Fpr2 (formyl peptide receptor 2) - Rat Genome Database

Name: Fpr2
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Fpr2 (formyl peptide receptor 2) Rattus norvegicus

Analyze

Symbol:

Fpr2

Name:

formyl peptide receptor 2

RGD ID:

1584013

Description:

Enables RAGE receptor binding activity. Predicted to be involved in several processes, including G protein-coupled receptor signaling pathway; cellular response to amyloid-beta; and positive regulation of immune response. Predicted to act upstream of or within G protein-coupled receptor signaling pathway. Predicted to be located in cytoplasm. Predicted to be active in plasma membrane. Orthologous to human FPR2 (formyl peptide receptor 2); INTERACTS WITH 17beta-estradiol; bisphenol A; lipoxin A4.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

formyl peptide receptor 2-like; formyl peptide receptor, related sequence 2; formyl peptide receptor, related sequence 2-like; formyl peptide receptor-like 1; Fpr-rs2; Fprl1; LOC690158; similar to formyl peptide receptor, related sequence 2

RGD Orthologs

Human

Mouse

Bonobo

Dog

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	FPR2 (formyl peptide receptor 2)	HGNC	Ensembl, HomoloGene, Inparanoid, Panther, Treefam
Mus musculus (house mouse):	Fpr2 (formyl peptide receptor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	FPR2 (formyl peptide receptor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	FPR2 (formyl peptide receptor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	FPR2 (formyl peptide receptor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Fpr2 (formyl peptide receptor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	FPR3 (formyl peptide receptor 3)	HGNC	OrthoDB, Panther
Homo sapiens (human):	FPR1 (formyl peptide receptor 1)	HGNC	OrthoDB
Alliance orthologs ³
Homo sapiens (human):	FPR2 (formyl peptide receptor 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Mus musculus (house mouse):	Fpr2 (formyl peptide receptor 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Fpr3 (formyl peptide receptor 3)	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	si:dkey-211g8.1	Alliance	DIOPT (Ensembl Compara\|OMA)
Danio rerio (zebrafish):	si:ch211-137j23.9	Alliance	DIOPT (OMA\|PANTHER)
Danio rerio (zebrafish):	si:ch73-160i9.1	Alliance	DIOPT (Ensembl Compara\|OMA)
Danio rerio (zebrafish):	si:dkey-42l23.5	Alliance	DIOPT (OMA\|PANTHER)
Danio rerio (zebrafish):	si:dkey-42l23.7	Alliance	DIOPT (OMA\|PANTHER)
Danio rerio (zebrafish):	si:dkey-42l23.4	Alliance	DIOPT (OMA\|PANTHER)

Related Pseudogenes:

Fpr2-ps4

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	1	58,776,592 - 58,785,227 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	58,776,752 - 58,786,019 (+)	Ensembl		mRatBN7.2 Ensembl
Rnor_6.0	1	59,800,558 - 59,809,507 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	59,800,984 - 59,802,401 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	60,719,375 - 60,727,932 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	56,622,816 - 56,624,057 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	1	54,955,259 - 54,964,212 (+)	NCBI		Celera
Cytogenetic Map	1	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Crohn's disease (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

17beta-estradiol (EXP)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

4,4'-diaminodiphenylmethane (ISO)

4-hydroxyphenyl retinamide (ISO)

acetylsalicylic acid (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

antirheumatic drug (ISO)

arsane (ISO)

arsenic atom (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP)

carbon nanotube (ISO)

cerium trichloride (ISO)

CGP 52608 (ISO)

chloroprene (ISO)

cisplatin (ISO)

cobalt dichloride (ISO)

cyclophosphamide (ISO)

cyclosporin A (ISO)

dextran sulfate (ISO)

diclofenac (ISO)

lipopolysaccharide (ISO)

lipoxin A4 (EXP,ISO)

methotrexate (ISO)

nickel atom (ISO)

ozone (ISO)

paracetamol (ISO)

