Pthlh (parathyroid hormone-like hormone)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Pthlh (parathyroid hormone-like hormone) Rattus norvegicus

Analyze

Symbol:

Pthlh

Name:

parathyroid hormone-like hormone

RGD ID:

3441

Description:

Enables hormone activity. Involved in adenylate cyclase-activating G protein-coupled receptor signaling pathway. Predicted to be located in Golgi apparatus; cytosol; and nucleoplasm. Human ortholog(s) of this gene implicated in brachydactyly type E2. Orthologous to human PTHLH (parathyroid hormone like hormone); PARTICIPATES IN Hedgehog signaling pathway; INTERACTS WITH 1-Oleoyl-2-acetyl-sn-glycerol; 6-propyl-2-thiouracil; acrylamide.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

parathyroid hormone-like peptide; parathyroid hormone-like protein; parathyroid hormone-related protein; parathyroid-like peptide; PLP; PTH-rP; PTHrP

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	4	180,188,792 - 180,199,847 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	180,188,792 - 180,199,847 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	186,472,387 - 186,483,481 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	4	182,256,935 - 182,268,028 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	4	180,877,368 - 180,888,461 (-)	NCBI	Rnor_WKY
Rnor_6.0	4	181,663,425 - 181,674,181 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_5.0	4	245,811,895 - 245,822,651 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	184,887,702 - 184,898,841 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	185,132,825 - 185,143,965 (-)	NCBI
Celera	4	168,675,915 - 168,686,473 (-)	NCBI		Celera
RH 3.4 Map	4	1091.1	RGD
Cytogenetic Map	4	q44	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

achondroplasia (ISS)

acute necrotizing pancreatitis (ISO)

Albright's hereditary osteodystrophy (ISS)

alcoholic pancreatitis (ISO)

bone resorption disease (ISO)

brachydactyly type E2 (ISO)

Breast Neoplasms (ISO)

Cachexia (ISO)

Chronic Pancreatitis (ISO)

Congenital Foot Deformities (ISO)

Congenital Hand Deformities (ISO)

Edema (ISO)

genetic disease (ISO)

Growth Disorders (ISO)

Hyperalgesia (ISO)

hypercalcemia (ISO)

lung disease (ISO)

lung non-small cell carcinoma (ISO)

multiple myeloma (ISO)

neuroendocrine tumor (ISO)

Osteolysis (ISO)

pancreatic cancer (ISO)

Prostatic Neoplasms (ISO)

Spontaneous Abortions (ISO)

Superior Vena Cava Syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(E)-thiamethoxam (ISO)

1,2-dimethylhydrazine (ISO)

1-nitropyrene (ISO)

1-Oleoyl-2-acetyl-sn-glycerol (EXP)

17beta-estradiol (ISO)

17beta-hydroxy-17-methylestra-4,9,11-trien-3-one (ISO)

17beta-hydroxy-5alpha-androstan-3-one (ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

2,6-di-tert-butyl-4-methylphenol (ISO)

2-hydroxypropanoic acid (ISO)

3',5'-cyclic AMP (ISO)

3,3',4,4',5-pentachlorobiphenyl (ISO)

3,3',5,5'-tetrabromobisphenol A (ISO)

4,4'-diaminodiphenylmethane (ISO)

4-nitroquinoline N-oxide (ISO)

5-azacytidine (ISO)

6-propyl-2-thiouracil (EXP)

8-Br-cAMP (ISO)

9-cis-retinoic acid (ISO)

acrolein (ISO)

acrylamide (EXP)

afimoxifene (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (EXP,ISO)

alpha-pinene (ISO)

antirheumatic drug (ISO)

arsane (EXP,ISO)

arsenic atom (EXP,ISO)

arsenite(3-) (ISO)

benzene (ISO)

benzo[a]pyrene (ISO)

betulinic acid (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP)

bortezomib (ISO)

butan-1-ol (ISO)

butane-2,3-dione (ISO)

cadmium atom (EXP)

cadmium dichloride (EXP)

calcitriol (ISO)

calcium carbonate (ISO)

candesartan (EXP)

ceruletide (EXP,ISO)

