Advanced Search (OLGA)

Gene: Pthlh (parathyroid hormone-like peptide) Mus musculus

Analyze

Symbol:

Pthlh

Name:

parathyroid hormone-like peptide

RGD ID:

11188

MGI Page

MGI

Description:

Predicted to enable hormone activity and peptide hormone receptor binding activity. Acts upstream of or within several processes, including endochondral ossification; lung development; and mammary gland morphogenesis. Located in nucleus. Is expressed in several structures, including brain; female reproductive system; integumental system; limb; and skeleton. Used to study achondroplasia and pseudohypoparathyroidism type 1A. Human ortholog(s) of this gene implicated in brachydactyly type E2. Orthologous to human PTHLH (parathyroid hormone like hormone).

Type:

protein-coding

RefSeq Status:

REVIEWED

Previously known as:

parathyroid hormone-like hormone; parathyroid hormone-like protein; parathyroid hormone-related peptide; parathyroid hormone-related protein; PLP; Pt; PTH-l; PTH-like; PTH-related peptide; PTH-rP; Pthrp

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PTHLH (parathyroid hormone like hormone)	HGNC	EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Rattus norvegicus (Norway rat):	Pthlh (parathyroid hormone-like hormone)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Pthlh (parathyroid hormone like hormone)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PTHLH (parathyroid hormone like hormone)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	PTHLH (parathyroid hormone like hormone)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Pthlh (parathyroid hormone like hormone)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PTHLH (parathyroid hormone like hormone)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PTHLH (parathyroid hormone like hormone)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Pthlh (parathyroid hormone like hormone)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Rattus norvegicus (Norway rat):	Pthlh (parathyroid hormone-like hormone)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	PTHLH (parathyroid hormone like hormone)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	pthlhb (parathyroid hormone-like hormone b)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|PANTHER\|PhylomeDB\|ZFIN)
Danio rerio (zebrafish):	pthlhb (parathyroid hormone-like hormone b)	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|ZFIN)
Danio rerio (zebrafish):	pthlha (parathyroid hormone-like hormone a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid\|ZFIN)
Danio rerio (zebrafish):	pthlha (parathyroid hormone-like hormone a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid\|ZFIN)
Xenopus tropicalis (tropical clawed frog):	pthlh	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCm39 - Mouse Genome Assembly GRCm39

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	147,153,607 - 147,165,511 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	147,153,599 - 147,165,681 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	6	147,252,109 - 147,264,013 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	147,252,101 - 147,264,183 (-)	Ensembl			mm10	GRCm38
MGSCv37	6	147,200,632 - 147,212,607 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	6	147,209,270 - 147,221,371 (-)	NCBI		MGSCv36	mm8
Celera	6	150,289,180 - 150,301,102 (-)	NCBI		Celera
Cytogenetic Map	6	G3	NCBI
cM Map	6	78.19	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

achondroplasia (IAGP)

acute necrotizing pancreatitis (ISO)

alcoholic pancreatitis (ISO)

bone resorption disease (ISO)

brachydactyly type E2 (ISO)

Breast Neoplasms (ISO)

Cachexia (ISO)

Chronic Pancreatitis (ISO)

Congenital Foot Deformities (ISO)

Congenital Hand Deformities (ISO)

Edema (ISO)

genetic disease (ISO)

Growth Disorders (ISO)

Hyperalgesia (ISO)

hypercalcemia (ISO)

lung disease (ISO)

lung non-small cell carcinoma (ISO)

multiple myeloma (ISO)

neuroendocrine tumor (ISO)

Osteolysis (ISO)

pancreatic cancer (ISO)

Prostatic Neoplasms (ISO)

pseudohypoparathyroidism type 1A (IAGP)

Spontaneous Abortions (ISO)

Superior Vena Cava Syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(E)-thiamethoxam (EXP)

1,2-dimethylhydrazine (EXP)

1-nitropyrene (ISO)

1-Oleoyl-2-acetyl-sn-glycerol (ISO)

17beta-estradiol (ISO)

17beta-hydroxy-17-methylestra-4,9,11-trien-3-one (ISO)

17beta-hydroxy-5alpha-androstan-3-one (ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

2,6-di-tert-butyl-4-methylphenol (EXP)

2-hydroxypropanoic acid (ISO)

2-palmitoylglycerol (ISO)

3',5'-cyclic AMP (ISO)

3,3',4,4',5-pentachlorobiphenyl (ISO)

3,3',5,5'-tetrabromobisphenol A (EXP)

4,4'-diaminodiphenylmethane (EXP)

4-nitroquinoline N-oxide (EXP)

5-azacytidine (ISO)

6-propyl-2-thiouracil (ISO)

8-Br-cAMP (ISO)

