Tph2 (tryptophan hydroxylase 2) - Rat Genome Database

Name: Tph2
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Gene: Tph2 (tryptophan hydroxylase 2) Rattus norvegicus

Analyze

Symbol:

Tph2

Name:

tryptophan hydroxylase 2

RGD ID:

631332

Description:

Predicted to enable tryptophan 5-monooxygenase activity. Involved in several processes, including cellular response to lithium ion; response to activity; and response to estrogen. Predicted to be active in neuron projection. Human ortholog(s) of this gene implicated in autistic disorder; major depressive disorder; and panic disorder. Orthologous to human TPH2 (tryptophan hydroxylase 2); PARTICIPATES IN tryptophan metabolic pathway; INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,3-bis(4-hydroxyphenyl)propionitrile.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

neuronal tryptophan hydroxylase; Ntph; tryptophan 5-hydroxylase 2; tryptophan 5-monooxygenase 2

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	TPH2 (tryptophan hydroxylase 2)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Tph2 (tryptophan hydroxylase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Tph2 (tryptophan hydroxylase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	TPH2 (tryptophan hydroxylase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	TPH2 (tryptophan hydroxylase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Tph2 (tryptophan hydroxylase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	TPH2 (tryptophan hydroxylase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	TPH2 (tryptophan hydroxylase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Tph2 (tryptophan hydroxylase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	TPH2 (tryptophan hydroxylase 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Tph2 (tryptophan hydroxylase 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	tph2 (tryptophan hydroxylase 2 (tryptophan 5-monooxygenase))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	tph-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	Trhn	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	tph2	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Allele / Splice:

Tph2^em2Mcwi Tph2^em3Mcwi

Genetic Models:

DA-Tph2^em2Mcwi DA-Tph2^em3Mcwi DA-Tph2^em3Mcwi+/+ DA-Tph2^em2Mcwi-/- DA-Tph2^em3Mcwi-/- DA-Tph2^em2Mcwi+/- DA-Tph2^em3Mcwi+/-

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	52,571,909 - 52,676,305 (-)	NCBI		GRCr8
mRatBN7.2	7	50,685,694 - 50,789,424 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	50,685,694 - 50,789,424 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	52,592,588 - 52,696,312 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	54,795,694 - 54,899,410 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	54,573,629 - 54,677,371 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	58,042,279 - 58,149,220 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	58,042,281 - 58,149,061 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	58,053,268 - 58,157,949 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	54,321,033 - 54,430,706 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	54,341,665 - 54,451,339 (-)	NCBI
Celera	7	47,478,282 - 47,582,240 (-)	NCBI		Celera
Cytogenetic Map	7	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

attention deficit hyperactivity disorder (ISO)

Attention Deficit-Hyperactivity Disorder 7 (ISO)

autistic disorder (ISO)

bipolar disorder (ISO)

depressive disorder (ISO)

Fever (ISO)

genetic disease (ISO)

major depressive disorder (ISO)

melancholic depression (ISS)

panic disorder (ISO)

pulmonary hypertension (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(S)-nicotine (ISO)

1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (ISO)

17beta-estradiol (EXP)

2,3',4,4',5-Pentachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

2,3-bis(4-hydroxyphenyl)propionitrile (EXP)

4,4'-sulfonyldiphenol (EXP,ISO)

6-propyl-2-thiouracil (EXP)

8-Br-cAMP (ISO)

aflatoxin B1 (ISO)

aldehydo-D-glucose (ISO)

ammonium chloride (EXP)

atrazine (EXP)

benzo[a]pyrene (ISO)

benzo[e]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

caffeine (ISO)

CGP 52608 (ISO)

cyhalothrin (EXP)

D-glucose (ISO)

ethanol (ISO)

fluoxetine (EXP,ISO)

folic acid (ISO)

fructose (ISO)

glucose (ISO)

lithium chloride (EXP)

mephedrone (EXP,ISO)

methamphetamine (ISO)

methapyrilene (ISO)

methoxychlor (EXP)

N,N-diethyl-m-toluamide (EXP)

N-[2-(4-bromocinnamylamino)ethyl]isoquinoline-5-sulfonamide (EXP)

N-Nitrosopyrrolidine (ISO)

nicotine (ISO)

O-methyleugenol (ISO)

ochratoxin A (EXP)

permethrin (EXP)