CGP 52608 (ISO)

chloroethene (ISO)

chloropicrin (ISO)

chloroprene (ISO)

cisplatin (ISO)

cobalt atom (ISO)

copper atom (ISO)

copper(0) (ISO)

crocidolite asbestos (ISO)

curcumin (ISO)

cyclosporin A (ISO)

dexamethasone (ISO)

dextran sulfate (ISO)

enalapril (EXP)

ethanol (EXP,ISO)

folic acid (EXP,ISO)

formaldehyde (EXP)

geldanamycin (ISO)

gentamycin (EXP)

iron atom (ISO)

iron(0) (ISO)

L-ascorbic acid (EXP)

lead diacetate (EXP)

lead(0) (EXP)

lead(2+) (EXP)

leflunomide (ISO)

losartan (EXP)

manganese(II) chloride (EXP)

mercury dichloride (EXP)

methotrexate (ISO)

methylisothiazolinone (ISO)

methylmercury chloride (ISO)

N-Nitrosopyrrolidine (ISO)

nitrofen (EXP)

O-methyleugenol (ISO)

ozone (ISO)

paracetamol (ISO)

pentane-2,3-dione (ISO)

phenylephrine (EXP)

phorbol 13-acetate 12-myristate (EXP)

potassium chromate (ISO)

progesterone (EXP,ISO)

quercetin (ISO)

quinapril hydrochloride (EXP)

rac-lactic acid (ISO)

resveratrol (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenite (EXP)

Soman (EXP)

styrene (ISO)

tamoxifen (ISO)

telmisartan (EXP)

temozolomide (ISO)

testosterone (ISO)

thiamethoxam (ISO)

titanium dioxide (EXP,ISO)

trichostatin A (ISO)

undecane (EXP)

valproic acid (ISO)

vinclozolin (EXP)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adenylate cyclase-activating G protein-coupled receptor signaling pathway (IBA,IDA,ISO)

bone mineralization (IEA,ISO)

chondrocyte differentiation (ISO)

endochondral ossification (ISO)

endoderm development (ISO)

lung alveolus development (ISO)

lung epithelial cell differentiation (ISO)

mammary gland bud elongation (ISO)

negative regulation of chondrocyte development (ISO)

negative regulation of chondrocyte differentiation (ISO)

negative regulation of DNA-binding transcription factor activity (ISO)

nipple sheath formation (ISO)

osteoblast development (IBA,ISO,TAS)

positive regulation of cell population proliferation (ISO)

protein processing (ISO)

regulation of chondrocyte differentiation (IBA)

regulation of gene expression (ISO)

signal transduction (IEA)

skeletal system development (ISO)

surfactant homeostasis (ISO)

Cellular Component

cellular_component (ND)

cytoplasm (IEA)

cytosol (ISO)

extracellular region (IEA)

Golgi apparatus (ISO)

nucleoplasm (ISO)

nucleus (IEA,ISO)

Molecular Function

hormone activity (IBA,IDA,IEA)

peptide hormone receptor binding (IBA,IEA,ISO,ISS)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

Hedgehog signaling pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	TGFbeta2 mediates the effects of hedgehog on hypertrophic differentiation and PTHrP expression.	Alvarez J, etal., Development. 2002 Apr;129(8):1913-24.
2.	Parathyroid hormone-related protein induction in focal stroke: a neuroprotective vascular peptide.	Funk JL, etal., Am J Physiol Regul Integr Comp Physiol 2003 Apr;284(4):R1021-30.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
5.	Gene-encoding parathyroid hormone-like peptide: nucleotide sequence of the rat gene and comparison with the human homologue.	Karaplis AC, etal., Mol Endocrinol 1990 Mar;4(3):441-6.
6.	High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.	Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
7.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
8.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
9.	Expression of parathyroid hormone-related peptide and insulin-like growth factor I during rat fracture healing.	Okazaki K, etal., J Orthop Res. 2003 May;21(3):511-20.
10.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
11.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
12.	GOA pipeline	RGD automated data pipeline
13.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
14.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
15.	Comprehensive gene review and curation	RGD comprehensive gene curation
16.	Gene-based anchoring of the rat genetic linkage and cytogenetic maps: new regional localizations, orientation of the linkage groups, and insights into mammalian chromosome evolution.	Szpirer C, etal., Mamm Genome 1998 Sep;9(9):721-34
17.	Calcium-sensing receptor stimulates PTHrP release by pathways dependent on PKC, p38 MAPK, JNK, and ERK1/2 in H-500 cells.	Tfelt-Hansen J, etal., Am J Physiol Endocrinol Metab 2003 Aug;285(2):E329-37. Epub 2003 Apr 15.
18.	Expression of a calcium-mobilizing parathyroid hormone-like peptide in lactating mammary tissue.	Thiede MA and Rodan GA, Science 1988 Oct 14;242(4876):278-80.
19.	Rat parathyroid hormone-like peptide: comparison with the human homologue and expression in malignant and normal tissue.	Yasuda T, etal., Mol Endocrinol 1989 Mar;3(3):518-25.

