-induced lung injury in newborn rats via inhibiting receptor for advanced glycation end-products/nuclear factor kappaB signaling.	Tian Z, etal., Exp Biol Med (Maywood). 2013 Feb;238(2):242-7. doi: 10.1177/1535370212473706.
160.	[Influence of human mesenchymal stem cells on hyperoxia-exposed newborn rats by RAGE-NF-kappaB signaling in lung].	Tian ZF, etal., Zhonghua Er Ke Za Zhi. 2012 May;50(5):356-60.
161.	[Protection of hyperoxia-induced lung injury by granulocyte-macrophage colony-stimulating factor via RAGE-NF-kappaB signaling pathway in newborn rats].	Tian ZF, etal., Zhonghua Yi Xue Za Zhi. 2011 Aug 16;91(30):2143-7.
162.	High mobility group B1 protein interacts with its receptor RAGE in tumor cells but not in normal tissues.	Todorova J and Pasheva E, Oncol Lett. 2012 Jan;3(1):214-218. Epub 2011 Oct 24.
163.	S100B interaction with the receptor for advanced glycation end products (RAGE): a novel receptor-mediated mechanism for myocyte apoptosis postinfarction.	Tsoporis JN, etal., Circ Res. 2010 Jan 8;106(1):93-101. Epub 2009 Nov 12.
164.	Receptor for advanced glycation end-products is a marker of type I cell injury in acute lung injury.	Uchida T, etal., Am J Respir Crit Care Med. 2006 May 1;173(9):1008-15. Epub 2006 Feb 2.
165.	Receptor for advanced glycation end products is protective during murine tuberculosis.	van Zoelen MA, etal., Mol Immunol. 2012 Jun 12;52(3-4):183-189.
166.	Gene polymorphisms (G82S, 1704G/T, 2184A/G and 2245G/A) of the receptor of advanced glycation end products (RAGE) in plaque psoriasis.	Vasku V, etal., Arch Dermatol Res. 2002 May;294(3):127-30. Epub 2002 Apr 9.
167.	Endogenous secretory RAGE in obese women: association with platelet activation and oxidative stress.	Vazzana N, etal., J Clin Endocrinol Metab. 2012 Sep;97(9):E1726-30. doi: 10.1210/jc.2012-1473. Epub 2012 Jul 3.
168.	Peroxisome proliferator-activated receptor gamma down-regulates receptor for advanced glycation end products and inhibits smooth muscle cell proliferation in a diabetic and nondiabetic rat carotid artery injury model.	Wang K, etal., J Pharmacol Exp Ther. 2006 Apr;317(1):37-43. Epub 2005 Dec 20.
169.	Receptor for advanced glycation end products is upregulated in optic neuropathy of Alzheimer's disease.	Wang MY, etal., Acta Neuropathol. 2009 Sep;118(3):381-9. doi: 10.1007/s00401-009-0513-4. Epub 2009 Mar 11.
170.	Advanced glycation end-product Nepsilon-carboxymethyl-Lysine accelerates progression of atherosclerotic calcification in diabetes.	Wang Z, etal., Atherosclerosis. 2012 Apr;221(2):387-96. doi: 10.1016/j.atherosclerosis.2012.01.019. Epub 2012 Jan 13.
171.	Alagebrium reduces glomerular fibrogenesis and inflammation beyond preventing RAGE activation in diabetic apolipoprotein E knockout mice.	Watson AM, etal., Diabetes. 2012 Aug;61(8):2105-13. doi: 10.2337/db11-1546. Epub 2012 Jun 14.
172.	Galantamine anti-colitic effect: Role of alpha-7 nicotinic acetylcholine receptor in modulating Jak/STAT3, NF-κB/HMGB1/RAGE and p-AKT/Bcl-2 pathways.	Wazea SA, etal., Sci Rep. 2018 Mar 23;8(1):5110. doi: 10.1038/s41598-018-23359-6.
173.	An aqueous orally active vaccine targeted against a RAGE/AB complex as a novel therapeutic for Alzheimer's disease.	Webster SJ, etal., Neuromolecular Med. 2012 Jun;14(2):119-30. doi: 10.1007/s12017-012-8176-z. Epub 2012 Mar 14.
174.	Advanced glycation end products accelerate rat vascular calcification through RAGE/oxidative stress.	Wei Q, etal., BMC Cardiovasc Disord. 2013 Mar 5;13:13. doi: 10.1186/1471-2261-13-13.
175.	Down-regulation of vascular HMGB1 and RAGE expression by n-3 polyunsaturated fatty acids is accompanied by amelioration of chronic vasculopathy of small bowel allografts.	Wei W, etal., J Nutr Biochem. 2012 Oct;23(10):1333-40. doi: 10.1016/j.jnutbio.2011.08.002. Epub 2012 Jan 2.
176.	Six-month feeding of low-dose fish oil decreases vascular expression of high mobility group box1 and receptor for advanced glycation end-products in rat chronic allograft vasculopathy.	Wei W, etal., Transplant Proc. 2013 Jun;45(5):1771-5. doi: 10.1016/j.transproceed.2013.01.057.
177.	RAGE drives the development of glomerulosclerosis and implicates podocyte activation in the pathogenesis of diabetic nephropathy.	Wendt TM, etal., Am J Pathol. 2003 Apr;162(4):1123-37.
178.	Pentoxifylline alleviates high-fat diet-induced non-alcoholic steatohepatitis and early atherosclerosis in rats by inhibiting AGE and RAGE expression.	Wu J, etal., Acta Pharmacol Sin. 2010 Oct;31(10):1367-75. Epub 2010 Sep 13.
179.	Attenuation of aortic injury by ursolic acid through RAGE-Nox-NFkappaB pathway in streptozocin-induced diabetic rats.	Xiang M, etal., Arch Pharm Res. 2012 May;35(5):877-86. doi: 10.1007/s12272-012-0513-0. Epub 2012 May 29.
180.	Proteomic analysis reveals the deregulation of inflammation-related proteins in acupuncture-treated rats with asthma onset.	Xu YD, etal., Evid Based Complement Alternat Med. 2012;2012:850512. doi: 10.1155/2012/850512. Epub 2012 Nov 14.
181.	Matcha, a powdered green tea, ameliorates the progression of renal and hepatic damage in type 2 diabetic OLETF rats.	Yamabe N, etal., J Med Food. 2009 Aug;12(4):714-21. doi: 10.1089/jmf.2008.1282.