Phenelzine (ISO)

pirinixic acid (ISO)

protein kinase inhibitor (ISO)

quercetin (ISO)

silicon dioxide (ISO)

sulforaphane (ISO)

tamoxifen (ISO)

tetrachloromethane (ISO)

titanium dioxide (ISO)

tremolite asbestos (ISO)

trimellitic anhydride (ISO)

triptonide (ISO)

tungsten (ISO)

XL147 (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway (ISO)

calcium-mediated signaling (ISO)

cell surface receptor signaling pathway (ISO)

cellular response to amyloid-beta (ISO)

complement receptor mediated signaling pathway (IBA)

defense response to bacterium (ISO)

G protein-coupled receptor signaling pathway (ISO)

immune response-regulating cell surface receptor signaling pathway (ISO)

inflammatory response (IBA)

negative regulation of inflammatory response (ISO)

phospholipase C-activating G protein-coupled receptor signaling pathway (IBA,ISO)

positive chemotaxis (ISO)

positive regulation of cytosolic calcium ion concentration (IBA)

positive regulation of ERK1 and ERK2 cascade (ISO)

positive regulation of innate immune response (ISO)

positive regulation of monocyte chemotaxis (ISO)

positive regulation of phagocytosis (ISO)

positive regulation of protein phosphorylation (ISO)

positive regulation of superoxide anion generation (ISO)

Cellular Component

cytoplasm (ISO)

plasma membrane (IBA,ISO)

Molecular Function

amyloid-beta binding (ISO)

complement receptor activity (IBA)

G protein-coupled receptor activity (IBA)

N-formyl peptide receptor activity (IBA,ISO)

protein binding (ISO)

RAGE receptor binding (IPI)

scavenger receptor binding (ISO)

signaling receptor activity (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Functional and physical interactions between formyl-peptide-receptors and scavenger receptor MARCO and their involvement in amyloid beta 1-42-induced signal transduction in glial cells.	Brandenburg LO, etal., J Neurochem. 2010 May;113(3):749-60. doi: 10.1111/j.1471-4159.2010.06637.x. Epub 2010 Feb 5.
2.	Involvement of formyl-peptide-receptor-like-1 and phospholipase D in the internalization and signal transduction of amyloid beta 1-42 in glial cells.	Brandenburg LO, etal., Neuroscience. 2008 Oct 2;156(2):266-76. doi: 10.1016/j.neuroscience.2008.07.042. Epub 2008 Aug 5.
3.	Detrimental Role of miRNA-144-3p in Intracerebral Hemorrhage Induced Secondary Brain Injury is Mediated by Formyl Peptide Receptor 2 Downregulation Both In Vivo and In Vitro.	Fan W, etal., Cell Transplant. 2018 Dec 4:963689718817219. doi: 10.1177/0963689718817219.
4.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
6.	Involvement of formyl peptide receptors in receptor for advanced glycation end products (RAGE)--and amyloid beta 1-42-induced signal transduction in glial cells.	Slowik A, etal., Mol Neurodegener. 2012 Nov 20;7:55. doi: 10.1186/1750-1326-7-55.

Additional References at PubMed

PMID:11160457	PMID:11316806	PMID:11689470	PMID:12218158	PMID:21299846	PMID:21990306	PMID:22859307	PMID:25505240	PMID:25616869	PMID:26732571	PMID:27173446	PMID:27862450
PMID:30784911	PMID:34572022	PMID:36279933

Genomics

Comparative Map Data

Fpr2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	1	58,776,592 - 58,785,227 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	58,776,752 - 58,786,019 (+)	Ensembl		mRatBN7.2 Ensembl
Rnor_6.0	1	59,800,558 - 59,809,507 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	59,800,984 - 59,802,401 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	60,719,375 - 60,727,932 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	56,622,816 - 56,624,057 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	1	54,955,259 - 54,964,212 (+)	NCBI		Celera
Cytogenetic Map	1	q12	NCBI