PhIP (EXP)

propamocarb (ISO)

serotonin (ISO)

sertraline (EXP)

sodium arsenite (ISO)

streptozocin (ISO)

trichloroethene (EXP)

triptonide (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

aromatic amino acid metabolic process (IEA)

cellular response to lithium ion (IEP)

circadian rhythm (IEP)

response to activity (IEP)

response to calcium ion (IEP)

response to estrogen (IEP)

response to glucocorticoid (IEP)

response to nutrient levels (IEP)

serotonin biosynthetic process (IEA)

Cellular Component

neuron projection (IBA,IEA,ISO)

Molecular Function

iron ion binding (IEA)

tryptophan 5-monooxygenase activity (IBA,IEA,ISO,ISS)

Molecular Pathway Annotations Click to see Annotation Detail View

tryptophan metabolic pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Possible association between autism and variants in the brain-expressed tryptophan hydroxylase gene (TPH2).	Coon H, etal., Am J Med Genet B Neuropsychiatr Genet. 2005 May 5;135B(1):42-6.
2.	Tryptophan hydroxylase 2 gene expression and promoter polymorphisms in bipolar disorder and schizophrenia.	De Luca V, etal., Psychopharmacology (Berl). 2005 Dec;183(3):378-82. Epub 2005 Oct 21.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Estrogen selectively increases tryptophan hydroxylase-2 mRNA expression in distinct subregions of rat midbrain raphe nucleus: association between gene expression and anxiety behavior in the open field.	Hiroi R, etal., Biol Psychiatry. 2006 Aug 1;60(3):288-95. Epub 2006 Feb 3.
5.	Tryptophan hydroxylase 1 knockout and tryptophan hydroxylase 2 polymorphism: effects on hypoxic pulmonary hypertension in mice.	Izikki M, etal., Am J Physiol Lung Cell Mol Physiol. 2007 Oct;293(4):L1045-52. Epub 2007 Aug 3.
6.	Cell-type specific induction of tryptophan hydroxylase-2 transcription by calcium mobilization.	Lenicov FR, etal., J Neurochem. 2007 Dec;103(5):2047-57. Epub 2007 Sep 14.
7.	Diurnal rhythms of tryptophan hydroxylase 1 and 2 mRNA expression in the rat retina.	Liang J, etal., Neuroreport. 2004 Jun 28;15(9):1497-500.
8.	Daily rhythm of tryptophan hydroxylase-2 messenger ribonucleic acid within raphe neurons is induced by corticoid daily surge and modulated by enhanced locomotor activity.	Malek ZS, etal., Endocrinology. 2007 Nov;148(11):5165-72. Epub 2007 Jun 26.
9.	Association study of tryptophan hydroxylase 2 gene polymorphisms in panic disorder.	Maron E, etal., Neurosci Lett. 2007 Jan 16;411(3):180-4. Epub 2006 Nov 22.
10.	Omega-3 fatty acid deficiency during perinatal development increases serotonin turnover in the prefrontal cortex and decreases midbrain tryptophan hydroxylase-2 expression in adult female rats: dissociation from estrogenic effects.	McNamara RK, etal., J Psychiatr Res. 2009 Mar;43(6):656-63. Epub 2008 Nov 4.
11.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
12.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
13.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
14.	Family-based association study of TPH1 and TPH2 polymorphisms in autism.	Ramoz N, etal., Am J Med Genet B Neuropsychiatr Genet. 2006 Dec 5;141B(8):861-7.
15.	GOA pipeline	RGD automated data pipeline
16.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
17.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
18.	Comprehensive gene review and curation	RGD comprehensive gene curation
19.	Lithium modulates tryptophan hydroxylase 2 gene expression and serotonin release in primary cultures of serotonergic raphe neurons.	Scheuch K, etal., Brain Res. 2010 Jan 11;1307:14-21. Epub 2009 Oct 17.
20.	Serotonergic changes produced by repeated exposure to forced swimming: correlation with behavior.	Shishkina GT, etal., Ann N Y Acad Sci. 2008 Dec;1148:148-53.
21.	Synthesis of serotonin by a second tryptophan hydroxylase isoform.	Walther DJ, etal., Science 2003 Jan 3;299(5603):76.

