Advanced Search (OLGA)

Gene: Rasa1 (RAS p21 protein activator 1) Rattus norvegicus

Analyze

Symbol:

Rasa1

Name:

RAS p21 protein activator 1

RGD ID:

3537

Description:

Enables several functions, including GTPase activator activity; platelet-derived growth factor receptor binding activity; and protein kinase binding activity. Involved in several processes, including activation of GTPase activity; cellular response to epidermal growth factor stimulus; and cellular response to platelet-derived growth factor stimulus. Located in nuclear membrane. Human ortholog(s) of this gene implicated in arteriovenous malformation and basal cell carcinoma. Orthologous to human RASA1 (RAS p21 protein activator 1); PARTICIPATES IN protein kinase C (PKC) signaling pathway; ephrin - ephrin receptor bidirectional signaling axis; epidermal growth factor/neuregulin signaling pathway; INTERACTS WITH 2,2',4,4'-Tetrabromodiphenyl ether; 2,3,7,8-tetrachlorodibenzodioxine; 2,6-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

GAP; GAPX; GTPase-activating protein; p120GAP; ras GTPase-activating protein 1; RAS p21 protein activator; RAS p21 protein activator (GTPase activating protein) 1; Rasa; rasGAP

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	RASA1 (RAS p21 protein activator 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Rasa1 (RAS p21 protein activator 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Rasa1 (RAS p21 protein activator 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	RASA1 (RAS p21 protein activator 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	RASA1 (RAS p21 protein activator 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Rasa1 (RAS p21 protein activator 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	RASA1 (RAS p21 protein activator 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	RASA1 (RAS p21 protein activator 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Rasa1 (RAS p21 protein activator 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	TXNDC16 (thioredoxin domain containing 16)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	RASA1 (RAS p21 protein activator 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Rasa1 (RAS p21 protein activator 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	rasa1b (RAS p21 protein activator (GTPase activating protein) 1b)	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Danio rerio (zebrafish):	rasa1a (RAS p21 protein activator (GTPase activating protein) 1a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	vap	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	rasa1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	17,593,136 - 17,676,707 (-)	NCBI		GRCr8
mRatBN7.2	2	15,857,704 - 15,940,757 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	15,857,980 - 15,940,854 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	22,959,727 - 23,040,229 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	21,059,980 - 21,140,482 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	15,733,780 - 15,814,284 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	13,617,021 - 13,696,531 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	13,616,822 - 13,696,426 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	13,470,580 - 13,551,782 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	14,203,815 - 14,287,824 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	14,124,183 - 14,208,193 (-)	NCBI
Celera	2	12,124,725 - 12,204,755 (-)	NCBI		Celera
Cytogenetic Map	2	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Animal Mammary Neoplasms (ISO)

arteriovenous malformation (ISO)

basal cell carcinoma (ISO)

Capillary Malformation-Arteriovenous Malformation (ISO)

Capillary Malformation-Arteriovenous Malformation 1 (ISO)

carcinoma (ISO)

Central Nervous System Venous Angioma (ISO)

Chemical and Drug Induced Liver Injury (ISO)

Experimental Mammary Neoplasms (ISO)

familial adenomatous polyposis 1 (ISO)

genetic disease (ISO)

hereditary hemorrhagic telangiectasia (ISO)

Hereditary Neoplastic Syndromes (ISO)

Infantile Capillary Hemangioma (ISO)

Klippel-Trenaunay syndrome (ISO)

Left Ventricular Hypertrophy (ISO)

lung adenocarcinoma (ISO)

Multiple Basal Cell Carcinoma (ISO)

Neurodevelopmental Disorders (ISO)

Port-Wine Stain (ISO)

squamous cell carcinoma (ISO)

Sturge-Weber syndrome (ISO)

Vascular Malformations (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-taxifolin (ISO)

1,2-dimethylhydrazine (ISO)

1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (ISO)

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,6-dimethoxyphenol (ISO)

2,6-dinitrotoluene (EXP)

2-hydroxypropanoic acid (ISO)