FPR2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	51,761,180 - 51,770,531 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	19	51,752,026 - 51,770,531 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	52,264,433 - 52,273,784 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	56,956,265 - 56,965,591 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	19	56,958,453 - 56,965,589	NCBI
Celera	19	49,314,014 - 49,323,339 (+)	NCBI		Celera
Cytogenetic Map	19	q13.41	NCBI
HuRef	19	48,595,209 - 48,604,534 (+)	NCBI		HuRef
CHM1_1	19	52,266,274 - 52,275,599 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	19	54,848,374 - 54,857,725 (+)	NCBI		T2T-CHM13v2.0

Fpr2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	17	18,108,086 - 18,114,214 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	17	18,108,086 - 18,114,214 (+)	Ensembl		GRCm39 Ensembl
GRCm38	17	17,887,824 - 17,893,952 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	17	17,887,824 - 17,893,952 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	17	18,024,788 - 18,030,916 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	17	17,592,442 - 17,598,570 (+)	NCBI		MGSCv36	mm8
Celera	17	18,828,566 - 18,834,697 (+)	NCBI		Celera
Cytogenetic Map	17	A3.2	NCBI

FPR2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	19	57,586,681 - 57,593,320 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
Mhudiblu_PPA_v0	19	48,663,622 - 48,715,535 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

FPR2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	105,343,096 - 105,353,563 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	105,344,463 - 105,372,070 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	104,916,610 - 104,927,170 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	105,853,006 - 105,863,566 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	105,855,489 - 105,856,544 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	105,525,388 - 105,535,950 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	105,164,383 - 105,175,163 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	105,961,120 - 105,971,680 (-)	NCBI		UU_Cfam_GSD_1.0

FPR2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	44,580,342 - 44,591,187 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	44,589,334 - 44,590,389 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666073	24,634,825 - 24,645,669 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Fpr2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624832	3,275,365 - 3,282,308 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Fpr2
196 total Variants