9-cis-retinoic acid (ISO)

acrolein (ISO)

acrylamide (ISO)

afimoxifene (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (EXP,ISO)

alpha-pinene (ISO)

amitrole (ISO)

antirheumatic drug (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

Azoxymethane (EXP)

benzene (EXP)

benzo[a]pyrene (EXP,ISO)

betulinic acid (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (ISO)

bortezomib (ISO)

butan-1-ol (ISO)

butane-2,3-dione (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

calcitriol (ISO)

calcium carbonate (ISO)

candesartan (ISO)

ceruletide (EXP,ISO)

CGP 52608 (ISO)

chloroethene (EXP)

chloropicrin (ISO)

chloroprene (EXP)

cisplatin (ISO)

cobalt atom (EXP)

copper atom (ISO)

copper(0) (ISO)

crocidolite asbestos (ISO)

curcumin (ISO)

cyclosporin A (ISO)

dexamethasone (ISO)

dextran sulfate (EXP)

enalapril (ISO)

ethanol (EXP,ISO)

fentanyl (ISO)

folic acid (EXP,ISO)

formaldehyde (ISO)

geldanamycin (ISO)

gentamycin (ISO)

iron atom (ISO)

iron(0) (ISO)

L-ascorbic acid (ISO)

lead diacetate (ISO)

lead(0) (ISO)

leflunomide (ISO)

losartan (ISO)

manganese(II) chloride (ISO)

mercury dichloride (ISO)

methimazole (ISO)

methotrexate (ISO)

methoxychlor (ISO)

methylisothiazolinone (ISO)

methylmercury chloride (ISO)

N-Nitrosopyrrolidine (ISO)

nitrofen (ISO)

O-methyleugenol (ISO)

okadaic acid (ISO)

ozone (ISO)

paracetamol (ISO)

pentane-2,3-dione (ISO)

phenylephrine (ISO)

phorbol 13-acetate 12-myristate (ISO)

potassium chromate (ISO)

progesterone (ISO)

quercetin (ISO)

quinapril hydrochloride (ISO)

rac-lactic acid (ISO)

resveratrol (ISO)

silver atom (EXP)

silver(0) (EXP)

sodium arsenite (ISO)

Soman (ISO)

styrene (EXP)

sulfadimethoxine (ISO)

tamoxifen (ISO)

telmisartan (ISO)

temozolomide (ISO)

testosterone (EXP,ISO)

thiamethoxam (EXP)

thiram (ISO)

titanium dioxide (EXP,ISO)

trichostatin A (ISO)

undecane (ISO)

valproic acid (ISO)

vinclozolin (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adenylate cyclase-activating G protein-coupled receptor signaling pathway (IBA,ISO)

bone mineralization (IMP)

calcium ion homeostasis (TAS)

chondrocyte differentiation (IMP)

endochondral ossification (IMP)

endoderm development (IDA)

lung alveolus development (IMP)

lung epithelial cell differentiation (IMP)

magnesium ion homeostasis (TAS)

mammary gland bud elongation (IMP)

negative regulation of chondrocyte development (ISO)

negative regulation of chondrocyte differentiation (IDA,IGI,IMP,ISO)

negative regulation of DNA-binding transcription factor activity (IDA)

nipple sheath formation (IMP)

osteoblast development (IBA,IMP)

phosphate ion homeostasis (TAS)

positive regulation of cell population proliferation (IDA)

protein processing (IDA)

regulation of chondrocyte differentiation (IBA)

regulation of gene expression (ISO)

skeletal system development (IMP,ISO)

surfactant homeostasis (IMP)

Cellular Component

cytoplasm (IEA)

cytosol (ISO)

extracellular region (IEA)

extracellular space (ISO,TAS)

Golgi apparatus (ISO)

nucleoplasm (ISO)

nucleus (IDA,IEA)

Molecular Function

hormone activity (IBA,IEA,ISO,ISS,TAS)

peptide hormone receptor binding (IBA,ISO,ISS)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

Hedgehog signaling pathway (ISO)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

abnormal ameloblast morphology (IAGP)

abnormal angiogenesis (IAGP)

abnormal appendicular skeleton morphology (IAGP)

abnormal autophagy (IAGP)

abnormal axial skeleton morphology (IAGP)

abnormal blood vessel morphology (IAGP)

abnormal bone marrow development (IAGP)

abnormal bone mineralization (IAGP)

abnormal bone ossification (IAGP)

abnormal bone structure (IAGP)

abnormal bone trabecula morphology (IAGP)

abnormal brain vasculature morphology (IEA)

abnormal calcium ion homeostasis (IAGP)

abnormal cartilage development (IAGP)

abnormal cervical rib (IEA)

abnormal chondrocyte differentiation (IAGP)

abnormal circulating calcium level (IAGP)