182.	Expression of receptor for advanced glycation end products during rat tongue carcinogenesis by 4-nitroquinoline 1-oxide and effect of a selective cyclooxygenase-2 inhibitor, etodolac.	Yamamoto K, etal., Pathobiology. 2006;73(6):317-24.
183.	Septic shock is associated with receptor for advanced glycation end products ligation of LPS.	Yamamoto Y, etal., J Immunol. 2011 Mar 1;186(5):3248-57. Epub 2011 Jan 26.
184.	RAGE and amyloid-beta peptide neurotoxicity in Alzheimer's disease.	Yan SD, etal., Nature 1996 Aug 22;382(6593):685-91.
185.	Intracranial aneurysm formation in type-one diabetes rats.	Yan T, etal., PLoS One. 2013 Jul 2;8(7):e67949. doi: 10.1371/journal.pone.0067949. Print 2013.
186.	Blocking the receptor for advanced glycation end product activation attenuates autoimmune myocarditis.	Yang WI, etal., Circ J. 2014;78(5):1197-205. Epub 2014 Mar 6.
187.	Niaspan reduces high-mobility group box 1/receptor for advanced glycation endproducts after stroke in type-1 diabetic rats.	Ye X, etal., Neuroscience. 2011 Sep 8;190:339-45. doi: 10.1016/j.neuroscience.2011.06.004. Epub 2011 Jun 13.
188.	alpha-Lipoic acid protects diabetic apolipoprotein E-deficient mice from nephropathy.	Yi X, etal., J Diabetes Complications. 2011 May-Jun;25(3):193-201. doi: 10.1016/j.jdiacomp.2010.07.004. Epub 2010 Aug 30.
189.	Serum levels of soluble receptor for advanced glycation endproducts (sRAGE) are higher in ulcerative colitis and correlate with disease activity.	Yilmaz Y, etal., J Crohns Colitis. 2011 Oct;5(5):402-6. Epub 2011 Apr 15.
190.	AGEs induce cell death via oxidative and endoplasmic reticulum stresses in both human SH-SY5Y neuroblastoma cells and rat cortical neurons.	Yin QQ, etal., Cell Mol Neurobiol. 2012 Nov;32(8):1299-309. doi: 10.1007/s10571-012-9856-9. Epub 2012 Jun 21.
191.	Clinical significance of serum HMGB-1 and sRAGE levels in systemic sclerosis: association with disease severity.	Yoshizaki A, etal., J Clin Immunol. 2009 Mar;29(2):180-9. doi: 10.1007/s10875-008-9252-x. Epub 2008 Sep 30.
192.	High cholesterol diet increases osteoporosis risk via inhibiting bone formation in rats.	You L, etal., Acta Pharmacol Sin. 2011 Dec;32(12):1498-504. doi: 10.1038/aps.2011.135. Epub 2011 Oct 31.
193.	Advanced Glycation End Product (AGE)-AGE Receptor (RAGE) System Upregulated Connexin43 Expression in Rat Cardiomyocytes via PKC and Erk MAPK Pathways.	Yu L, etal., Int J Mol Sci. 2013 Jan 24;14(2):2242-57. doi: 10.3390/ijms14022242.
194.	RAGE signaling mediates post-injury arterial neointima formation by suppression of liver kinase B1 and AMPK activity.	Yu W, etal., Atherosclerosis. 2012 Jun;222(2):417-25. Epub 2012 Apr 11.
195.	Curcumin alleviates diabetic cardiomyopathy in experimental diabetic rats.	Yu W, etal., PLoS One. 2012;7(12):e52013. doi: 10.1371/journal.pone.0052013. Epub 2012 Dec 14.
196.	Serum S100A12 (EN-RAGE) levels in patients with decreased renal function and subclinical chronic inflammatory disease.	Zakiyanov O, etal., Kidney Blood Press Res. 2011;34(6):457-64. doi: 10.1159/000329291. Epub 2011 Aug 5.
197.	Polymorphisms in the advanced glycosylation end product-specific receptor gene and risk of incident myocardial infarction or ischemic stroke.	Zee RY, etal., Stroke. 2006 Jul;37(7):1686-90. Epub 2006 May 25.
198.	Association of 1704G/T and G82S polymorphisms in the receptor for advanced glycation end products gene with diabetic retinopathy in Chinese population.	Zhang HM, etal., J Endocrinol Invest. 2009 Mar;32(3):258-62.
199.	Salidroside attenuates beta amyloid-induced cognitive deficits via modulating oxidative stress and inflammatory mediators in rat hippocampus.	Zhang J, etal., Behav Brain Res. 2013 May 1;244:70-81. doi: 10.1016/j.bbr.2013.01.037. Epub 2013 Feb 5.
200.	Novel sulfated polysaccharides disrupt cathelicidins, inhibit RAGE and reduce cutaneous inflammation in a mouse model of rosacea.	Zhang J, etal., PLoS One. 2011 Feb 9;6(2):e16658.
201.	Role of high mobility group box 1 (HMGB1) in wound healing.	Zhang Q, etal., J Surg Res. 2012 Jul;176(1):343-7. doi: 10.1016/j.jss.2011.06.069. Epub 2011 Jul 29.
202.	Morpho-mechanical intestinal remodeling in type 2 diabetic GK rats--is it related to advanced glycation end product formation?	Zhao J, etal., J Biomech. 2013 Apr 5;46(6):1128-34. doi: 10.1016/j.jbiomech.2013.01.010. Epub 2013 Feb 10.
203.	KCa3.1 channels mediate the increase of cell migration and proliferation by advanced glycation endproducts in cultured rat vascular smooth muscle cells.	Zhao LM, etal., Lab Invest. 2013 Feb;93(2):159-67. doi: 10.1038/labinvest.2012.163. Epub 2012 Nov 19.
204.	Advanced glycation end products promote proliferation of cardiac fibroblasts by upregulation of KCa3.1 channels.	Zhao LM, etal., Pflugers Arch. 2012 Dec;464(6):613-21. doi: 10.1007/s00424-012-1165-0. Epub 2012 Oct 2.
205.	Inhibition of the receptor for advanced glycation endproducts (RAGE) protects pancreatic beta-cells.	Zhu Y, etal., Biochem Biophys Res Commun. 2011 Jan 7;404(1):159-65. doi: 10.1016/j.bbrc.2010.11.085. Epub 2010 Nov 25.