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
738020	Pia8	Pristane induced arthritis QTL 8	4.7		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	1	65833076	Rat
1554320	Bmd1	Bone mineral density QTL 1	12.2	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	509108	86060548	Rat
631688	Hcas2	Hepatocarcinoma susceptibility QTL 2	3	0.0001	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	5925874	115540829	Rat
1300167	Hrtrt2	Heart rate QTL 2	4.35		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	11481312	75088344	Rat
2313062	Bmd73	Bone mineral density QTL 73	3.9	0.0001	tibia mineral mass (VT:1000283)	cortical volumetric bone mineral density (CMO:0001730)	1	11481312	82174945	Rat
2313065	Bss67	Bone structure and strength QTL 67	3.1	0.0001	tibia area (VT:1000281)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
2313069	Bss68	Bone structure and strength QTL 68	2.9	0.0001	tibia size trait (VT:0100001)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
2313075	Bss66	Bone structure and strength QTL 66	3.4	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	11481312	82174945	Rat
2313077	Bss69	Bone structure and strength QTL 69	3.5	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	11481312	82174945	Rat
2313092	Bmd72	Bone mineral density QTL 72	2.5	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	11481312	82174945	Rat
2313097	Bss70	Bone structure and strength QTL 70	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
724520	Bp145	Blood pressure QTL 145	2.1	0.0024	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	20784828	65784828	Rat
1357400	Bw62	Body weight QTL62	4.05		inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	1	22340647	67340647	Rat
631495	Bp96	Blood pressure QTL 96	4.52		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	22340647	102268831	Rat
1331785	Rf27	Renal function QTL 27	4.643		urine sodium amount (VT:0006274)	urine sodium level (CMO:0000129)	1	28879780	78430678	Rat
1358359	Sradr1	Stress Responsive Adrenal Weight QTL 1	4.74		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	30882023	123479925	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32356093	162846471	Rat
1300172	Bp172	Blood pressure QTL 172	3.56		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	32737273	90665040	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32737458	199368955	Rat
1354599	Bw29	Body weight QTL 29	3.46	0.001	body mass (VT:0001259)	body weight (CMO:0000012)	1	33449848	78449848	Rat
1354643	Foco2	Food consumption QTL 2	7.17	0.0001	eating behavior trait (VT:0001431)	food intake rate (CMO:0000427)	1	33449848	78449848	Rat
8552900	Pigfal1	Plasma insulin-like growth factor 1 level QTL 1	7.4		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	1	34836858	79836858	Rat
8552948	Pigfal11	Plasma insulin-like growth factor 1 level QTL 11	4.7		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	1	34836858	79836858	Rat
9589820	Insglur3	Insulin/glucose ratio QTL 3	10.75	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	1	34836858	79836858	Rat
1331732	Srn4	Serum renin concentration QTL 4	4.467		renin activity (VT:0005581)	plasma renin activity level (CMO:0000116)	1	35239598	78430678	Rat
1331792	Rf29	Renal function QTL 29	4.589		urine potassium amount (VT:0010539)	urine potassium level (CMO:0000128)	1	35239598	78430678	Rat
2313051	Bss57	Bone structure and strength QTL 57	3.7	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	43284731	118944897	Rat
2313059	Bss55	Bone structure and strength QTL 55	3.2	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
2313072	Bss53	Bone structure and strength QTL 53	4.3	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	43284731	118944897	Rat
2313078	Bss54	Bone structure and strength QTL 54	3.5	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
2313094	Bss58	Bone structure and strength QTL 58	3.7	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	43284731	118944897	Rat
2313098	Bmd70	Bone mineral density QTL 70	3.6	0.0001	tibia mineral mass (VT:1000283)	cortical volumetric bone mineral density (CMO:0001730)	1	43284731	118944897	Rat
2313099	Bss56	Bone structure and strength QTL 56	2.4	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	1	43284731	118944897	Rat
2302059	Pia36	Pristane induced arthritis QTL 36	3.8	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	1	43333002	88333002	Rat
1331778	Rf28	Renal function QTL 28	4.66		urine potassium amount (VT:0010539)	urine potassium excretion rate (CMO:0000761)	1	45803140	78430678	Rat
2313402	Anxrr24	Anxiety related response QTL 24			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	1	48963584	144267916	Rat
4889962	Bss94	Bone structure and strength QTL 94	3.8		tibia area (VT:1000281)	tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722)	1	49361465	82174945	Rat
1578649	Bmd8	Bone mineral density QTL 8	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	1	49393172	94393172	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	49393172	159356837	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	49393289	199050459	Rat
6903308	Scl36	Serum cholesterol QTL 36	2	0.0125	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	53863041	90532583	Rat
4889919	Bss86	Bone structure and strength QTL 86	4.1		tibia area (VT:1000281)	tibia midshaft total cross-sectional area (CMO:0001715)	1	53895117	82174945	Rat
4889929	Bss87	Bone structure and strength QTL 87	6.7		tibia area (VT:1000281)	tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722)	1	53895117	82174945	Rat
61342	Bp27	Blood pressure QTL 27	3.4	0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	56732668	98773277	Rat
2300164	Bmd44	Bone mineral density QTL 44	5.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	1	56949932	101949932	Rat
2298545	Neuinf8	Neuroinflammation QTL 8	4.6		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	1	57336763	151090257	Rat

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system
High
Medium				1
Low		12	12	7	12		8	1	2	9
Below cutoff	30	17	10	6	10	1	27	26	21	2

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001408783	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_001073508	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_003753185	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	JACYVU010000023	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000064917 ⟹ ENSRNOP00000061936

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	1	59,800,984 - 59,802,401 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000117661 ⟹ ENSRNOP00000094760