abnormal circulating hormone level (IAGP)

abnormal clavicle morphology (IAGP)

abnormal cranium morphology (IEA)

abnormal ductus venosus valve morphology (IEA)

abnormal enamel morphology (IAGP)

abnormal forebrain morphology (IEA)

abnormal gait (IAGP)

abnormal head morphology (IEA)

abnormal inferior vena cava morphology (IEA)

abnormal long bone epiphyseal plate morphology (IAGP)

abnormal long bone epiphyseal plate proliferative zone (IAGP)

abnormal long bone hypertrophic chondrocyte zone (IAGP)

abnormal long bone metaphysis morphology (IAGP)

abnormal long bone morphology (IAGP)

abnormal lung development (IAGP)

abnormal lung interstitium morphology (IAGP)

abnormal lung morphology (IAGP)

abnormal lung saccule morphology (IAGP)

abnormal mandible morphology (IAGP)

abnormal mesenchymal cell differentiation involved in lung development (IAGP)

abnormal molar morphology (IAGP)

abnormal neurocranium morphology (IAGP)

abnormal odontoblast morphology (IAGP)

abnormal osteoblast differentiation (IAGP)

abnormal osteoblast morphology (IAGP)

abnormal osteoclast morphology (IAGP)

abnormal postnatal growth (IAGP)

abnormal pulmonary alveolus epithelium morphology (IAGP)

abnormal rib morphology (IAGP)

abnormal skeleton development (IAGP)

abnormal skeleton morphology (IAGP)

abnormal sternum ossification (IAGP)

abnormal thoracic cage shape (IAGP)

abnormal tooth development (IAGP)

abnormal tooth morphology (IAGP)

abnormal trabecular bone morphology (IAGP)

abnormal type II pneumocyte morphology (IAGP)

abnormal urine homeostasis (IAGP)

abnormal vertebral body morphology (IAGP)

abnormal vitamin D level (IAGP)

absent tooth root (IAGP)

absent type I pneumocytes (IAGP)

atelectasis (IAGP)

cachexia (IAGP)

chondrodystrophy (IAGP)

cyanosis (IAGP)

decreased alveolar lamellar body number (IAGP)

decreased body size (IAGP)

decreased body weight (IAGP)

decreased bone mineral density (IAGP)

decreased brain size (IAGP)

decreased cell proliferation (IAGP)

decreased chondrocyte number (IAGP)

decreased chondrocyte proliferation (IAGP)

decreased circulating glucose level (IAGP)

decreased length of long bones (IAGP)

decreased long bone epiphyseal plate size (IAGP)

decreased osteoblast cell number (IAGP)

decreased osteoclast cell number (IAGP)

decreased surfactant secretion (IAGP)

decreased total body fat amount (IAGP)

dilated liver sinusoidal space (IEA)

disorganized long bone epiphyseal plate (IAGP)

disproportionate dwarf (IAGP)

distended abdomen (IAGP)

domed cranium (IAGP)

embryo tumor (IEA)

enlarged parathyroid gland (IAGP)

exophthalmos (IAGP)

failure of tooth eruption (IAGP)

flattened snout (IAGP)

frontal bossing (IAGP)

hyperkeratosis (IAGP)

increased apoptosis (IAGP)

increased blood urea nitrogen level (IEA)

increased bone mass (IAGP)

increased chondrocyte apoptosis (IAGP)

increased compact bone thickness (IAGP)

increased diameter of long bones (IAGP)

increased osteoblast apoptosis (IAGP)

increased osteoblast cell number (IAGP)

increased osteocyte apoptosis (IAGP)

increased width of hypertrophic chondrocyte zone (IAGP)

kyphosis (IAGP)

long lower incisors (IAGP)

long tibia (IAGP)

malocclusion (IAGP)

neonatal lethality, complete penetrance (IAGP)

no abnormal phenotype detected (IEA)

osteoporosis (IAGP)

perinatal lethality, complete penetrance (IAGP)

postnatal growth retardation (IAGP)

postnatal lethality, complete penetrance (IAGP)

postnatal lethality, incomplete penetrance (IAGP)

premature aging (IAGP)

premature bone ossification (IAGP)

premature death (IAGP)

premature endochondral bone ossification (IAGP)

preweaning lethality, complete penetrance (IEA)

protruding tongue (IAGP)

respiratory failure (IAGP)

shallow orbits (IAGP)

short femur (IAGP)

short humerus (IAGP)

short limbs (IAGP)

short mandible (IAGP)

short maxilla (IAGP)

short radius (IAGP)

short ribs (IAGP)

short snout (IAGP)

short sternum (IAGP)

short tibia (IAGP)

short ulna (IAGP)

small lung (IAGP)

small lung saccule (IAGP)

small thoracic cavity (IAGP)

splayed ribs (IAGP)

thick lung-associated mesenchyme (IAGP)

thin epidermis (IAGP)

tooth ankylosis (IAGP)

tooth impaction (IAGP)