Additional References at PubMed

PMID:9224812	PMID:10391939	PMID:10399917	PMID:11078691	PMID:12477932	PMID:14744997	PMID:15033494	PMID:15039226	PMID:15155381	PMID:15158469	PMID:15381690	PMID:15457210
PMID:15781751	PMID:15930093	PMID:15944249	PMID:16503878	PMID:17095586	PMID:18039581	PMID:18245812	PMID:18323529	PMID:18367618	PMID:18390831	PMID:18452184	PMID:18606705
PMID:18981529	PMID:19110400	PMID:19221410	PMID:19513528	PMID:19820198	PMID:19848206	PMID:19998499	PMID:20043889	PMID:20495289	PMID:20670350	PMID:20739563	PMID:20835858
PMID:20858979	PMID:20945382	PMID:21098642	PMID:21148126	PMID:21257730	PMID:21343866	PMID:21450369	PMID:21512281	PMID:21570918	PMID:21606643	PMID:21614209	PMID:22406537
PMID:22449800	PMID:22473704	PMID:22577135	PMID:23109892	PMID:23209312	PMID:23525442	PMID:23823020	PMID:23880178	PMID:23973487	PMID:24029001	PMID:24119142	PMID:24260107
PMID:24273313	PMID:24420848	PMID:24465790	PMID:24740410	PMID:24978055	PMID:24995813	PMID:25538203	PMID:25673150	PMID:25689357	PMID:25783987	PMID:25894538	PMID:25956731
PMID:26005850	PMID:26016731	PMID:26045736	PMID:26212415	PMID:26513053	PMID:26520447	PMID:26773687	PMID:26814270	PMID:26824730	PMID:26899371	PMID:26902637	PMID:26920052
PMID:27301641	PMID:27425255	PMID:27426491	PMID:27574116	PMID:27644038	PMID:27655137	PMID:27939576	PMID:28320103	PMID:28618037	PMID:28645008	PMID:28713206	PMID:28882317
PMID:28887039	PMID:29050939	PMID:29127006	PMID:29337308	PMID:29448054	PMID:29518356	PMID:29796842	PMID:29930087	PMID:30094805	PMID:30201694	PMID:30468490	PMID:30480814
PMID:30633750	PMID:31003767	PMID:31136947	PMID:31158467	PMID:32621862	PMID:33036632	PMID:33760170	PMID:34020590	PMID:34405719	PMID:35033142	PMID:35834066	PMID:35930096
PMID:36521778