3-chloropropane-1,2-diol (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

acrylamide (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

cadmium sulfate (ISO)

caffeine (ISO)

carbamazepine (ISO)

chlorpyrifos (ISO)

cisplatin (ISO)

cobalt dichloride (ISO)

copper atom (ISO)

copper(0) (ISO)

coumestrol (ISO)

crocidolite asbestos (ISO)

dexamethasone (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (EXP,ISO)

dichlorine (EXP)

diclofenac (ISO)

disulfiram (ISO)

doxorubicin (ISO)

epoxiconazole (ISO)

fenthion (ISO)

finasteride (EXP)

flavonoids (EXP)

flutamide (EXP)

folic acid (ISO)

fulvestrant (ISO)

furfural (ISO)

GTP (ISO)

indometacin (ISO)

irinotecan (ISO)

isoprenaline (EXP)

ivermectin (ISO)

ketamine (EXP)

lipopolysaccharide (ISO)

methidathion (ISO)

miconazole (ISO)

mitoxantrone (ISO)

oxaliplatin (EXP)

ozone (EXP)

paracetamol (ISO)

phenethyl isothiocyanate (EXP)

phenobarbital (ISO)

PhIP (EXP)

pirinixic acid (ISO)

potassium chromate (ISO)

quercetin (ISO)

rac-lactic acid (ISO)

raloxifene (EXP)

rofecoxib (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

sodium arsenite (ISO)

sodium chloride (ISO)

sodium fluoride (ISO)

sulindac (EXP)

sunitinib (ISO)

tamoxifen (ISO)

temozolomide (ISO)

testosterone (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

topotecan (EXP)

trichostatin A (ISO)

triphenyl phosphate (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

actin cytoskeleton organization (NAS)

activation of GTPase activity (IDA)

blood vessel morphogenesis (IEA,ISO)

cell adhesion (NAS)

cellular response to epidermal growth factor stimulus (IDA)

cellular response to fibroblast growth factor stimulus (IEP)

cellular response to platelet-derived growth factor stimulus (IDA)

male genitalia development (IEP)

mitotic cytokinesis (ISS)

negative regulation of apoptotic process (IEA,ISO,ISS)

negative regulation of cell adhesion (IEA,ISO,ISS)

negative regulation of cell-matrix adhesion (IEA,ISO,ISS)

negative regulation of neuron apoptotic process (ISS)

positive regulation of D-glucose import (IMP)

positive regulation of fibroblast proliferation (IMP)

positive regulation of GTPase activity (IMP)

positive regulation of peptidyl-tyrosine phosphorylation (IMP)

positive regulation of protein phosphorylation (IMP)

regulation of actin filament polymerization (IEA,ISO,ISS)

response to insulin (IEP)

response to xenobiotic stimulus (IDA)

signal transduction (IEA,ISO,ISS)

vasculogenesis (ISS)

Cellular Component

cytoplasm (IEA)

nuclear membrane (IDA)

plasma membrane (IEA,ISO)

ruffle (IEA,ISO)

Molecular Function

GTPase activator activity (IDA,IEA,ISO)

GTPase binding (IEA,ISO)

kinase binding (IPI)

phosphotyrosine residue binding (IEA,ISO)

platelet-derived growth factor receptor binding (IDA,IPI)

protein binding (IPI,ISO)

protein kinase B binding (IPI)

protein tyrosine kinase binding (IPI)

protein-containing complex binding (IDA,IPI)

receptor tyrosine kinase binding (IPI)

signaling receptor binding (IEA,ISO)

transmembrane transporter binding (IPI)

Molecular Pathway Annotations Click to see Annotation Detail View

ephrin - ephrin receptor bidirectional signaling axis (ISO)

epidermal growth factor/neuregulin signaling pathway (ISO)

insulin signaling pathway (ISO)

interleukin-2 signaling pathway (ISO)

mitogen activated protein kinase signaling pathway (IEA)

platelet-derived growth factor signaling pathway (ISO)

protein kinase C (PKC) signaling pathway (IMP)