Additional References at PubMed

PMID:90087	PMID:8314082	PMID:8895385	PMID:9008714	PMID:9477327	PMID:9832460	PMID:9921650	PMID:11606467	PMID:12647298	PMID:15162506	PMID:15579504	PMID:16007342
PMID:16672315	PMID:16940239	PMID:17200368	PMID:17328886	PMID:17435078	PMID:18048500	PMID:18401831	PMID:19574446	PMID:19674967	PMID:19910689	PMID:21073445	PMID:22093939
PMID:22508055	PMID:23038778	PMID:23546599	PMID:24253735	PMID:25159845	PMID:25278090	PMID:25645361	PMID:26538570	PMID:26859332	PMID:30504697	PMID:31311343	PMID:31471966

Genomics

Comparative Map Data

Pthlh
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	4	180,188,792 - 180,199,847 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	180,188,792 - 180,199,847 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	186,472,387 - 186,483,481 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	4	182,256,935 - 182,268,028 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	4	180,877,368 - 180,888,461 (-)	NCBI	Rnor_WKY
Rnor_6.0	4	181,663,425 - 181,674,181 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_5.0	4	245,811,895 - 245,822,651 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	184,887,702 - 184,898,841 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	185,132,825 - 185,143,965 (-)	NCBI
Celera	4	168,675,915 - 168,686,473 (-)	NCBI		Celera
RH 3.4 Map	4	1091.1	RGD
Cytogenetic Map	4	q44	NCBI

PTHLH
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	12	27,958,084 - 27,972,733 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	12	27,958,084 - 27,972,733 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	12	28,111,017 - 28,125,666 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	28,002,284 - 28,016,183 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	12	28,002,283 - 28,014,161	NCBI
Celera	12	33,256,594 - 33,270,557 (-)	NCBI		Celera
Cytogenetic Map	12	p11.22	NCBI
HuRef	12	27,880,337 - 27,894,279 (-)	NCBI		HuRef
CHM1_1	12	28,076,045 - 28,089,944 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	12	27,829,831 - 27,844,463 (-)	NCBI		T2T-CHM13v2.0

Pthlh
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	147,153,607 - 147,165,511 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	147,153,599 - 147,165,681 (-)	Ensembl		GRCm39 Ensembl
GRCm38	6	147,252,109 - 147,264,013 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	147,252,101 - 147,264,183 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	6	147,200,632 - 147,212,607 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	6	147,209,270 - 147,221,371 (-)	NCBI		MGSCv36	mm8
Celera	6	150,289,180 - 150,301,102 (-)	NCBI		Celera
Cytogenetic Map	6	G3	NCBI
cM Map	6	78.19	NCBI

Pthlh
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955505	6,834,533 - 6,847,335 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955505	6,834,533 - 6,846,909 (+)	NCBI	ChiLan1.0	ChiLan1.0

PTHLH
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	12	60,959,327 - 60,973,749 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	12	60,960,071 - 60,973,750 (+)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	12	58,341,361 - 58,355,804 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

PTHLH
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	27	19,781,557 - 19,795,078 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	27	19,781,557 - 19,795,078 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	27	26,604,753 - 26,729,826 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	27	19,869,742 - 19,989,315 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	27	19,975,781 - 19,989,312 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	27	19,676,917 - 19,795,837 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	27	19,703,486 - 19,822,427 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	27	26,761,823 - 26,881,419 (-)	NCBI		UU_Cfam_GSD_1.0

Pthlh
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	81,724,063 - 81,735,818 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936760	197,525 - 209,518 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936760	197,525 - 209,212 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PTHLH
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	5	45,751,292 - 45,763,415 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	5	45,750,968 - 45,763,421 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	5	49,159,951 - 49,172,393 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PTHLH
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	11	27,682,300 - 27,694,808 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	11	27,682,338 - 27,694,898 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666069	7,351,760 - 7,364,353 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Pthlh
(Heterocephalus glaber - naked mole-rat)

Naked Mole-rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624778	8,008,056 - 8,019,612 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624778	8,007,358 - 8,019,538 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Pthlh
43 total Variants