Genomics

Comparative Map Data

Ager
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	20	4,148,150 - 4,151,361 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	4,147,890 - 4,151,078 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	20	4,854,742 - 4,857,677 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	20	4,216,494 - 4,219,429 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	20	4,747,395 - 4,750,329 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	20	4,363,152 - 4,366,079 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	4,363,152 - 4,366,079 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	20	6,442,508 - 6,445,435 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	20	4,250,613 - 4,253,540 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	20	4,250,839 - 4,253,767 (-)	NCBI
Celera	20	3,879,126 - 3,882,053 (+)	NCBI		Celera
Cytogenetic Map	20	p12	NCBI

AGER
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	32,180,969 - 32,184,253 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	32,180,968 - 32,184,322 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	6	32,148,746 - 32,152,030 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	32,256,724 - 32,260,001 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	6	32,256,723 - 32,260,001	NCBI
Celera	6	33,715,793 - 33,719,070 (-)	NCBI		Celera
Cytogenetic Map	6	p21.32	NCBI
HuRef	6	31,902,943 - 31,906,297 (-)	NCBI		HuRef
CHM1_1	6	32,151,229 - 32,154,583 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	6	32,034,160 - 32,037,444 (-)	NCBI		T2T-CHM13v2.0

Ager
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	17	34,816,545 - 34,819,911 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	17	34,816,836 - 34,819,910 (+)	Ensembl		GRCm39 Ensembl
GRCm38	17	34,597,460 - 34,600,937 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	17	34,597,862 - 34,600,936 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	17	34,734,807 - 34,737,877 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	17	34,205,945 - 34,208,989 (+)	NCBI		MGSCv36	mm8
Celera	17	37,693,022 - 37,696,092 (+)	NCBI		Celera
Cytogenetic Map	17	B1	NCBI
cM Map	17	18.18	NCBI

Ager
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955437	645,897 - 648,479 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955437	645,482 - 648,607 (-)	NCBI	ChiLan1.0	ChiLan1.0

AGER
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	6	42,605,525 - 42,609,148 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	31,828,363 - 31,831,981 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	32,708,251 - 32,711,641 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	6	32,708,251 - 32,711,641 (-)	Ensembl	panpan1.1		panPan2

AGER
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	12	1,574,251 - 1,577,410 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	12	1,574,251 - 1,577,129 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	12	1,707,946 - 1,710,824 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	12	1,712,483 - 1,715,623 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	12	1,712,483 - 1,715,351 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	12	1,575,515 - 1,578,386 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	12	1,641,097 - 1,643,974 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	12	1,707,421 - 1,710,298 (-)	NCBI		UU_Cfam_GSD_1.0

Ager
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404946	36,139,331 - 36,142,908 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936727	1,418,799 - 1,422,147 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936727	1,418,342 - 1,422,005 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

AGER
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	24,218,120 - 24,221,162 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	7	24,218,116 - 24,221,162 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	28,038,957 - 28,042,327 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

AGER
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	17	39,847,343 - 39,851,288 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	17	39,847,759 - 39,851,127 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666044	32,080,456 - 32,084,078 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ager
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624754	24,138,086 - 24,140,900 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Ager
8 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	135
Count of miRNA genes:	78
Interacting mature miRNAs:	94
Transcripts:	ENSRNOT00000000508, ENSRNOT00000072848
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1354642	Despr15	Despair related QTL 15		0.0027	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	20	1	24159021	Rat
1600382	Edcs3	Endometrial carcinoma susceptibility QTL3	3.5	0.003	uterus morphology trait (VT:0001120)	percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759)	20	1	25159026	Rat
2317851	Alcrsp22	Alcohol response QTL 22	3.2	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	20	1	27339237	Rat
1641893	Alcrsp7	Alcohol response QTL 7			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	20	1	27339237	Rat
8694189	Bw153	Body weight QTL 153	3.13	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	20	1	29191651	Rat
9590275	Scort15	Serum corticosterone level QTL 15	3.48	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	20	1	29191651	Rat
7411650	Foco23	Food consumption QTL 23	20.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	1	29191651	Rat
9590109	Sffal8	Serum free fatty acids level QTL 8	5.32	0.01	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	20	1	29191651	Rat
9589155	Insul32	Insulin level QTL 32	6.38	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	20	1	29191651	Rat
6893685	Bw111	Body weight QTL 111	2.7	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	20	1	32578807	Rat
7411668	Foco32	Food consumption QTL 32	8	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	1	36600972	Rat
9590252	Scort12	Serum corticosterone level QTL 12	20.46	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	20	1	36600972	Rat
2305926	Iddm37	Insulin dependent diabetes mellitus QTL 37	6		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	20	1527842	46527842	Rat
2306850	Pia40	Pristane induced arthritis QTL 40		0.0001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	20	1527959	5304575	Rat
1641915	Colcr9	Colorectal carcinoma resistance QTL 9	2.97	0.0024	intestine integrity trait (VT:0010554)	benign colorectal tumor number (CMO:0001795)	20	1530655	46530655	Rat
1598816	Memor12	Memory QTL 12	2.4		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	20	2606836	47606836	Rat
61448	Ciaa1	CIA Autoantibody QTL 1	30	0.001	blood autoantibody amount (VT:0003725)	calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281)	20	2646395	4597031	Rat
61472	Aia1	Adjuvant induced arthritis QTL 1	18	0.001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	20	2646395	4597031	Rat
2317057	Aia27	Adjuvant induced arthritis QTL 27	2.83		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	20	2892597	26381954	Rat
1300152	Bp195	Blood pressure QTL 195	3.46		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	20	3621649	9243559	Rat
1331772	Cdexp2	CD45RC expression in CD8 T cells QTL 2	5.7		CD8-positive T cell quantity (VT:0008077)	blood CD45RC(high) CD8 T cell count to CD45RC(low) CD8 T cell count ratio (CMO:0001990)	20	3621649	10078919	Rat
737973	Pia21	Pristane induced arthritis QTL 21	4.8		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	20	3621656	4606812	Rat
61432	Cia1	Collagen induced arthritis QTL 1			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	20	3621656	14101050	Rat