References

References - curated

#	Reference Title	Reference Citation
1.	TGFbeta2 mediates the effects of hedgehog on hypertrophic differentiation and PTHrP expression.	Alvarez J, etal., Development. 2002 Apr;129(8):1913-24.
2.	Electronic Transfer of Homolog Data	MGD and Homologene mouse data transfer
3.	MGDs mouse GO annotations	MGD data from the GO Consortium
4.	MGD IEA	MGD IEA
5.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
6.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
7.	Mouse MP Annotation Import Pipeline	RGD automated import pipeline
8.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
9.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
10.	Rat parathyroid hormone-like peptide: comparison with the human homologue and expression in malignant and normal tissue.	Yasuda T, etal., Mol Endocrinol 1989 Mar;3(3):518-25.

Additional References at PubMed

PMID:1354597	PMID:1628813	PMID:1889815	PMID:1973379	PMID:2055117	PMID:2249778	PMID:7508121	PMID:7516868	PMID:7590978	PMID:8056147	PMID:8089190	PMID:8185578
PMID:8314082	PMID:8557651	PMID:8592727	PMID:8608863	PMID:8662546	PMID:8662561	PMID:8816783	PMID:8840192	PMID:8889548	PMID:8895385	PMID:8938591	PMID:8986793
PMID:9008714	PMID:9391087	PMID:9460531	PMID:9477327	PMID:9664687	PMID:9736773	PMID:9751753	PMID:9789035	PMID:9806774	PMID:9832460	PMID:9856827	PMID:9858490
PMID:9921650	PMID:10049363	PMID:10098520	PMID:10098521	PMID:10213384	PMID:10330406	PMID:10330492	PMID:10409496	PMID:10409817	PMID:10449432	PMID:10465785	PMID:10530918
PMID:10631175	PMID:10639544	PMID:10742104	PMID:10843788	PMID:10854780	PMID:10922068	PMID:11103933	PMID:11156472	PMID:11161799	PMID:11171335	PMID:11171337	PMID:11306604
PMID:11316774	PMID:11498728	PMID:11518254	PMID:11566859	PMID:11606467	PMID:11702786	PMID:11714677	PMID:11748145	PMID:11760831	PMID:11792564	PMID:11832378	PMID:11879796
PMID:11897779	PMID:11994406	PMID:12049768	PMID:12050144	PMID:12135917	PMID:12185361	PMID:12194850	PMID:12351440	PMID:12379497	PMID:12399319	PMID:12414734	PMID:12466851
PMID:12477932	PMID:12538525	PMID:12606286	PMID:12671051	PMID:12713572	PMID:12810618	PMID:12960089	PMID:14586397	PMID:14597768	PMID:14668414	PMID:14694163	PMID:14722611
PMID:14745966	PMID:14751559	PMID:14966569	PMID:14980515	PMID:14993235	PMID:15039145	PMID:15124025	PMID:15132997	PMID:15162506	PMID:15177029	PMID:15226640	PMID:15355563
PMID:15489334	PMID:15542035	PMID:15561942	PMID:15741244	PMID:15841179	PMID:15866164	PMID:15883646	PMID:15901283	PMID:15923624	PMID:15951842	PMID:16138191	PMID:16141072
PMID:16284117	PMID:16355280	PMID:16375886	PMID:16421188	PMID:16537572	PMID:16602821	PMID:16672315	PMID:16675960	PMID:16783635	PMID:16783882	PMID:16818445	PMID:16857753
PMID:16877353	PMID:16935278	PMID:16988000	PMID:17003237	PMID:17065821	PMID:17083128	PMID:17166921	PMID:17191253	PMID:17199044	PMID:17200368	PMID:17301089	PMID:17328886
PMID:17443683	PMID:17481601	PMID:17576802	PMID:17660199	PMID:17660535	PMID:17670790	PMID:17997355	PMID:18025304	PMID:18052755	PMID:18183793	PMID:18247361	PMID:18258656
PMID:18358824	PMID:18434416	PMID:18456591	PMID:18477451	PMID:18539921	PMID:18550647	PMID:18597638	PMID:18601749	PMID:18621740	PMID:18636074	PMID:18791844	PMID:19035497
PMID:19091948	PMID:19147675	PMID:19196804	PMID:19224984	PMID:19252479	PMID:19351720	PMID:19378260	PMID:19389373	PMID:19389374	PMID:19419310	PMID:19474191	PMID:19487464
PMID:19557172	PMID:19574446	PMID:19590577	PMID:19605502	PMID:19704004	PMID:19723659	PMID:19759178	PMID:19795511	PMID:19906842	PMID:19906844	PMID:19948490	PMID:19959711
PMID:19968565	PMID:20032198	PMID:20145205	PMID:20170896	PMID:20200004	PMID:20428761	PMID:20530870	PMID:20534695	PMID:20675290	PMID:20876097	PMID:20920500	PMID:20951345
PMID:21308774	PMID:21312270	PMID:21677750	PMID:21702022	PMID:21872610	PMID:21873635	PMID:21911092	PMID:22056386	PMID:22087279	PMID:22210745	PMID:22290230	PMID:22291434
PMID:22318950	PMID:22451941	PMID:22808183	PMID:22844494	PMID:22930757	PMID:22967998	PMID:23026747	PMID:23034629	PMID:23109045	PMID:23284101	PMID:23364519	PMID:23494914
PMID:23545937	PMID:23716486	PMID:23720345	PMID:23782944	PMID:23895994	PMID:23937065	PMID:23940373	PMID:24154525	PMID:24161523	PMID:24349082	PMID:24586192	PMID:24762197
PMID:24777663	PMID:24785493	PMID:24862038	PMID:24930703	PMID:24936779	PMID:24952961	PMID:25035110	PMID:25043053	PMID:25057796	PMID:25107907	PMID:25187507	PMID:25340332
PMID:25529628	PMID:25645361	PMID:25761772	PMID:25808752	PMID:25917430	PMID:26052897	PMID:26094741	PMID:26097038	PMID:26116392	PMID:26121068	PMID:26164475	PMID:26229008
PMID:26432258	PMID:26495794	PMID:26518653	PMID:26581094	PMID:26794256	PMID:26859332	PMID:26859889	PMID:26952977	PMID:26992132	PMID:27018594	PMID:27068606	PMID:27075243
PMID:27335464	PMID:27373231	PMID:27391423	PMID:27463808	PMID:27666725	PMID:27930311	PMID:28027321	PMID:28408247	PMID:28408643	PMID:28698625	PMID:28741471	PMID:28864069
PMID:28914969	PMID:29222391	PMID:29353060	PMID:29805302	PMID:30401834	PMID:30509999	PMID:30843886	PMID:30973865	PMID:31201465	PMID:31430259	PMID:31927188	PMID:32973206
PMID:33095824	PMID:33492304	PMID:33724469	PMID:33879790	PMID:34101894	PMID:34108685	PMID:34309509	PMID:34376651	PMID:35440032	PMID:35523895	PMID:35863746	PMID:35887221
PMID:35974052	PMID:37236490	PMID:37318953	PMID:37440279	PMID:37568579	PMID:37683603	PMID:37704733	PMID:38051593	PMID:38058151	PMID:38234039	PMID:38346197	PMID:38355793
PMID:38760574	PMID:39012257	PMID:39012795	PMID:39090666	PMID:40362273