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	11320076	180699135	Rat
2303623	Vencon2	Ventilatory control QTL 2	3.8		respiration trait (VT:0001943)	minute ventilation (CMO:0000132)	4	135204660	180204660	Rat
1578674	Bmd12	Bone mineral density QTL 12	3.8		femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	4	135699135	180699135	Rat
2293659	Bmd35	Bone mineral density QTL 35	4.5	0.0001	femur strength trait (VT:0010010)	femoral neck ultimate force (CMO:0001703)	4	137755016	181392681	Rat
6478718	Anxrr34	Anxiety related response QTL 34		0.00896	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	144639524	182687754	Rat
6478748	Anxrr42	Anxiety related response QTL 42		0.28008	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	144639524	182687754	Rat
6478754	Anxrr43	Anxiety related response QTL 43		0.14035	locomotor behavior trait (VT:0001392)	distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493)	4	144639524	182687754	Rat
6478693	Anxrr32	Anxiety related response QTL 32		0.00092	locomotor behavior trait (VT:0001392)	measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957)	4	144639524	182687754	Rat
6478700	Anxrr33	Anxiety related response QTL 33		0.00896	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	144639524	182687754	Rat
10401796	Kidm48	Kidney mass QTL 48			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	4	145568712	182687754	Rat
10053718	Scort25	Serum corticosterone level QTL 25	2.15	0.0097	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	155561574	182687754	Rat
1300109	Rf13	Renal function QTL 13	3.91		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	4	157710145	182687754	Rat

Markers in Region

D4Wox11

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	180,200,975 - 180,201,064 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	181,675,452 - 181,675,540	NCBI	Rnor6.0
Rnor_5.0	4	245,823,922 - 245,824,010	UniSTS	Rnor5.0
RGSC_v3.4	4	184,899,968 - 184,900,058	RGD	RGSC3.4
RGSC_v3.4	4	184,899,969 - 184,900,057	UniSTS	RGSC3.4
RGSC_v3.1	4	185,145,092 - 185,145,182	RGD
RH 3.4 Map	4	1091.9	UniSTS
RH 3.4 Map	4	1091.9	RGD
RH 2.0 Map	4	1106.7	RGD
Cytogenetic Map	4	q44	UniSTS

RH94501

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	180,188,895 - 180,189,095 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	181,663,529 - 181,663,728	NCBI	Rnor6.0
Rnor_5.0	4	245,811,999 - 245,812,198	UniSTS	Rnor5.0
RGSC_v3.4	4	184,887,806 - 184,888,005	UniSTS	RGSC3.4
Celera	4	168,676,019 - 168,676,218	UniSTS
RH 3.4 Map	4	1091.1	UniSTS
Cytogenetic Map	4	q44	UniSTS

RH130039

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	180,188,864 - 180,189,084 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	181,663,498 - 181,663,717	NCBI	Rnor6.0
Rnor_5.0	4	245,811,968 - 245,812,187	UniSTS	Rnor5.0
RGSC_v3.4	4	184,887,775 - 184,887,994	UniSTS	RGSC3.4
Celera	4	168,675,988 - 168,676,207	UniSTS
Cytogenetic Map	4	q44	UniSTS

Expression

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_012636	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AH002230	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473964	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000151	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M21967	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M31603	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000112037 ⟹ ENSRNOP00000078983

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	180,188,792 - 180,199,847 (-)	Ensembl

RefSeq Acc Id:

NM_012636 ⟹ NP_036768

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	4	180,188,792 - 180,199,847 (-)	NCBI
Rnor_6.0	4	181,663,425 - 181,674,181 (-)	NCBI
Rnor_5.0	4	245,811,895 - 245,822,651 (-)	NCBI
RGSC_v3.4	4	184,887,702 - 184,898,841 (-)	RGD
Celera	4	168,675,915 - 168,686,473 (-)	RGD