Markers in Region

RH133750

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	4,147,793 - 4,147,984 (-)	MAPPER	mRatBN7.2
Rnor_6.0	20	4,366,245 - 4,366,435	NCBI	Rnor6.0
Rnor_5.0	20	6,445,601 - 6,445,791	UniSTS	Rnor5.0
RGSC_v3.4	20	4,250,257 - 4,250,447	UniSTS	RGSC3.4
Celera	20	3,882,219 - 3,882,409	UniSTS
RH 3.4 Map	20	53.3	UniSTS
Cytogenetic Map	20	p12	UniSTS

PMC162222P1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	4,149,485 - 4,150,413 (-)	MAPPER	mRatBN7.2
Rnor_6.0	20	4,363,817 - 4,364,744	NCBI	Rnor6.0
Rnor_5.0	20	6,443,173 - 6,444,100	UniSTS	Rnor5.0
RGSC_v3.4	20	4,251,948 - 4,252,875	UniSTS	RGSC3.4
Celera	20	3,879,791 - 3,880,718	UniSTS
Cytogenetic Map	20	p12	UniSTS

AI453961

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	4,148,217 - 4,148,512 (-)	MAPPER	mRatBN7.2
Rnor_6.0	20	4,365,717 - 4,366,011	NCBI	Rnor6.0
Rnor_5.0	20	6,445,073 - 6,445,367	UniSTS	Rnor5.0
RGSC_v3.4	20	4,250,681 - 4,250,975	UniSTS	RGSC3.4
Celera	20	3,881,691 - 3,881,985	UniSTS
RH 3.4 Map	20	53.83	UniSTS
Cytogenetic Map	20	p12	UniSTS

AI176804

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	4,151,744 - 4,151,845 (-)	MAPPER	mRatBN7.2
Rnor_6.0	20	4,362,385 - 4,362,485	NCBI	Rnor6.0
Rnor_5.0	20	6,441,741 - 6,441,841	UniSTS	Rnor5.0
RGSC_v3.4	20	4,254,207 - 4,254,307	UniSTS	RGSC3.4
Celera	20	3,878,359 - 3,878,459	UniSTS
RH 3.4 Map	20	52.92	UniSTS
Cytogenetic Map	20	p12	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High												7
Medium		4	2	2	1	2			38	14	22	4
Low	3	39	55	39	18	39	8	11	36	21	18		8
Below cutoff											1

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_053336	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006256025	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC084697	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BX883044	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474121	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CR475487	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	GU164715	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	GU164716	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	GU164717	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	GU164718	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	GU164719	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	GU164720	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	GU164721	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	GU164722	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	GU164723	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	GU164724	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	GU164725	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	GU164726	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000323	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	L33413	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000000508 ⟹ ENSRNOP00000000508

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	20	4,147,890 - 4,151,078 (-)	Ensembl
Rnor_6.0 Ensembl	20	4,363,152 - 4,366,079 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000072848 ⟹ ENSRNOP00000066649

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	20	4,149,443 - 4,151,078 (-)	Ensembl
Rnor_6.0 Ensembl	20	4,363,186 - 4,366,050 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000077205 ⟹ ENSRNOP00000075474

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	20	4,149,161 - 4,151,078 (-)	Ensembl
Rnor_6.0 Ensembl	20	4,363,508 - 4,365,317 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000077561 ⟹ ENSRNOP00000073680

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	20	4,363,186 - 4,366,050 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000080289

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	20	4,365,587 - 4,366,078 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000084841 ⟹ ENSRNOP00000072071

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	20	4,147,890 - 4,151,078 (-)	Ensembl
Rnor_6.0 Ensembl	20	4,363,186 - 4,366,050 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000085277