syndecan signaling pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	RASA1: variable phenotype with capillary and arteriovenous malformations.	Boon LM, etal., Curr Opin Genet Dev. 2005 Jun;15(3):265-9.
2.	GTPase-activating protein interactions with the viral and cellular Src kinases.	Brott BK, etal., Proc Natl Acad Sci U S A. 1991 Feb 1;88(3):755-9.
3.	Two regions with differential growth-modulating activity in the N-terminal domain of ras GTPase-activating protein (p120GAP) src homology and Gly-Ala-Pro-rich regions.	Chang JS, etal., Eur J Biochem. 1995 Sep 15;232(3):691-9.
4.	Dysregulation of HSG triggers vascular proliferative disorders.	Chen KH, etal., Nat Cell Biol 2004 Sep;6(9):872-83. Epub 2004 Aug 22.
5.	Identification of a novel protein complex containing annexin VI, Fyn, Pyk2, and the p120(GAP) C2 domain.	Chow A, etal., FEBS Lett. 2000 Mar 3;469(1):88-92.
6.	Sequence of the cDNA encoding Ras GTPase-activating protein from rat.	Davis MM, etal., Gene 1993 Dec 8;134(2):305-6.
7.	Capillary malformation-arteriovenous malformation, a new clinical and genetic disorder caused by RASA1 mutations.	Eerola I, etal., Am J Hum Genet 2003 Dec;73(6):1240-9.
8.	Nonsense mutations in the C-terminal SH2 region of the GTPase activating protein (GAP) gene in human tumours.	Friedman E, etal., Nat Genet 1993 Nov;5(3):242-7.
9.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
10.	KEGG: Kyoto Encyclopedia of Genes and Genomes	KEGG
11.	PDGF-induced glycosaminoglycan synthesis is mediated via phosphatidylinositol 3-kinase.	Liu J, etal., Am J Physiol. 1998 May;274(5 Pt 1):L702-13.
12.	Oncogenic Mutations Rewire Signaling Pathways by Switching Protein Recruitment to Phosphotyrosine Sites.	Lundby A, etal., Cell. 2019 Oct 3;179(2):543-560.e26. doi: 10.1016/j.cell.2019.09.008.
13.	Purification of a novel ras GTPase-activating protein from rat brain.	Maekawa M, etal., J Biol Chem. 1993 Oct 25;268(30):22948-52.
14.	Insulin signal transduction in rat small intestine: role of MAP kinases in expression of mucosal hydrolases.	Marandi S, etal., Am J Physiol Gastrointest Liver Physiol. 2001 Feb;280(2):G229-40.
15.	The N-terminal region of GAP regulates cytoskeletal structure and cell adhesion.	McGlade J, etal., EMBO J. 1993 Aug;12(8):3073-81.
16.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
17.	Protein-tyrosine kinases regulate the phosphorylation, protein interactions, subcellular distribution, and activity of p21ras GTPase-activating protein.	Moran MF, etal., Mol Cell Biol. 1991 Apr;11(4):1804-12.
18.	Alterations in the subcellular distribution of p21ras-GTPase activating protein in proliferating rat acinar cells.	Nakagawa Y, etal., Biochem Biophys Res Commun. 1992 Sep 16;187(2):1172-9.
19.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
20.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
21.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
22.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
23.	Sex- and estrogen-dependent regulation of a miRNA network in the healthy and hypertrophied heart.	Queiros AM, etal., Int J Cardiol. 2013 Nov 20;169(5):331-8. doi: 10.1016/j.ijcard.2013.09.002. Epub 2013 Oct 5.
24.	Sodium butyrate inhibits platelet-derived growth factor-induced proliferation of vascular smooth muscle cells.	Ranganna K, etal., Arterioscler Thromb Vasc Biol. 1995 Dec;15(12):2273-83.
25.	GOA pipeline	RGD automated data pipeline
26.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
27.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
28.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
29.	miR-335 is involved in the rat epididymal development by targeting the mRNA of RASA1.	Wang J and Ruan K, Biochem Biophys Res Commun. 2010 Nov 12;402(2):222-7. doi: 10.1016/j.bbrc.2010.10.002. Epub 2010 Oct 8.
30.	Neuroprotective gene expression profiles in ischemic cortical cultures preconditioned with IGF-1 or bFGF.	Yoshida E, etal., Brain Res Mol Brain Res. 2004 Nov 24;131(1-2):33-50.
31.	Ras GTPase-activating protein binds to Akt and is required for its activation.	Yue Y, etal., J Biol Chem. 2004 Mar 26;279(13):12883-9. Epub 2004 Jan 5.