Additional References at PubMed

PMID:12911638	PMID:16115212	PMID:16917826	PMID:17950541	PMID:18197473	PMID:19559077	PMID:19588223	PMID:19647049	PMID:19906978	PMID:20127812	PMID:21182901	PMID:21272616
PMID:21924839	PMID:22511363	PMID:31078489	PMID:31415826	PMID:31505169	PMID:34874128	PMID:36868221	PMID:37848703

Genomics

Comparative Map Data

Tph2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	52,571,909 - 52,676,305 (-)	NCBI		GRCr8
mRatBN7.2	7	50,685,694 - 50,789,424 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	50,685,694 - 50,789,424 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	52,592,588 - 52,696,312 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	54,795,694 - 54,899,410 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	54,573,629 - 54,677,371 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	58,042,279 - 58,149,220 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	58,042,281 - 58,149,061 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	58,053,268 - 58,157,949 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	54,321,033 - 54,430,706 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	54,341,665 - 54,451,339 (-)	NCBI
Celera	7	47,478,282 - 47,582,240 (-)	NCBI		Celera
Cytogenetic Map	7	q22	NCBI

TPH2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	12	71,938,845 - 72,032,440 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	12	71,938,845 - 72,186,618 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	12	72,332,625 - 72,426,220 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	70,618,893 - 70,712,488 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	12	70,618,892 - 70,712,488	NCBI
Celera	12	71,995,911 - 72,089,543 (+)	NCBI		Celera
Cytogenetic Map	12	q21.1	NCBI
HuRef	12	69,382,235 - 69,474,238 (+)	NCBI		HuRef
CHM1_1	12	72,299,779 - 72,391,813 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	12	71,916,323 - 72,008,338 (+)	NCBI		T2T-CHM13v2.0

Tph2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	10	114,914,546 - 115,020,927 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	10	114,914,546 - 115,020,927 (-)	Ensembl		GRCm39 Ensembl
GRCm38	10	115,078,641 - 115,185,022 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	10	115,078,641 - 115,185,022 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	10	114,515,697 - 114,622,078 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	10	114,482,751 - 114,589,132 (-)	NCBI		MGSCv36	mm8
Celera	10	117,006,698 - 117,113,837 (-)	NCBI		Celera
Cytogenetic Map	10	D2	NCBI
cM Map	10	63.51	NCBI

Tph2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955405	11,886,206 - 11,982,550 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955405	11,877,474 - 11,981,035 (+)	NCBI	ChiLan1.0	ChiLan1.0

TPH2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	10	79,966,411 - 80,062,791 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	12	79,962,807 - 80,059,170 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	12	69,460,883 - 69,557,329 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	12	72,318,908 - 72,412,557 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	12	72,318,908 - 72,412,557 (+)	Ensembl	panpan1.1		panPan2

TPH2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	10	13,442,611 - 13,526,537 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	10	13,442,611 - 13,527,243 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	10	13,381,425 - 13,464,836 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	10	13,578,664 - 13,662,404 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	10	13,578,143 - 13,663,110 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	10	13,440,095 - 13,523,686 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	10	13,688,920 - 13,772,483 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	10	13,812,858 - 13,896,308 (+)	NCBI		UU_Cfam_GSD_1.0