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	20	4,147,890 - 4,151,078 (-)	Ensembl
Rnor_6.0 Ensembl	20	4,363,186 - 4,366,050 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000089721

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	20	4,363,186 - 4,366,050 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000091105

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	20	4,363,351 - 4,364,019 (+)	Ensembl

RefSeq Acc Id:

NM_053336 ⟹ NP_445788

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	20	4,148,150 - 4,151,078 (-)	NCBI
Rnor_6.0	20	4,363,152 - 4,366,079 (+)	NCBI
Rnor_5.0	20	6,442,508 - 6,445,435 (+)	NCBI
RGSC_v3.4	20	4,250,613 - 4,253,540 (-)	RGD
Celera	20	3,879,126 - 3,882,053 (+)	RGD

Sequence:

show sequence

AGCCACAGTAGGAAGTGGGGCAGACAGAACCAGGAGCCTGGGAAGGAAGCACCATGCCAACGGG
GACAGTAGCTAGAGCCTGGGTACTGGTTCTTGCTCTGTGGGGAGCCGTAGCTGGTGGTCAGAAC
ATCACAGCCCGGATCGGAGAGCCACTTATGCTGAGCTGTAAGGGGGCCCCTAAGAAGCCAACCC
AGAAGCTAGAATGGAAACTGAACACAGGAAGGACTGAAGCTTGGAAGGTCCTCTCTCCCCAGGG
AGACCCCTGGGACAGTGTGGCTCGAATCCTCCCCAATGGTTCACTCCTCCTTCCAGCTATCGGA
ATTGTCGATGAGGGGACTTTCCGGTGTCGGGCAACTAACAGGCTTGGGAAGGAGGTCAAGTCCA
ACTACCGAGTCCGAGTCTACCAGATTCCTGGGAAGCCGGAAATTGTGAATCCTGCCTCTGAACT
CACAGCCAATGTCCCTAATAAGGTGGGGACGTGTGTGTCTGAGGGGAGCTACCCTGCAGGGACC
CTTAGCTGGCACTTGGATGGGAAACCTCTGATTCCTGATGGCAAAGGGACAGTTGTGAAGGAGG
AGACCAGGAGGCACCCTGAGACGGGACTCTTCACGCTTCGGTCAGAGCTCACAGTGACCCCAGC
CCAAGGAGGGACCACTCCTACCTATTCCTGCAGCTTCAGCCTGGGCCTTCCTCGGCACAGACCC
CTGAACACAGCCCCCATCCAGCCCCGAGTCAGGGAGCCCCTGCCTCCAGAGGGCATTCAGCTGT
TGGTTGAGCCTGAAGGTGGAACAGTCGCTCCTGGTGGGACCGTGACCCTGACCTGTGCCATCTC
TGCCCAGCCTCCCCCTCAAATCCACTGGATAAAAGATGGCACACCCCTGCCCCTTGCCCCCAGC
CCTGTGCTGCTCCTCCCTGAGGTAGGGCATGAGGATGAGGGCATCTACAGCTGCGTGGCCACCC
ACCCTAGCCATGGACCTCAGGAAAGCCCTCCTGTCAACATCAGGGTCACAGAAACCGGTGATGA
AGGACAAGCTGCAGGCTCTGTGGATGGGTCTGGGCTGGGAACGCTAGCCCTGGCCTTAGGGATC
CTGGGAGGCCTGGGAATAGCCGCTCTGCTCATTGGGGCCATCCTGTGGCGAAAACGACAACCCA
GACTCGAGGAGAGGAAGGCCCCAGAAAGCCAGGAGGACGAGGAGGAACGTGCAGAGCTGAATCA
GTCAGAGGAAGCGGAAATGCCAGAGAATGGTGCAGGGGGACCTTAAGAGCGCCCAGGCAAACCC
TGTCTCCTTCAGCTTCCGACCTCAGCTGTGCTGGCTCCAGACGAGCTCCCCCACTCTACGATCC
CAATTCAACCTCGAGCCACTTTCTTCTCCAACCAGAGCCCACATGATCCATGCTGAGTAAACAC
CTGACACATGTTAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_006256025 ⟹ XP_006256087

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	20	4,148,150 - 4,151,361 (-)	NCBI
Rnor_6.0	20	4,363,153 - 4,366,078 (+)	NCBI
Rnor_5.0	20	6,442,508 - 6,445,435 (+)	NCBI