Additional References at PubMed

PMID:1756860	PMID:2122974	PMID:2157284	PMID:2176151	PMID:7478585	PMID:8183574	PMID:8798684	PMID:11970986	PMID:12008030	PMID:14643014	PMID:15542850	PMID:15860730
PMID:16046410	PMID:20624904	PMID:22206666	PMID:23687085	PMID:34165173

Genomics

Comparative Map Data

Rasa1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	17,593,136 - 17,676,707 (-)	NCBI		GRCr8
mRatBN7.2	2	15,857,704 - 15,940,757 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	15,857,980 - 15,940,854 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	22,959,727 - 23,040,229 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	21,059,980 - 21,140,482 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	15,733,780 - 15,814,284 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	13,617,021 - 13,696,531 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	13,616,822 - 13,696,426 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	13,470,580 - 13,551,782 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	14,203,815 - 14,287,824 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	14,124,183 - 14,208,193 (-)	NCBI
Celera	2	12,124,725 - 12,204,755 (-)	NCBI		Celera
Cytogenetic Map	2	q11	NCBI

RASA1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	87,267,883 - 87,391,916 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	5	87,267,883 - 87,391,931 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	5	86,563,700 - 86,687,733 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	5	86,599,907 - 86,723,489 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	5	86,600,521 - 86,723,488	NCBI
Celera	5	82,456,373 - 82,579,983 (+)	NCBI		Celera
Cytogenetic Map	5	q14.3	NCBI
HuRef	5	81,768,403 - 81,891,908 (+)	NCBI		HuRef
CHM1_1	5	85,997,132 - 86,120,771 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	5	87,749,006 - 87,873,021 (+)	NCBI		T2T-CHM13v2.0

Rasa1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	13	85,362,893 - 85,437,487 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	13	85,362,899 - 85,437,249 (-)	Ensembl		GRCm39 Ensembl
GRCm38	13	85,214,699 - 85,289,486 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	13	85,214,780 - 85,289,130 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	13	85,354,304 - 85,429,091 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	13	85,689,136 - 85,729,574 (-)	NCBI		MGSCv36	mm8
Celera	13	87,446,946 - 87,523,497 (-)	NCBI		Celera
Cytogenetic Map	13	C3	NCBI
cM Map	13	45.05	NCBI

Rasa1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955418	23,807,740 - 23,897,707 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955418	23,807,740 - 23,897,699 (-)	NCBI	ChiLan1.0	ChiLan1.0

RASA1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	4	28,003,513 - 28,131,187 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	5	26,157,126 - 26,284,812 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	5	27,980,907 - 28,104,368 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	5	28,115,159 - 28,239,854 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	5	28,115,159 - 28,240,321 (-)	Ensembl	panpan1.1		panPan2

RASA1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	3	21,068,182 - 21,177,288 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	3	21,054,930 - 21,176,757 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	3	22,433,878 - 22,542,367 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	3	20,976,854 - 21,085,576 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	3	20,963,599 - 21,086,379 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	3	20,947,976 - 21,056,165 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	3	20,910,527 - 21,018,703 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	3	21,202,248 - 21,310,549 (-)	NCBI		UU_Cfam_GSD_1.0

Rasa1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	176,687,034 - 176,786,016 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936469	5,839,743 - 5,932,021 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936469	5,839,560 - 5,933,049 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RASA1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	94,878,911 - 94,993,450 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	94,879,615 - 94,992,725 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	97,399,815 - 97,512,972 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

RASA1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	4	81,249,851 - 81,371,486 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	4	81,249,805 - 81,370,453 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666049	30,268,183 - 30,393,793 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Rasa1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624743	6,788,108 - 6,882,223 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624743	6,750,476 - 6,882,556 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Rasa1
618 total Variants

miRNA Target Status (No longer updated)

Confirmed Target Of

miRNA Gene	Mature miRNA	Method Name	Result Type	Data Type	Support Type	PMID
Mir212	rno-miR-212-3p	Mirtarbase	external_info	Immunoblot//Luciferase reporter assay//qRT-PCR	Functional MTI	22431733
Mir132	rno-miR-132-3p	Mirtarbase	external_info	Immunoblot//Luciferase reporter assay//qRT-PCR	Functional MTI	22431733