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	58,776,752 - 58,786,019 (+)	Ensembl

RefSeq Acc Id:

XM_001073508 ⟹ XP_001073508

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	1	58,776,592 - 58,785,227 (+)	NCBI
Rnor_6.0	1	59,800,558 - 59,809,507 (-)	NCBI
Rnor_5.0	1	60,719,375 - 60,727,932 (-)	NCBI
RGSC_v3.4	1	56,622,816 - 56,624,057 (+)	RGD

Sequence:

show sequence

CTGCTGAGAGCCAAGTACTTCAGTTGCATCACAGGATCCAGGAGTGAGCCAGAGGAAGGAGACC
TCATCTGGTTGTGCAGACAAAATGGAAGCCAACTATTCCGTCCCTCTGAATGTATCAGAAGTGG
TGGTCTATGATTCTACCATCTCCAGAGTTCTGTGGATCCTCTCAATGGTGGTTCTCTCCATTAC
ATTTGTCCTTGGTGTGCTGGGTAATGGACTAGTGATCTGGGTAGCTGGATTCCGGATGGTACAC
ACTGTTACCACTACTTGTTATCTGAATTTAGCTTTGGCTGACTTCTCTTTCACAGCAACTCTAC
CATTCTTTGTCATCTCAACTGCTATGAAAGAAAAATGGCCTTTTGGCTGGTTTCTGTGTAAATT
AGTTCACATTGTGGTAGACATAAACCTCTTTGGAAGTGTCTTCCTGATTGCTTTAATTGCCTTG
GACCGCTGCATTTGTGTCCTGCATCCAGTCTGGGCTCAGAACCACCGCACTGTGAGCCTGGCTC
GGAAGGTGGTTGTTGGGCCCTGGATTTTAGCTCTGATTCTCACTTTGCCCATTTTTGTTTTCAT
GACTACAGTTAGAGTTCCTGGAGGTAATGTGTACTGTACATTCAACTATGCATCCTGGGGAAAA
ACTGTTGAAGAAGTGCTGGACGTAGCAAACACTTGTGAAACAGTTAGAGGGACCATCAGGTTCG
TTATTGGCTTCACAATGCCCATGTCCATTGTGGCCATCTGCTATGGACTCATCGCTGTCAAGAT
CCACAGAAGAGCACTTGTTAATTCCAGTCGTCCCTTACGAGTCCTTACAGCAGTTGTGGTTTCT
TTCTTTATCTGTTGGTTTCCCTTTCAACTGGTGGCCCTTTTAGGTACAATCTGGTTCAAAGAGC
TATTGTTTAATACTCGTTACGGAATTCTTAAGATGTGGGTTAACCCAACCAGCTCATTGGCCTA
CTTCAATAGTTGCCTCAATCCAATGCTCTATGTTTTCATGGGCCAGGACTTCCGAGAGAGACTG
ATTCATTCTCTGCCTTCCAGTTTGGAGAGAGCTCTGAGTGAGGACTGTGGCCAAACCAGTGATA
CAGGCACAAATTCTGCTTTACCTCCTGCAGACATTGAGATAAAAGCAATATGAAGATTGGGATG
AGGGATTTTTTTTGTCTTACCTCAGTTGAATTCCAGTTTTGTCTTACGTTATGTTGTGCCCTAG
AGCAATTTTAACCTAATAAAATACTTCTCTGTCTCCTGACTCTGGGAAAAGAATTAAAAGTCAA
TATTTAAGTAATCTTTCTTGGGGGAATCTTTATATGTATATACTACCATAGCCTGTTTTGAGAA
AAGAAAATTTTAGTTCTGGTGTTTATGAATAGTCCTGTATTGGAAAGAATGATGATAATATGGC
TATTGTCACTCAATCATTCAAACATTTTTTAAAGGAAATCTTAGAATCTGAGTTAAATAGTTAT
TTACATATTTACATTCTAATGGCACAGGTTATACCAAGCATTCTTATGAACATAAAGGTGGGGG
GGGGCAACATTTTACTTACTTTCAAAGATGATGTGTCTGCAAGAGTCAAGAGGAGTTGATATTG
TGTGCTTCAAAAAATAGTGAGGGGGCAAAAAAAGGAAGTCAGTGTTTGAAATGATCAAAATAGA
AAATATTTAAAAACTCAAATTGTACAGAATTTGCCATATAATTTGTTAAGTTTTTTAAAGTAAA
TATACAAACCTATATATTTCCTGTAAAATTTTA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001395712	(Get FASTA)	NCBI Sequence Viewer
	XP_001073508	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:

XP_001073508 ⟸ XM_001073508

- UniProtKB:

F1M670 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MEANYSVPLNVSEVVVYDSTISRVLWILSMVVLSITFVLGVLGNGLVIWVAGFRMVHTVTTTCY
LNLALADFSFTATLPFFVISTAMKEKWPFGWFLCKLVHIVVDINLFGSVFLIALIALDRCICVL
HPVWAQNHRTVSLARKVVVGPWILALILTLPIFVFMTTVRVPGGNVYCTFNYASWGKTVEEVLD
VANTCETVRGTIRFVIGFTMPMSIVAICYGLIAVKIHRRALVNSSRPLRVLTAVVVSFFICWFP
FQLVALLGTIWFKELLFNTRYGILKMWVNPTSSLAYFNSCLNPMLYVFMGQDFRERLIHSLPSS
LERALSEDCGQTSDTGTNSALPPADIEIKAI

hide sequence

RefSeq Acc Id:

ENSRNOP00000061936 ⟸ ENSRNOT00000064917

RefSeq Acc Id:

ENSRNOP00000094760 ⟸ ENSRNOT00000117661

Protein Domains

G_PROTEIN_RECEP_F1_2

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-F1M670-F1-model_v2	AlphaFold	F1M670	1-351	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1584013	AgrOrtholog
BioCyc Gene	G2FUF-61247	BioCyc
Ensembl Genes	ENSRNOG00000042605	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000094760	ENTREZGENE
	ENSRNOP00000094760.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000117661	ENTREZGENE
	ENSRNOT00000117661.1	UniProtKB/TrEMBL
InterPro	7TM_GPCR_Rhodpsn	UniProtKB/TrEMBL
	Formyl_pep_1_rcpt	UniProtKB/TrEMBL
	Frt_met_rcpt	UniProtKB/TrEMBL
	GPCR_Rhodpsn_supfam	UniProtKB/TrEMBL
NCBI Gene	690158	ENTREZGENE
PANTHER	PTHR24225	UniProtKB/TrEMBL
	PTHR24225:SF15	UniProtKB/TrEMBL
Pfam	7tm_1	UniProtKB/TrEMBL
PhenoGen	Fpr2	PhenoGen
PRINTS	GPCRRHODOPSN	UniProtKB/TrEMBL
PROSITE	G_PROTEIN_RECEP_F1_1	UniProtKB/TrEMBL
	G_PROTEIN_RECEP_F1_2	UniProtKB/TrEMBL
UniProt	A0A8I6AM80	ENTREZGENE, UniProtKB/TrEMBL
	F1M670	ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-07-08	Fpr2	formyl peptide receptor 2	LOC681693	similar to formyl peptide receptor, related sequence 2	Data Merged	1643240	APPROVED
2008-05-20	Fpr2	formyl peptide receptor 2	Fpr-rs2	formyl peptide receptor, related sequence 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-06	Fpr-rs2	formyl peptide receptor, related sequence 2	LOC690158	similar to formyl peptide receptor, related sequence 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-11-20	LOC681693	similar to formyl peptide receptor, related sequence 2			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-11-19	LOC690158	similar to formyl peptide receptor, related sequence 2			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - CTD