Sequence:

show sequence

GCCACAGTAGGAAGTGGGGCAGACAGAACCAGGAGCCTGGGAAGGAAGCACCATGCCAACGGGG
ACAGTAGCTAGAGCCTGGGTACTGGTTCTTGCTCTGTGGGGAGCCGTAGCTGGTGGTCAGAACA
TCACAGCCCGGATCGGAGAGCCACTTATGCTGAGCTGTAAGGGGGCCCCTAAGAAGCCAACCCA
GAAGCTAGAATGGAAACTGAACACAGGAAGGACTGAAGCTTGGAAGGTCCTCTCTCCCCAGGGA
GACCCCTGGGACAGTGTGGCTCGAATCCTCCCCAATGGTTCACTCCTCCTTCCAGCTATCGGAA
TTGTCGATGAGGGGACTTTCCGGTGTCGGGCAACTAACAGGCTTGGGAAGGAGGTCAAGTCCAA
CTACCGAGTCCGAGTCTACCAGATTCCTGGGAAGCCGGAAATTGTGAATCCTGCCTCTGAACTC
ACAGCCAATGTCCCTAATAAGGTGGGGACGTGTGTGTCTGAGGGGAGCTACCCTGCAGGGACCC
TTAGCTGGCACTTGGATGGGAAACCTCTGATTCCTGATGGCAAAGGGACAGTTGTGAAGGAGGA
GACCAGGAGGCACCCTGAGACGGGACTCTTCACGCTTCGGTCAGAGCTCACAGTGACCCCAGCC
CAAGGAGGGACCACTCCTACCTATTCCTGCAGCTTCAGCCTGGGCCTTCCTCGGCACAGACCCC
TGAACACAGCCCCCATCCAGCCCCGAGTCAGGGAGCCCCTGCCTCCAGAGGGCATTCAGCTGTT
GGTTGAGCCTGAAGGTGGAACAGTCGCTCCTGGTGGGACCGTGACCCTGACCTGTGCCATCTCT
GCCCAGCCTCCCCCTCAAATCCACTGGATAAAAGATGGCACACCCCTGCCCCTTGCCCCCAGCC
CTGTGCTGCTCCTCCCTGAGGTAGGGCATGAGGATGAGGGCATCTACAGCTGCGTGGCCACCCA
CCCTAGCCATGGACCTCAGGAAAGCCCTCCTGTCAACATCAGGGTCACAGGCTCTGTGGATGGG
TCTGGGCTGGGAACGCTAGCCCTGGCCTTAGGGATCCTGGGAGGCCTGGGAATAGCCGCTCTGC
TCATTGGGGCCATCCTGTGGCGAAAACGACAACCCAGACTCGAGGAGAGGAAGGCCCCAGAAAG
CCAGGAGGACGAGGAGGAACGTGCAGAGCTGAATCAGTCAGAGGAAGCGGAAATGCCAGAGAAT
GGTGCAGGGGGACCTTAAGAGCGCCCAGGCAAACCCTGTCTCCTTCAGCTTCCGACCTCAGCTG
TGCTGGCTCCAGACGAGCTCCCCCACTCTACGATCCCAATTCAACCTCGAGCCACTTTCTTCTC
CAACCAGAGCCCACATGATCCATGCTGAGTAAACACCTGACACATGT

hide sequence

Protein Sequences


Protein RefSeqs	NP_445788	(Get FASTA)	NCBI Sequence Viewer
	XP_006256087	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA42027	(Get FASTA)	NCBI Sequence Viewer
	AAH84697	(Get FASTA)	NCBI Sequence Viewer
	ADX07273	(Get FASTA)	NCBI Sequence Viewer
	ADX07274	(Get FASTA)	NCBI Sequence Viewer
	ADX07275	(Get FASTA)	NCBI Sequence Viewer
	ADX07276	(Get FASTA)	NCBI Sequence Viewer
	CAE83960	(Get FASTA)	NCBI Sequence Viewer
	EDL83392	(Get FASTA)	NCBI Sequence Viewer
	EDL83393	(Get FASTA)	NCBI Sequence Viewer
	EDL83394	(Get FASTA)	NCBI Sequence Viewer
	Q63495	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_445788 ⟸ NM_053336
- Peptide Label:	precursor
- UniProtKB:	Q63495 (UniProtKB/Swiss-Prot), Q6MG86 (UniProtKB/TrEMBL), A6KTG2 (UniProtKB/TrEMBL)
- Sequence:	show sequence MPTGTVARAWVLVLALWGAVAGGQNITARIGEPLMLSCKGAPKKPTQKLEWKLNTGRTEAWKVL SPQGDPWDSVARILPNGSLLLPAIGIVDEGTFRCRATNRLGKEVKSNYRVRVYQIPGKPEIVNP ASELTANVPNKVGTCVSEGSYPAGTLSWHLDGKPLIPDGKGTVVKEETRRHPETGLFTLRSELT VTPAQGGTTPTYSCSFSLGLPRHRPLNTAPIQPRVREPLPPEGIQLLVEPEGGTVAPGGTVTLT CAISAQPPPQIHWIKDGTPLPLAPSPVLLLPEVGHEDEGIYSCVATHPSHGPQESPPVNIRVTE TGDEGQAAGSVDGSGLGTLALALGILGGLGIAALLIGAILWRKRQPRLEERKAPESQEDEEERA ELNQSEEAEMPENGAGGP hide sequence