Tph2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	44,662,510 - 44,753,680 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936568	974,767 - 1,065,804 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936568	974,575 - 1,065,800 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TPH2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	5	35,918,370 - 36,017,509 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	5	35,917,159 - 36,016,981 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	5	38,620,459 - 38,716,640 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TPH2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	11	67,568,744 - 67,664,911 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666037	177,991,214 - 178,084,445 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Tph2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624750	25,702,630 - 25,801,618 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624750	25,702,597 - 25,801,938 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Tph2
212 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	308
Count of miRNA genes:	199
Interacting mature miRNAs:	236
Transcripts:	ENSRNOT00000005157
Prediction methods:	Microtar, Miranda, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
634336	Anxrr17	Anxiety related response QTL 17	3.66		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	924703	115097879	Rat
10755440	Coatc10	Coat color QTL 10		0	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	7	7496499	52496499	Rat
10059592	Kidm45	Kidney mass QTL 45	3.95	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	7	7573985	52573985	Rat
2298547	Neuinf5	Neuroinflammation QTL 5	3.7		nervous system integrity trait (VT:0010566)	spinal cord Cd74 protein level (CMO:0002131)	7	9462246	58265113	Rat
1643004	Pain2	Pain QTL 2	1		mechanical nociception trait (VT:0002734)	self mutilation severity score (CMO:0002145)	7	9462246	98011544	Rat
1578652	Bmd15	Bone mineral density QTL 15	5.2		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	7	9866467	60460686	Rat
738033	Anxrr6	Anxiety related response QTL 6	4.1		exploratory behavior trait (VT:0010471)	percentage of entries into a discrete space in an experimental apparatus (CMO:0000961)	7	15573889	60573889	Rat
2317059	Aia15	Adjuvant induced arthritis QTL 15	2.46		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	7	17004598	62004598	Rat
10755451	Coatc11	Coat color QTL 11		0	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	7	17944357	62944357	Rat
1354639	Spl5	Serum phospholipid level QTL 5	3.9		blood LDL phospholipid amount (VT:0010505)	blood low density lipoprotein phospholipid level (CMO:0001568)	7	19654317	52888450	Rat
1300132	Bp182	Blood pressure QTL 182	3.49		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	7	19654317	84928080	Rat
7411569	Bw137	Body weight QTL 137		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	7	21921195	66921195	Rat
1641885	Alcrsp9	Alcohol response QTL 9			alcohol metabolism trait (VT:0015089)	blood ethanol level (CMO:0000535)	7	24099606	69099606	Rat
1549840	Bss5	Bone structure and strength QTL 5	9.8		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	7	24751841	69751841	Rat
70190	Mcs6	Mammary carcinoma susceptibility QTL 6	2.29		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	7	26737401	63902784	Rat
1300138	Hrtrt9	Heart rate QTL 9	4.72		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	7	29409683	53612950	Rat
10402855	Bp379	Blood pressure QTL 379		0.21	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	29409683	74409683	Rat
1300127	Srn1	Serum renin concentration QTL 1	3.87		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	7	29409683	84928080	Rat
10755453	Coatc12	Coat color QTL 12		0	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	7	31112832	76112832	Rat
7411605	Foco14	Food consumption QTL 14	24.1	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	34293282	79293282	Rat
631534	Lnnr1	Liver neoplastic nodule remodeling QTL 1	3.85	0.001	liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number to liver total tumorous lesion number ratio (CMO:0001705)	7	34293282	79293282	Rat
631513	Scl7	Serum cholesterol level QTL 7	4.1		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	7	37960569	82960569	Rat
2303629	Vencon3	Ventilatory control QTL 3	7.25		respiration trait (VT:0001943)	respiration rate (CMO:0000289)	7	41109692	56793354	Rat
61357	Bp38	Blood pressure QTL 38	1.6	0.052	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	41333674	119109060	Rat
634326	Hc3	Hypercalciuria QTL 3	2.1		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	7	42787314	87787314	Rat
10053722	Scort27	Serum corticosterone level QTL 27	2.41	0.0083	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	7	43228750	88228750	Rat
1358361	Sradr5	Stress Responsive Adrenal Weight QTL 5	5.55		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	7	43747012	108555253	Rat
1300179	Kidm5	Kidney mass QTL 5	3.51		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	43747012	135012528	Rat
1300149	Cm6	Cardiac mass QTL 6	4.09		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	7	43747099	102228765	Rat
631504	Cm27	Cardiac mass QTL 27	3.45		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	7	44421311	118198041	Rat
61428	Scl3	Serum cholesterol level QTL 3	3.2		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	7	44867533	89867533	Rat
738030	Anxrr8	Anxiety related response QTL 8	4.1		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	46590070	91590070	Rat
10059605	Kidm47	Kidney mass QTL 47	2.91	0.05	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	7	47251783	65728867	Rat
2293696	Bmd32	Bone mineral density QTL 32	5.1	0.0001	femur strength trait (VT:0010010)	femoral neck polar moment of inertia (CMO:0001670)	7	47651439	92651439	Rat
2293707	Bss32	Bone structure and strength QTL 32	7.64	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	7	47651439	92651439	Rat
2300178	Bmd54	Bone mineral density QTL 54	5.3	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	7	47651439	92651439	Rat
2293644	Bmd29	Bone mineral density QTL 29	5.4	0.0001	femur size trait (VT:1000369)	femoral neck cross-sectional area (CMO:0001697)	7	47651439	92651439	Rat
2293667	Bss42	Bone structure and strength QTL 42	7.25	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra cross-sectional area (CMO:0001689)	7	47651439	92651439	Rat
2293678	Bss24	Bone structure and strength QTL 24	6.71	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	7	47651439	92651439	Rat
2293685	Bmd21	Bone mineral density QTL 21	4.2	0.0003	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	7	47651439	92651439	Rat