Genomics

Comparative Map Data

Pthlh
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	147,153,607 - 147,165,511 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	147,153,599 - 147,165,681 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	6	147,252,109 - 147,264,013 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	147,252,101 - 147,264,183 (-)	Ensembl			mm10	GRCm38
MGSCv37	6	147,200,632 - 147,212,607 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	6	147,209,270 - 147,221,371 (-)	NCBI		MGSCv36	mm8
Celera	6	150,289,180 - 150,301,102 (-)	NCBI		Celera
Cytogenetic Map	6	G3	NCBI
cM Map	6	78.19	NCBI

PTHLH
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	12	27,958,084 - 27,972,733 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	12	27,958,084 - 27,972,733 (-)	Ensembl			hg38	GRCh38
GRCh37	12	28,111,017 - 28,125,666 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	28,002,284 - 28,016,183 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	12	28,002,283 - 28,014,161	NCBI
Celera	12	33,256,594 - 33,270,557 (-)	NCBI		Celera
Cytogenetic Map	12	p11.22	NCBI
HuRef	12	27,880,337 - 27,894,279 (-)	NCBI		HuRef
CHM1_1	12	28,076,045 - 28,089,944 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	12	27,829,831 - 27,844,463 (-)	NCBI		T2T-CHM13v2.0

Pthlh
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	181,919,400 - 181,930,454 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	4	181,919,400 - 181,930,454 (-)	Ensembl				GRCr8
mRatBN7.2	4	180,188,792 - 180,199,847 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	180,188,792 - 180,199,847 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	4	186,472,387 - 186,483,481 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	182,256,935 - 182,268,028 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	180,877,368 - 180,888,461 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	181,663,425 - 181,674,181 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_5.0	4	245,811,895 - 245,822,651 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	4	184,887,702 - 184,898,841 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	4	168,675,915 - 168,686,473 (-)	NCBI		Celera
RGSC_v3.1	4	185,132,825 - 185,143,965 (-)	NCBI
RH 3.4 Map	4	1091.1	RGD
Cytogenetic Map	4	q44	NCBI