Predicted Target Of

	Summary Value
Count of predictions:	22
Count of miRNA genes:	20
Interacting mature miRNAs:	22
Transcripts:	ENSRNOT00000046251
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578664	Bmd9	Bone mineral QTL density 9	5		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	2	11852062	49003364	Rat
738010	Lnnr3	Liver neoplastic nodule remodeling QTL 3	2.94		liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number (CMO:0001461)	2	1	41244106	Rat
10755430	Coatc6	Coat color QTL 6		0.02576	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	2	11591100	56591100	Rat
1600379	Mcs18	Mammary carcinoma susceptibility QTL 18	2.6		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	2	7887772	42804738	Rat
738012	Anxrr3	Anxiety related response QTL 3	3.8		exploratory behavior trait (VT:0010471)	percentage of entries into a discrete space in an experimental apparatus (CMO:0000961)	2	9023519	54023519	Rat
61368	Mcs1	Mammary carcinoma susceptibility QTL 1	4.4		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	2	7887772	23319447	Rat
631682	Bp115	Blood pressure QTL 115	4.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	1	37410502	Rat
61355	Bp36	Blood pressure QTL 36	2.9		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	2	5873687	102844969	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_013135	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039101802	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473955	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ227936	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	L13151	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000046251 ⟹ ENSRNOP00000047300

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	15,857,980 - 15,940,854 (-)	Ensembl
Rnor_6.0 Ensembl	2	13,616,822 - 13,696,426 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000095572 ⟹ ENSRNOP00000088606

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	15,857,980 - 15,940,854 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000101798 ⟹ ENSRNOP00000092393

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	15,857,980 - 15,940,854 (-)	Ensembl

RefSeq Acc Id:

NM_013135 ⟹ NP_037267

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	17,593,136 - 17,676,161 (-)	NCBI
mRatBN7.2	2	15,857,706 - 15,940,738 (-)	NCBI
Rnor_6.0	2	13,617,021 - 13,696,531 (-)	NCBI
Rnor_5.0	2	13,470,580 - 13,551,782 (-)	NCBI
RGSC_v3.4	2	14,203,815 - 14,287,824 (-)	RGD
Celera	2	12,124,725 - 12,204,755 (-)	RGD

Sequence:

show sequence

ATGATGGCGGCCGAGGCGGGCAGTGAGGAAGGCGGCCCGGCGACCGCGGGGACCGGCGGCGCCG
CGGCCACGGGCTCCAGCGCCTACCCAGCAGCGTGCCGGGTAAAGTTACCCGCGGCCCCTCCGAT
GGCAGTCGCCCCGTGTCCTGGGCTGGCGGACACCGACCTGGCTGCGGCCCTCGGTGGGGGAGCC
GCGTCGGGGTCCGGGTTCCTGGGGACCGGGCCGGTGTCTGGTGTCCTGGGGGGCGCCGCGCTGA
CCGGCGGTGCTGCAGCTGGCGTGGCGGGTGCTGCAGCCGCTGGACCTGCCGGAGACATCGCTCT
CACCAAGGGGACTCTCTCTCTGCCTGCTGAGACTCTCGGGCCGGGCGGCGGATTCCCTCCTCTG
CCGCCTCCTCCTCTGTTGCCTCCTTTGGGCTCCGGTCTGGGGACAGTGGATGAAGGTGACTCCT
TGGATGGACCAGAATACGAGGAGGAAGAGGTGGCCATACCGCTGACCGCACCTCCAACTAACCA
GTGGTATCATGGAAAACTTGATAGAACTATAGCAGAAGAACGCCTCAGGCAGGCAGGGAAATCT
GGAAGCTACCTTATAAGAGAGAGTGATCGGAGGCCAGGGTCCTTTGTACTTTCATTTCTTAGCC
AGACAAATGTTGTCAATCATTTTAGGATTATTGCTATGTGTGGTGATTACTACATTGGTGGAAG
GCGTTTTTCTTCACTCTCAGACCTAATAGGATATTACAGTCACGTTTCTTGTTTACTTAAAGGA
GAAAAATTACTCTACCCAGTTGCACCACCAGAGCCAGTAGAAGATAGAAGACGTGTACGAGCCA
TTCTGCCCTACACAAAAGTACCAGACACTGATGAAATAAGTTTCTTAAAGGGAGATATGTTCAT
TGTTCACAATGAGTTAGAAGATGGATGGATGTGGGTTACAAACCTAAGAACAGATGAGCAAGGC
CTTATTGTTGAGGACCTAGTGGAAGAGGTGGGCCGAGAAGAAGATCCACATGAAGGCAAAATAT
GGTTCCATGGGAAGATTTCCAAACAAGAAGCTTATAATTTATTAATGACAGTTGGCCAAGTCTG
CAGCTTTCTTGTGAGGCCCTCAGATAATACTCCTGGAGATTATTCCCTGTATTTTCGGACCAAT
GAAAATATCCAGCGATTTAAAATTTGTCCAACACCTAACAATCAGTTCATGATGGGAGGCCGCT
ATTATAACAGTATTGGGGACATCATAGACCACTATCGGAAAGAACAGATTGTTGAAGGCTATTA
TCTTAAGGAACCTGTACCAATGCAGGATCAAGGACAAGTACTCAATGACACTGTGGATGGGAAG
GAAATCTATAATACAATTCGTCGTAAAACAAAGGATGCATTTTATAAAAATATTGTTAAAAAAG
GTTATCTTCTGAAGAAGGGCAAAGGAAAACGTTGGAAAAATTTATATTTTATCTTAGAGGGCAG
TGATGCCCAACTTATTTATTTTGAAAGTGAAAAACGAGCTACAAAACCAAAAGGGCTAATAGAT
CTCAGTGTATGTTCTGTCTACGTTGTCCATGATAGTCTCTTCGGCAGGCCAAACTGTTTTCAGA
TAGTCGTTCAGCACTTTAGTGAAGAACATTACATCTTTTACTTTGCAGGAGAAACTCCAGAACA
AGCAGAGGATTGGATGAAAGGCCTGCAAGCATTTTGCAGTTTACGGAAAAGTAGCCCAGGGACA
TCTAATAAACGCCTTCGTCAGGTCAGCAGCCTTGTATTACATATTGAAGAAGCTCATAAACTAC
CAGTAAAACACTTCACTAATCCATATTGTAACATCTACTTGAATAGTGTCCAAGTAGCAAAAAC
TCATGCAAGGGAGGGGCAAAACCCAGTATGGTCAGAGGAGTTTGTCTTTGATGATCTTCCTCCT
GACATCAATAGATTTGAAATCACACTTAGTAATAAAACAAAGAAAAGTAAAGATCCAGATATCT
TATTTATGCGTTGCCAGTTGAGCAGGTTACAGAAAGGACATGCCACAGATGAATGGTTTCTGCT
AAGTTCTCATATACCACTAAAAGGTATTGAACCAGGATCTCTGCGTGTTCGAGCACGATACTCT
ATGGAAAAAATCATGCCAGAAGAAGAGTACAGTGAATTTAAAGAGCTTATACTGCAGAAGGAAC
TTCACGTAGTCTATGCTCTATCACACGTATGTGGACAAGACCGAACACTACTGGCCAGCATCCT
ACTGAAAATATTTCTTCATGAAAAGCTTGAGTCATTGTTGTTATGCACACTAAATGACAGAGAG
ATAAGTATGGAAGATGAAGCCACTACCCTATTTCGAGCTACAACACTTGCGAGTACCTTGATGG
AGCAGTACATGAAAGCCACGGCCACGCAGTTTGTTCATCATGCTTTGAAAGACTCCATTTTAAA
GATAATGGAAAGCAAGCAATCATGTGAGTTAAGTCCATCAAAGTTAGAAAAAAATGAAGATGTG
AACACTAATTTAGCACACCTATTGAGCATACTTTCAGAGCTTGTGGAGAAAATATTCATGGCTT
CAGAAATACTTCCACCGACACTGAGATATATTTATGGGTGTTTACAGAAATCAGTTCAGCATAA
GTGGCCTACAAATAACACCATGAGAACACGAGTTGTTAGTGGTTTTGTTTTTCTTCGGCTTATC
TGCCCAGCTATCCTGAATCCACGGATGTTTAATATCATCTCAGATTCTCCATCTCCTATTGCTG
CAAGAACACTGACATTAGTGGCTAAATCTGTGCAGAATTTAGCAAATCTTGTGGAATTTGGAGC
TAAGGAGCCTTATATGGAAGGTGTCAATCCATTCATCAAAAGTAATAAACATCGCATGATCATG
TTTTTAGATGAACTTGGGAATGTACCTGAGCTTCCGGACACTACAGAACATTCTAGAACTGACC
TGTCTCGTGACTTAGCAGCATTGCATGAGATTTGTGTAGCTCATTCAGATGAACTGAGAACACT
CAGTAATGAGCGTGGTGTACAGCAGCATGTACTGAAAAAGCTTCTGGCAATAACAGAACTGCTT
CAACAAAAGCAAAACCAGTATACAAAAACCAATGATGTCAGGTAG

hide sequence

RefSeq Acc Id:

XM_039101802 ⟹ XP_038957730

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	17,593,136 - 17,676,707 (-)	NCBI
mRatBN7.2	2	15,857,704 - 15,940,757 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_037267	(Get FASTA)	NCBI Sequence Viewer
	XP_038957730	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA16319	(Get FASTA)	NCBI Sequence Viewer
	EDM09977	(Get FASTA)	NCBI Sequence Viewer
	EDM09978	(Get FASTA)	NCBI Sequence Viewer
	EDM09979	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000047300
	ENSRNOP00000106544
GenBank Protein	P50904	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_037267 ⟸ NM_013135

- UniProtKB:

P50904 (UniProtKB/Swiss-Prot), A6I4L9 (UniProtKB/TrEMBL), G3V9H0 (UniProtKB/TrEMBL), A6I4M1 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MMAAEAGSEEGGPATAGTGGAAATGSSAYPAACRVKLPAAPPMAVAPCPGLADTDLAAALGGGA
ASGSGFLGTGPVSGVLGGAALTGGAAAGVAGAAAAGPAGDIALTKGTLSLPAETLGPGGGFPPL
PPPPLLPPLGSGLGTVDEGDSLDGPEYEEEEVAIPLTAPPTNQWYHGKLDRTIAEERLRQAGKS
GSYLIRESDRRPGSFVLSFLSQTNVVNHFRIIAMCGDYYIGGRRFSSLSDLIGYYSHVSCLLKG
EKLLYPVAPPEPVEDRRRVRAILPYTKVPDTDEISFLKGDMFIVHNELEDGWMWVTNLRTDEQG
LIVEDLVEEVGREEDPHEGKIWFHGKISKQEAYNLLMTVGQVCSFLVRPSDNTPGDYSLYFRTN
ENIQRFKICPTPNNQFMMGGRYYNSIGDIIDHYRKEQIVEGYYLKEPVPMQDQGQVLNDTVDGK
EIYNTIRRKTKDAFYKNIVKKGYLLKKGKGKRWKNLYFILEGSDAQLIYFESEKRATKPKGLID
LSVCSVYVVHDSLFGRPNCFQIVVQHFSEEHYIFYFAGETPEQAEDWMKGLQAFCSLRKSSPGT
SNKRLRQVSSLVLHIEEAHKLPVKHFTNPYCNIYLNSVQVAKTHAREGQNPVWSEEFVFDDLPP
DINRFEITLSNKTKKSKDPDILFMRCQLSRLQKGHATDEWFLLSSHIPLKGIEPGSLRVRARYS
MEKIMPEEEYSEFKELILQKELHVVYALSHVCGQDRTLLASILLKIFLHEKLESLLLCTLNDRE
ISMEDEATTLFRATTLASTLMEQYMKATATQFVHHALKDSILKIMESKQSCELSPSKLEKNEDV
NTNLAHLLSILSELVEKIFMASEILPPTLRYIYGCLQKSVQHKWPTNNTMRTRVVSGFVFLRLI
CPAILNPRMFNIISDSPSPIAARTLTLVAKSVQNLANLVEFGAKEPYMEGVNPFIKSNKHRMIM
FLDELGNVPELPDTTEHSRTDLSRDLAALHEICVAHSDELRTLSNERGVQQHVLKKLLAITELL
QQKQNQYTKTNDVR

hide sequence

Ensembl Acc Id:

ENSRNOP00000047300 ⟸ ENSRNOT00000046251

RefSeq Acc Id:	XP_038957730 ⟸ XM_039101802
- Peptide Label:	isoform X1
- UniProtKB:	A6I4L9 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000088606 ⟸ ENSRNOT00000095572

Ensembl Acc Id:

ENSRNOP00000092393 ⟸ ENSRNOT00000101798

Protein Domains

C2 PH Ras-GAP SH2 SH3

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P50904-F1-model_v2	AlphaFold	P50904	1-1038	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:3537	AgrOrtholog
BioCyc Gene	G2FUF-54930	BioCyc
Ensembl Genes	ENSRNOG00000029185	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000046251	ENTREZGENE
	ENSRNOT00000134396	ENTREZGENE
Gene3D-CATH	2.30.29.30	UniProtKB/Swiss-Prot
	2.60.40.150	UniProtKB/Swiss-Prot
	3.30.505.10	UniProtKB/Swiss-Prot
	GTPase Activation - p120gap, domain 1	UniProtKB/Swiss-Prot
	SH3 Domains	UniProtKB/Swiss-Prot
InterPro	C2_dom	UniProtKB/Swiss-Prot
	C2_domain_sf	UniProtKB/Swiss-Prot
	PH-like_dom_sf	UniProtKB/Swiss-Prot
	PH_domain	UniProtKB/Swiss-Prot
	Ras_GTPase	UniProtKB/Swiss-Prot
	RasGAP_C_SH2	UniProtKB/Swiss-Prot
	RasGAP_CS	UniProtKB/Swiss-Prot
	RasGAP_dom	UniProtKB/Swiss-Prot
	RasGAP_N_SH2	UniProtKB/Swiss-Prot
	RasGAP_SH3	UniProtKB/Swiss-Prot
	Rho_GTPase_activation_prot	UniProtKB/Swiss-Prot
	SH2	UniProtKB/Swiss-Prot
	SH2_dom_sf	UniProtKB/Swiss-Prot
	SH3-like_dom_sf	UniProtKB/Swiss-Prot
	SH3_domain	UniProtKB/Swiss-Prot
KEGG Report	rno:25676	UniProtKB/Swiss-Prot
NCBI Gene	25676	ENTREZGENE
PANTHER	PTHR10194	UniProtKB/Swiss-Prot
	RAS GTPASE-ACTIVATING PROTEIN 1	UniProtKB/Swiss-Prot
Pfam	PF00168	UniProtKB/Swiss-Prot
	PF00169	UniProtKB/Swiss-Prot
	RasGAP	UniProtKB/Swiss-Prot
	SH2	UniProtKB/Swiss-Prot
	SH3_1	UniProtKB/Swiss-Prot
PhenoGen	Rasa1	PhenoGen
PRINTS	SH2DOMAIN	UniProtKB/Swiss-Prot
PROSITE	PH_DOMAIN	UniProtKB/Swiss-Prot
	PS50004	UniProtKB/Swiss-Prot
	RAS_GTPASE_ACTIV_1	UniProtKB/Swiss-Prot
	RAS_GTPASE_ACTIV_2	UniProtKB/Swiss-Prot
	SH2	UniProtKB/Swiss-Prot
	SH3	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000029185	RatGTEx
SMART	RasGAP	UniProtKB/Swiss-Prot
	SH2	UniProtKB/Swiss-Prot
	SH3	UniProtKB/Swiss-Prot
	SM00233	UniProtKB/Swiss-Prot
	SM00239	UniProtKB/Swiss-Prot
Superfamily-SCOP	PH domain-like	UniProtKB/Swiss-Prot
	SSF48350	UniProtKB/Swiss-Prot
	SSF49562	UniProtKB/Swiss-Prot
	SSF50044	UniProtKB/Swiss-Prot
	SSF55550	UniProtKB/Swiss-Prot
TIGR	TC220708
UniProt	A0A8I6A6I6_RAT	UniProtKB/TrEMBL
	A0A8I6AHF7_RAT	UniProtKB/TrEMBL
	A6I4L9	ENTREZGENE, UniProtKB/TrEMBL
	A6I4M0_RAT	UniProtKB/TrEMBL
	A6I4M1	ENTREZGENE, UniProtKB/TrEMBL
	G3V9H0	ENTREZGENE, UniProtKB/TrEMBL
	P50904	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-02-03	Rasa1	RAS p21 protein activator 1	Rasa1	RAS p21 protein activator (GTPase activating protein) 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-24	Rasa1	RAS p21 protein activator (GTPase activating protein) 1	Rasa1	RAS p21 protein activator 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2000-11-11	Rasa	RAS p21 protein activator			Symbol withdrawn	61033	WITHDRAWN
2000-11-11	Rasa1	RAS p21 protein activator 1			Symbol updated	61033	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)