Sequence:

show sequence

CCTGTGCGGTTTGAGAGAGGCACAGTTGGAGGCGCTGATTCCTACAAAAGTCCCCAGAGCCAGC
GAGCGGCACGATGCTGCGGAGGCTGGTTCAGCAGTGGAGCGTCCTGGTGTTCCTGCTCAGCTAC
TCCGTGCCCTCCCGCGGGCGCTCGGTGGAGGGGCTTGGTCGCAGGCTAAAACGCGCGGTGTCTG
AGCACCAGCTACTGCATGACAAGGGCAAGTCCATCCAAGACTTGCGCCGCCGTTTCTTCCTCCA
CCATCTGATTGCGGAGATCCACACAGCTGAAATCAGAGCTACCTCGGAGGTGTCCCCTAACTCC
AAACCTGCTCCCAACACCAAAAACCACCCTGTGCGGTTTGGGTCAGACGACGAGGGCAGATACC
TAACTCAGGAAACCAACAAGGTGGAGACGTACAAAGAGCAGCCACTCAAGACGCCCGGGAAGAA
GAAGAAAGGCAAGCCGGGGAAACGCAGAGAACAGGAGAAAAAAAAGCGAAGGACTCGGTCTGCC
TGGCCAGGCACAACTGGGAGTGGCCTGCTTGAGGACCCCCAGCCCCACACCTCCCCGACCTCGA
CCTCCCTGGAGCCCAGCTCAAGGACGCATTGAAACTTTCACCGAAGATCTTCCAAGGACACGTT
ACAGGATTCTGTAATAGTAAACATATGGAAAGTATTAGACATATTTATTGCCTGTACATACTGT
AAATGCATTGGGATCAAACTGTCTCCCCAGGAAACTGCACATGGGTCATGTGAATATTTTTCCT
TCTTTTTTTTTTTTTGCCAAGGCTAATCCAATTATTACTGTCACTGTTACCATAATTTATTTTG
TCAACTGATGTATTTATTTGTAAATGTATCTTGGTGCTGCTGACTCTGTTTTTTTGTAACATAA
TGCACTTTAGGTATACATATCAAGTATGTCGATGAATTTAACACGAAAAAGTGTCTCTATTTTG
TGGTTCATTTTGATGAGTTCTGAAATATAATTATCTAGACTGATCTCCCTCTGCGCATGTAAAA
ATGGCAGTATTTTAAATTTGTAAAGAATGTCTAATAAAATATAATCTAATTACACCGTGACTT

hide sequence

Protein Sequences


Protein RefSeqs	NP_036768	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA41889	(Get FASTA)	NCBI Sequence Viewer
	AAA41980	(Get FASTA)	NCBI Sequence Viewer
	AAA41981	(Get FASTA)	NCBI Sequence Viewer
	EDM01395	(Get FASTA)	NCBI Sequence Viewer
	P13085	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_036768 ⟸ NM_012636
- Peptide Label:	preproprotein
- UniProtKB:	P13085 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MLRRLVQQWSVLVFLLSYSVPSRGRSVEGLGRRLKRAVSEHQLLHDKGKSIQDLRRRFFLHHLI AEIHTAEIRATSEVSPNSKPAPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKKKG KPGKRREQEKKKRRTRSAWPGTTGSGLLEDPQPHTSPTSTSLEPSSRTH hide sequence

RefSeq Acc Id:

ENSRNOP00000078983 ⟸ ENSRNOT00000112037

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P13085-F1-model_v2	AlphaFold	P13085	1-177	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:3441	AgrOrtholog
BioCyc Gene	G2FUF-42415	BioCyc
Ensembl Genes	ENSRNOG00000069267	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000078983	ENTREZGENE
	ENSRNOP00000078983.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000112037	ENTREZGENE
	ENSRNOT00000112037.1	UniProtKB/TrEMBL
InterPro	PTH-rel	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTH/PTH-rel	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:24695	UniProtKB/Swiss-Prot
NCBI Gene	24695	ENTREZGENE
PANTHER	PARATHYROID HORMONE-RELATED PROTEIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR17223	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Parathyroid	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Pthlh	PhenoGen
PROSITE	PARATHYROID	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SMART	PTH	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I5ZLU3_RAT	UniProtKB/TrEMBL
	P13085	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-11-20	Pthlh	parathyroid hormone-like hormone	Pthlh	parathyroid hormone-like peptide	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2003-04-09	Pthlh	parathyroid hormone-like peptide		parathyroid-like peptide	Name updated	629478	APPROVED
2002-06-10	Pthlh	parathyroid-like peptide			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_function	may be a hormone for the mobilization and/or transfer of calcium to milk
gene_process	plays a role in lactation
gene_process	regulates epidermal development.
gene_process	may have intracrine effects in the nucleus of cells that produce it in addition to having juxtacrine, paracrine, and possibly endocrine effects after secretion	61489

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Imported Annotations - PID (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Imported Annotations - PID (archival)