Markers in Region

RH132298

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	50,685,695 - 50,685,852 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	58,042,283 - 58,042,439	NCBI	Rnor6.0
Rnor_5.0	7	58,053,272 - 58,053,428	UniSTS	Rnor5.0
RGSC_v3.4	7	54,321,035 - 54,321,191	UniSTS	RGSC3.4
Celera	7	47,478,284 - 47,478,440	UniSTS
RH 3.4 Map	7	442.0	UniSTS
Cytogenetic Map	7	q22	UniSTS

BI279052

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	50,686,685 - 50,686,866 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	58,043,273 - 58,043,453	NCBI	Rnor6.0
Rnor_5.0	7	58,054,262 - 58,054,442	UniSTS	Rnor5.0
RGSC_v3.4	7	54,322,025 - 54,322,205	UniSTS	RGSC3.4
Celera	7	47,479,274 - 47,479,454	UniSTS
RH 3.4 Map	7	442.6	UniSTS
Cytogenetic Map	7	q22	UniSTS

Genetic Models

This gene Tph2 is modified in the following models/strains:

DA-Tph2^em2Mcwi DA-Tph2^em3Mcwi DA-Tph2^em3Mcwi+/+ DA-Tph2^em2Mcwi-/- DA-Tph2^em3Mcwi-/- DA-Tph2^em2Mcwi+/- DA-Tph2^em3Mcwi+/-

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	appendage
High
Medium									5
Low			8						47	14	21
Below cutoff	3	2	7	3	4	3	1	1	16	13	15	1

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_173839	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008765357	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017594904	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063263689	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AY098915	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473960	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000005157 ⟹ ENSRNOP00000005157

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	50,685,694 - 50,789,424 (-)	Ensembl
Rnor_6.0 Ensembl	7	58,042,281 - 58,149,061 (-)	Ensembl

RefSeq Acc Id:

NM_173839 ⟹ NP_776211

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	52,571,911 - 52,675,639 (-)	NCBI
mRatBN7.2	7	50,685,694 - 50,789,424 (-)	NCBI
Rnor_6.0	7	58,042,281 - 58,149,061 (-)	NCBI
Rnor_5.0	7	58,053,268 - 58,157,949 (-)	NCBI
RGSC_v3.4	7	54,321,033 - 54,430,706 (-)	RGD
Celera	7	47,478,282 - 47,582,240 (-)	RGD

Sequence:

show sequence

CAGGGTTCTGGACAGCGCCTCGAGCAGCCAGCTGCCGCTCACCTTCCTCCTACATCTCTGCCAA
GGCTGCCCCTCTGATCCCCCCTGCTGCTGAGAAAGAAAATTACATCGGGATCCATGCAGCCCGC
AATGATGATGTTTTCCAGTAAATACTGGGCCAGGAGAGGGTTGTCCTTGGATTCAGCGGTGCCA
GAAGAGCATCAGATACTTGGCGGCTTAACACAAAATAAGGCTACCGCTAGCAAAAGCGAGGACA
AGAGAAGCGGCAAAGACACTTCGGAGAGCAGCAAGACTGCGGTTGTGTTCTCCCTGAAGAATGA
AGTTGGCGGGCTGGTGAGAGCACTGAGACTCTTCCAGGAAAAACACGTCAACATGCTCCATATT
GAATCCAGGAGGTCCCGGCGAAGAAGTTCTGAAGTCGAAATCTTCGTGGACTGTGAATGTGGCA
AAACAGAATTCAACGAGCTCATTCAGTTGCTCAAGTTTCAGACCACCATTGTGACGCTGAATCC
ACCTGACAACATTTGGACGGAGGAAGAAGAACTAGAGGATGTGCCGTGGTTCCCTCGGAAGATC
TCTGAGTTAGACAGATGCTCTCACAGAGTCCTCATGTACGGCACCGAGCTTGACGCCGACCACC
CAGGATTCAAGGACAACGTCTATCGACAGAGGAGGAAGTATTTTGTGGATGTGGCCATGGGTTA
TAAATATGGCCAGCCCATTCCCAGGGTGGAATACACAGAAGAAGAGACTAAAACTTGGGGTGTT
GTGTTTCGGGAGCTCTCCAAACTCTACCCCACTCATGCTTGCCGAGAGTACCTGAAAAACTTCC
CCCTGCTGACCAAGTACTGCGGCTACAGGGAAGACAACGTCCCGCAGCTGGAAGACGTCTCCAT
GTTTCTGAAAGAGCGATCTGGCTTCACAGTGAGACCAGTGGCTGGCTACCTGAGCCCAAGAGAC
TTCCTGGCTGGGCTGGCCTACAGAGTATTCCACTGCACTCAGTACGTGCGGCATGGCTCCGACC
CCCTCTACACCCCGGAACCAGACACATGCCATGAGCTCCTGGGACATGTGCCACTGCTGGCGGA
TCCCAAGTTCGCTCAGTTTTCTCAAGAAATAGGCTTAGCCTCTCTGGGAGCCTCAGATGAAGAC
GTTCAGAAACTGGCCACGTGCTATTTCTTCACAATCGAGTTCGGCCTTTGCAAGCAAGAAGGTC
AACTGCGGGCGTACGGAGCAGGGTTACTTTCCTCCATCGGAGAATTGAAGCATGCTCTTTCTGA
CAAGGCGTGTGTAAAAGCCTTTGACCCGAAGACAACCTGCTTGCAGGAATGCCTAATCACCACC
TTCCAAGATGCTTACTTTGTTTCTGAAAGTTTTGAAGAAGCCAAAGAGAAGATGAGGGATTTTG
CAAAGTCAATTACCCGTCCTTTCTCAGTATATTTCAACCCCTACACACAGAGCATTGAAATTCT
GAAAGACACCAGAAGTATTGAGAATGTGGTGCAGGACCTGCGCAGTGATTTGAACACCGTGTGC
GACGCCTTGAATAAAATGAACCAATATTTGGGGATTTGAGCCTATTGTCAGCACGAGCTCTTGG
GGGCTTAGCAACAATGCAGTCAATGTTATCCAACATCAACAACTTTCTGTGTCATGGCTGGCTA
GTAAGCATGCAATTCCATGTGTCTATACCTCTATGTAACTTAACATACAAAAATGATCTAAGAA
ACCCAGGCAGATGACCATTCAGCATTTTAAAGATTGTGATCTATTTGAACATCTCAAGTAGATT
TGACATTTCTGATTAGTGAGCAAACTGTAACTTAAGCAAACTGTGTCTTTAAAATTTGTAGCCA
ACATTCCTCACACAATTCCAGCTGCTGAGTCCTTGACCTTTTCTTCCTTGGACCTGAGTCTTTC
CTCTGTGTTCATTAGATAAAATGAAAACAGTTGGGAGGTGGTTTCTACTTTCAATAGTATTGGT
GTTCTCTGAGATAAACTAGAGTTGCTCCAAGCTTCGCATCACAGTAACAAAAGATTTAATATTT
TACTTCAGAAGCTGTTCAGAAACACAGCGATTGGAATGAATCTGGACTGAGTGTTTAGACAATG
CAAGAAAAGAAAAATTTTGATAAACAGGATATATAGATTGCACTGACCTTGTTGAAACCAATTT
GTGGTACGCTTCCTGAAGTGCTTTTGGAAGGAAACACTTTGACAAAGAATATTTGGAAAGGTTA
AACAGAAGGGAAGAAAATCTTGGAACTGTGAATGTGTCATTAGAATAAAGTGAATTATCAGTGC
AGGTGTGACTCCTTTCTCTTACACTGAGAACCCCAAATCCTGCAGGGATGTGAGTACCATCTCT
GATTCCGAAGATTTGGAAACCGAGTCACAGAGAAACAAAGGGATTTGCTTCAGTTAGGTCTGTT
GGCTGGGGGTGCAGTCATAATCCCCCCCCCCCTTTATGTTGGACTTCTGGCAAGTCTACTGTAG
TGTACATGCGGGTTTATGTATGGACAAAAAAAGAAAACTAATGCGTATAAAACTAATGCTTCTC
AATAAACAGAAACTTGCCCCC

hide sequence

RefSeq Acc Id:

XM_063263689 ⟹ XP_063119759

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	52,571,909 - 52,676,305 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_776211	(Get FASTA)	NCBI Sequence Viewer
	XP_063119759	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAM28947	(Get FASTA)	NCBI Sequence Viewer
	EDM16695	(Get FASTA)	NCBI Sequence Viewer
	EDM16696	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000005157
	ENSRNOP00000005157.5
GenBank Protein	Q8CGU9	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_776211 ⟸ NM_173839

- UniProtKB:

Q8CGU9 (UniProtKB/Swiss-Prot), A6IGK2 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MQPAMMMFSSKYWARRGLSLDSAVPEEHQILGGLTQNKATASKSEDKRSGKDTSESSKTAVVFS
LKNEVGGLVRALRLFQEKHVNMLHIESRRSRRRSSEVEIFVDCECGKTEFNELIQLLKFQTTIV
TLNPPDNIWTEEEELEDVPWFPRKISELDRCSHRVLMYGTELDADHPGFKDNVYRQRRKYFVDV
AMGYKYGQPIPRVEYTEEETKTWGVVFRELSKLYPTHACREYLKNFPLLTKYCGYREDNVPQLE
DVSMFLKERSGFTVRPVAGYLSPRDFLAGLAYRVFHCTQYVRHGSDPLYTPEPDTCHELLGHVP
LLADPKFAQFSQEIGLASLGASDEDVQKLATCYFFTIEFGLCKQEGQLRAYGAGLLSSIGELKH
ALSDKACVKAFDPKTTCLQECLITTFQDAYFVSESFEEAKEKMRDFAKSITRPFSVYFNPYTQS
IEILKDTRSIENVVQDLRSDLNTVCDALNKMNQYLGI

hide sequence

RefSeq Acc Id:

ENSRNOP00000005157 ⟸ ENSRNOT00000005157

RefSeq Acc Id:	XP_063119759 ⟸ XM_063263689
- Peptide Label:	isoform X1
- UniProtKB:	A0A8L2Q1S6 (UniProtKB/TrEMBL)

Protein Domains

ACT Biopterin-dependent aromatic amino acid hydroxylase

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q8CGU9-F1-model_v2	AlphaFold	Q8CGU9	1-485	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:631332	AgrOrtholog
BioCyc Gene	G2FUF-34069	BioCyc
BioCyc Pathway	PWY-6030 [serotonin and melatonin biosynthesis]	BioCyc
BioCyc Pathway Image	PWY-6030	BioCyc
Ensembl Genes	ENSRNOG00000003880	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000005157	ENTREZGENE
	ENSRNOT00000005157.5	UniProtKB/TrEMBL
Gene3D-CATH	1.10.800.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	ACT-like_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ACT_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ArAA_hydroxylase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ArAA_hydroxylase_Fe/CU_BS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ArAA_hydroxylase_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Aro-AA_hydroxylase_C_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Aromatic-AA_hydroxylase_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Trp_5_mOase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TrpOH_cat	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Tyrosine_3-monooxygenase-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:317675	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
NCBI Gene	317675	ENTREZGENE
PANTHER	PTHR11473	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TRYPTOPHAN 5-HYDROXYLASE 2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	ACT	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Biopterin_H	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PharmGKB	TPH2	RGD
PhenoGen	Tph2	PhenoGen
PIRSF	PIRSF000336	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PRINTS	FYWHYDRXLASE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	ACT	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	BH4_AAA_HYDROXYL_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	BH4_AAA_HYDROXYL_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000003880	RatGTEx
Superfamily-SCOP	SSF55021	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SSF56534	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8L2Q1S6	ENTREZGENE, UniProtKB/TrEMBL
	A6IGK2	ENTREZGENE, UniProtKB/TrEMBL
	A6IGK3_RAT	UniProtKB/TrEMBL
	Q8CGU9	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2004-02-11	Tph2	tryptophan hydroxylase 2	Ntph	neuronal tryptophan hydroxylase	Symbol and Name updated to reflect Human and Mouse nomenclature	625702	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_expression	expressed in brain	633509

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

BioCyc Pathways

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

BioCyc Pathways