Pthlh
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955505	6,834,533 - 6,847,335 (+)	Ensembl
ChiLan1.0	NW_004955505	6,834,533 - 6,846,909 (+)	NCBI	ChiLan1.0	ChiLan1.0

PTHLH
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	10	68,846,032 - 68,858,167 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	12	68,842,410 - 68,854,564 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	12	58,341,361 - 58,355,804 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	12	60,959,327 - 60,973,749 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	12	60,960,071 - 60,973,750 (+)	Ensembl			panPan2	panpan1.1

PTHLH
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	27	19,781,557 - 19,795,078 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	27	19,781,557 - 19,795,078 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	27	26,604,753 - 26,729,826 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	27	19,869,742 - 19,989,315 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	27	19,975,781 - 19,989,312 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	27	19,676,917 - 19,795,837 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	27	19,703,486 - 19,822,427 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	27	26,761,823 - 26,881,419 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Pthlh
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	81,724,063 - 81,735,818 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936760	197,525 - 209,518 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936760	197,525 - 209,212 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PTHLH
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	5	45,751,292 - 45,763,415 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	5	45,750,968 - 45,763,421 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	5	49,159,951 - 49,172,393 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PTHLH
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	11	27,682,300 - 27,694,808 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	11	27,682,338 - 27,694,898 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666069	7,351,760 - 7,364,353 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Pthlh
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624778	8,008,056 - 8,019,612 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624778	8,007,358 - 8,019,538 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Variants

Variants in Pthlh
507 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	111
Count of miRNA genes:	109
Interacting mature miRNAs:	109
Transcripts:	ENSMUST00000052296
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCm39)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
4142079	Skmw15_m	skeletal muscle weight 15 (mouse)			Not determined		6	116829851	149588044	Mouse
10449437	Pas15_m	pulmonary adenoma susceptibility 15 (mouse)					6	128180868	149588044	Mouse
1301084	Bpq5_m	blood pressure QTL 5 (mouse)			Not determined		6	129330484	149588044	Mouse
14746990	Manh61_m	mandible shape 61 (mouse)					6	130156355	149588044	Mouse
4141295	Rua_m	raffinose acetate tasting (mouse)			Not determined			115546805	149549364	Mouse
10766452	Sle23_m	systematic lupus erythematosus susceptibility 23 (mouse)					6	128601582	149588044	Mouse
25314320	Histh5_m	histamine hypersensitivity 5 (mouse)					6	48696934	148351498	Mouse
14746999	Mancz6_m	mandible centroid size 6 (mouse)					6	130156355	149588044	Mouse
1302089	Wta2_m	weight adult 2 (mouse)			Not determined		6	125269523	149588044	Mouse
1301686	Trmq1_m	T cell ratio modifier QTL 1 (mouse)			Not determined		6	129330484	149588044	Mouse
1301620	Insq8_m	insulin QTL 8 (mouse)			Not determined		6	129534979	149588044	Mouse
10053680	Lith25_m	lithogenic gene 25 (mouse)			Not determined		6	128601582	149588044	Mouse
4141974	Skmw14_m	skeletal muscle weight 14 (mouse)			Not determined		6	129330484	149588044	Mouse
15092047	Wsigrme2_m	week six growth rate, maternal effect 2 (mouse)					6	140497205	147252976	Mouse
15092045	Wngrme2_m	week nine growth rate, maternal effect 2 (mouse)					6	140497205	147252976	Mouse
1301027	Hdlq12_m	HDL QTL 12 (mouse)			Not determined		6	128601582	149588044	Mouse
15092052	Wsegrme2_m	week seven growth rate, maternal effect 2 (mouse)					6	140497205	147252976	Mouse
1301152	Athsq2_m	atherosclerosis susceptibility QTL 2 (mouse)			Not determined		6	117059949	149588044	Mouse
15092053	Wegrme2_m	week eight growth rate, maternal effect 2 (mouse)					6	140445726	147201498	Mouse
1301927	Etohcta6_m	ethanol conditioned taste aversion 6 (mouse)			Not determined		6	115578005	149578150	Mouse
4141194	Cyx_m	cycloheximide tasting (mouse)			Not determined			115546805	149549364	Mouse
1558959	Eamcd2_m	experimental autoimmune myocarditis 2 (mouse)			Not determined		6	129953954	149588044	Mouse
15092060	Wfogrme1_m	week four growth rate, maternal effect 1 (mouse)					6	140497205	147252976	Mouse
15092061	Wfigrme1_m	week five growth rate, maternal effect 1 (mouse)					6	140445726	147201498	Mouse
15092058	Lgrme2_m	late growth rate, maternal effect 2 (mouse)					6	140497205	147252976	Mouse
4141889	Qui_m	quinine sensitivity, taste (mouse)			Not determined			115546805	149549364	Mouse
15092056	Mgrme1_m	mid growth rate, maternal effect 1 (mouse)					6	140497205	147252976	Mouse
1301804	Bulb2_m	bulb size 2 (mouse)			Not determined		6	120416806	149588044	Mouse