RefSeq Acc Id:	XP_006256087 ⟸ XM_006256025
- Peptide Label:	isoform X1
- UniProtKB:	A0A0G2K218 (UniProtKB/TrEMBL), A6KTG3 (UniProtKB/TrEMBL), F1ABR4 (UniProtKB/TrEMBL)
- Sequence:	show sequence MPTGTVARAWVLVLALWGAVAGGQNITARIGEPLMLSCKGAPKKPTQKLEWKLNTGRTEAWKVL SPQGDPWDSVARILPNGSLLLPAIGIVDEGTFRCRATNRLGKEVKSNYRVRVYQIPGKPEIVNP ASELTANVPNKVGTCVSEGSYPAGTLSWHLDGKPLIPDGKGTVVKEETRRHPETGLFTLRSELT VTPAQGGTTPTYSCSFSLGLPRHRPLNTAPIQPRVREPLPPEGIQLLVEPEGGTVAPGGTVTLT CAISAQPPPQIHWIKDGTPLPLAPSPVLLLPEVGHEDEGIYSCVATHPSHGPQESPPVNIRVTG SVDGSGLGTLALALGILGGLGIAALLIGAILWRKRQPRLEERKAPESQEDEEERAELNQSEEAE MPENGAGGP hide sequence

RefSeq Acc Id:

ENSRNOP00000075474 ⟸ ENSRNOT00000077205

RefSeq Acc Id:

ENSRNOP00000072071 ⟸ ENSRNOT00000084841

RefSeq Acc Id:

ENSRNOP00000066649 ⟸ ENSRNOT00000072848

RefSeq Acc Id:

ENSRNOP00000000508 ⟸ ENSRNOT00000000508

RefSeq Acc Id:

ENSRNOP00000073680 ⟸ ENSRNOT00000077561

Protein Domains

Ig-like Ig-like C2-type Ig-like V-type

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q63495-F1-model_v2	AlphaFold	Q63495	1-402	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:69258	AgrOrtholog
BioCyc Gene	G2FUF-4584	BioCyc
Ensembl Genes	ENSRNOG00000000439	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000000508	ENTREZGENE
	ENSRNOP00000000508.2	UniProtKB/TrEMBL
	ENSRNOP00000066649.3	UniProtKB/TrEMBL
	ENSRNOP00000072071	ENTREZGENE
	ENSRNOP00000072071.2	UniProtKB/TrEMBL
	ENSRNOP00000075474.2	UniProtKB/TrEMBL
	ENSRNOP00000076524.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000000508	ENTREZGENE
	ENSRNOT00000000508.5	UniProtKB/TrEMBL
	ENSRNOT00000072848.3	UniProtKB/TrEMBL
	ENSRNOT00000077205.2	UniProtKB/TrEMBL
	ENSRNOT00000084841	ENTREZGENE
	ENSRNOT00000084841.2	UniProtKB/TrEMBL
	ENSRNOT00000085277.2	UniProtKB/TrEMBL
Gene3D-CATH	2.60.40.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7121345	IMAGE-MGC_LOAD
InterPro	CD80_C2-set	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ig-like_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ig-like_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ig-like_fold	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ig/MHC_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ig_sub	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ig_sub2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:81722	UniProtKB/TrEMBL
MGC_CLONE	MGC:105376	IMAGE-MGC_LOAD
NCBI Gene	81722	ENTREZGENE
PANTHER	ADVANCED GLYCOSYLATION END PRODUCT-SPECIFIC RECEPTOR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	CELL SURFACE GLYCOPROTEIN MUC18-RELATED	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	C2-set_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ig_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Ager	PhenoGen
PROSITE	IG_LIKE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	IG_MHC	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SMART	IGc2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SM00409	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF48726	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
TIGR	TC208219
UniProt	A0A0G2K218	ENTREZGENE, UniProtKB/TrEMBL
	A0A0G2KAP4_RAT	UniProtKB/TrEMBL
	A0A8I5Y614_RAT	UniProtKB/TrEMBL
	A6KTG2	ENTREZGENE, UniProtKB/TrEMBL
	A6KTG3	ENTREZGENE, UniProtKB/TrEMBL
	A6KTG4_RAT	UniProtKB/TrEMBL
	F1ABR3_RAT	UniProtKB/TrEMBL
	F1ABR4	ENTREZGENE, UniProtKB/TrEMBL
	F1ABR5_RAT	UniProtKB/TrEMBL
	F1ABR6_RAT	UniProtKB/TrEMBL
	F7EQT2_RAT	UniProtKB/TrEMBL
	M0RAU0_RAT	UniProtKB/TrEMBL
	Q5XFX5_RAT	UniProtKB/TrEMBL
	Q63495	ENTREZGENE
	Q6MG86	ENTREZGENE
	RAGE_RAT	UniProtKB/Swiss-Prot
UniProt Secondary	Q6MG86	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2002-06-10	Ager	advanced glycosylation end product-specific receptor			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_mapping	is found within the rat major histocompatibility RT1 complex.	1300431
gene_process	mediates interactions of advanced glycosylation end products (age), which accumulate in vascular tissue in aging and at an accelerated rate in diabetes	724707

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - GAD

RGD Manual Annotations

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - GAD

RGD Manual Annotations