Markers in Region

D6Mit26

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	6	147,264,666 - 147,264,871	UniSTS	GRCm38
MGSCv37	6	147,213,188 - 147,213,393	UniSTS	GRCm37
Cytogenetic Map	6	F-G	UniSTS
cM Map	6	74.4	UniSTS
Whitehead Genetic	6	65.6	UniSTS
Whitehead_YAC	6		UniSTS

RH94501

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	6	147,252,204 - 147,252,403	UniSTS	GRCm38
MGSCv37	6	147,200,726 - 147,200,925	UniSTS	GRCm37
Celera	6	150,289,274 - 150,289,473	UniSTS
Cytogenetic Map	6	F-G	UniSTS

PMC229353P1

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	6	147,263,736 - 147,263,826	UniSTS	GRCm38
MGSCv37	6	147,212,258 - 147,212,348	UniSTS	GRCm37
Celera	6	150,300,753 - 150,300,843	UniSTS
Cytogenetic Map	6	F-G	UniSTS

Pthlh

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
Cytogenetic Map	6	F-G	UniSTS
cM Map	6	74.0	UniSTS

Pthlh

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
Cytogenetic Map	6	F-G	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_008970	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC156278	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AH003058	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AJ278119	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AW488290	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AW540230	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY183377	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY220497	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC058187	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CB194603	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH466572	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CJ063300	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CJ063309	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CU210848	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSMUST00000052296 ⟹ ENSMUSP00000051433

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	6	147,153,599 - 147,165,665 (-)	Ensembl
GRCm38.p6 Ensembl	6	147,252,101 - 147,264,167 (-)	Ensembl

Ensembl Acc Id:

ENSMUST00000204197 ⟹ ENSMUSP00000145509

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	6	147,153,607 - 147,165,681 (-)	Ensembl
GRCm38.p6 Ensembl	6	147,252,109 - 147,264,183 (-)	Ensembl

RefSeq Acc Id:

NM_008970 ⟹ NP_032996

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	6	147,153,607 - 147,165,511 (-)	NCBI
GRCm38	6	147,252,109 - 147,264,013 (-)	NCBI
MGSCv37	6	147,200,632 - 147,212,607 (-)	RGD
Celera	6	150,289,180 - 150,301,102 (-)	RGD
cM Map	6		ENTREZGENE

Sequence:

show sequence

GCGGCCACCTGGCCCTCGCATCCACGACACGCGCGCCTGCAACTTGTTCAAGGGCGTTGTGGAA
TCAACTTTCCGGAAGCAACCAGCCCACCGAAGGAGGTAGACCGACAGCTATGTATATATACGCG
CTCTGCCGCAAGTGGCTGTGCACCCAGAGGCCCGGTGCGCAGGACAGCTGACTCCTGAGGAACA
CCCGCGTTTGAAGAGGGGTTTGACCTGCCCCACGACCCAGAGTGCTGCCGCCAAGACTAATTAG
ACATTGCTATGGGAGCCACAGCAACGCGCCACGCATCCCCGACGCCTATGTAAAACGCCCGGTT
TTCGCTCTTCTTTCAGAGGAAGCTCTCTGATTGCTTTTTCCCCTCTCGGGTCCCTTTTTGCCTG
TGCGGTTTGAGAGAGGCGCAGTTAGAGGCGCTGATTCCTACACAAGTCCCCAGAGCCAGCGAGC
GGCACGATGCTGCGGAGGCTGGTTCAGCAGTGGAGTGTCCTGGTATTCCTGCTCAGCTACTCCG
TGCCCTCCCGCGGGCGTTCGGTGGAGGGGCTTGGCCGCAGGCTCAAACGCGCTGTGTCTGAACA
TCAGCTACTGCATGACAAGGGCAAGTCCATCCAAGACTTGCGCCGCCGTTTCTTCCTCCACCAT
CTGATCGCGGAGATCCACACAGCCGAAATCAGAGCTACCTCGGAGGTGTCCCCCAACTCCAAAC
CTGCTCCCAACACCAAAAACCACCCCGTGCGGTTTGGGTCAGACGATGAGGGCAGATACCTAAC
TCAGGAAACCAACAAGGTGGAGACGTACAAAGAACAGCCACTCAAGACACCCGGGAAGAAGAAG
AAAGGCAAGCCTGGGAAACGCAGAGAACAGGAGAAAAAGAAGCGAAGGACTCGGTCTGCCTGGC
CAAGCACAGCTGCGAGTGGCCTGCTTGAGGACCCCCTGCCCCACACCTCCAGGCCCTCGCTGGA
GCCCAGCTTAAGGACGCATTGAAATTTTCATCGAAGATCTTCCAAGGACACGTTACAGGATTTT
GTAATAGTAAACATATGGAAAGTATTAGACATATTTATTGCCTGTACATACTGTAAATGCATTG
GGATCAAACTGTCTCCCCAGGAAACTGCACATGGGTCATGTGAATATTTTTCCCTTTTGCCAAG
GCTAATCCAATTATTCCTGTCACTGTTACCATAATTTATTTTGTCAACTGATGTATTTATTTGT
AAATGTATCTTGGTGCTGCTGACTCTGTTTTTTTGTAACATAATGCACTTTAGGTATACATATC
GAGTATGTGGATGAATTTAACACATAAAAGGATCTCTATTTTGTGGTTCATTTTAATGAGTTCT
GAAATATAATTATCTAGACTGATTTCCTTCTGTGCATGTAAAAATGGCAGTATTTTAAATTTGT
AAAGAATGTCTAATAAAATATAATCTAATTATAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_032996	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA63639	(Get FASTA)	NCBI Sequence Viewer
	AAH58187	(Get FASTA)	NCBI Sequence Viewer
	AAO25537	(Get FASTA)	NCBI Sequence Viewer
	AAO64343	(Get FASTA)	NCBI Sequence Viewer
	CAC39218	(Get FASTA)	NCBI Sequence Viewer
	EDL10731	(Get FASTA)	NCBI Sequence Viewer
	EDL10732	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSMUSP00000051433
GenBank Protein	P22858	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_032996 ⟸ NM_008970
- Peptide Label:	preproprotein
- UniProtKB:	P22858 (UniProtKB/Swiss-Prot), Q540C1 (UniProtKB/TrEMBL), Q924X4 (UniProtKB/TrEMBL)
- Sequence:	show sequence MLRRLVQQWSVLVFLLSYSVPSRGRSVEGLGRRLKRAVSEHQLLHDKGKSIQDLRRRFFLHHLI AEIHTAEIRATSEVSPNSKPAPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKKKG KPGKRREQEKKKRRTRSAWPSTAASGLLEDPLPHTSRPSLEPSLRTH hide sequence

Ensembl Acc Id:

ENSMUSP00000051433 ⟸ ENSMUST00000052296

Ensembl Acc Id:

ENSMUSP00000145509 ⟸ ENSMUST00000204197

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P22858-F1-model_v2	AlphaFold	P22858	1-175	view protein structure

Promoters

RGD ID:

6891546

Promoter ID:

EPDNEW_M9224

Type:

multiple initiation site

Name:

Pthlh_1

Description:

Mus musculus parathyroid hormone-like peptide , mRNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_M9225

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	6	147,263,868 - 147,263,928	EPDNEW

RGD ID:

6891548

Promoter ID:

EPDNEW_M9225

Type:

initiation region

Name:

Pthlh_2

Description:

Mus musculus parathyroid hormone-like peptide , mRNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_M9224

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	6	147,264,007 - 147,264,067	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	MGI:97800	AgrOrtholog
Ensembl Genes	ENSMUSG00000048776	Ensembl, ENTREZGENE
Ensembl Transcript	ENSMUST00000052296	ENTREZGENE
InterPro	PTH-rel	UniProtKB/Swiss-Prot
	PTH/PTH-rel	UniProtKB/Swiss-Prot
MGD	MGI:97800	ENTREZGENE
NCBI Gene	19227	ENTREZGENE
PANTHER	PARATHYROID HORMONE-RELATED PROTEIN	UniProtKB/Swiss-Prot
	PTHR17223	UniProtKB/Swiss-Prot
Pfam	Parathyroid	UniProtKB/Swiss-Prot
PhenoGen	Pthlh	PhenoGen
PROSITE	PARATHYROID	UniProtKB/Swiss-Prot
SMART	PTH	UniProtKB/Swiss-Prot
UniProt	P22858	ENTREZGENE, UniProtKB/Swiss-Prot
	Q540C1	ENTREZGENE, UniProtKB/TrEMBL
	Q811S6_MOUSE	UniProtKB/TrEMBL
	Q924X4	ENTREZGENE, UniProtKB/TrEMBL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Imported Annotations - PID (archival)

Mammalian Phenotype

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Imported Annotations - PID (archival)

Mammalian Phenotype