Advanced Search (OLGA)

Gene: Arpc3 (actin related protein 2/3 complex, subunit 3) Rattus norvegicus

Analyze

Symbol:

Arpc3

Name:

actin related protein 2/3 complex, subunit 3

RGD ID:

1311985

Description:

Predicted to be a structural constituent of cytoskeleton. Predicted to contribute to actin filament binding activity. Involved in cellular response to nerve growth factor stimulus. Located in growth cone leading edge. Part of filamentous actin. Used to study Parkinson's disease. Orthologous to human ARPC3 (actin related protein 2/3 complex subunit 3); PARTICIPATES IN insulin responsive facilitative sugar transporter mediated glucose transport pathway; platelet-derived growth factor signaling pathway; Rab family mediated signaling pathway; INTERACTS WITH 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,6-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

actin-related protein 2/3 complex subunit 3; LOC288669

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ARPC3 (actin related protein 2/3 complex subunit 3)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Arpc3 (actin related protein 2/3 complex, subunit 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Arpc3 (actin related protein 2/3 complex subunit 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ARPC3 (actin related protein 2/3 complex subunit 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ARPC3 (actin related protein 2/3 complex subunit 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	LOC101978301 (uncharacterized LOC101978301)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ARPC3 (actin related protein 2/3 complex subunit 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ARPC3 (actin related protein 2/3 complex subunit 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Arpc3 (actin related protein 2/3 complex subunit 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	ARPC3 (actin related protein 2/3 complex subunit 3)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Arpc3 (actin related protein 2/3 complex, subunit 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	arpc3 (actin related protein 2/3 complex, subunit 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	ARC18	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Arpc3A	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Arpc3B	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	arx-5	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	arpc3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	39,833,569 - 39,847,436 (-)	NCBI		GRCr8
mRatBN7.2	12	34,172,780 - 34,186,651 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	34,172,780 - 34,186,651 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	12	35,345,197 - 35,359,072 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	35,956,610 - 35,970,481 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	35,008,933 - 35,022,805 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	39,653,951 - 39,667,817 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	39,653,953 - 39,667,849 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	12	41,533,346 - 41,548,335 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	12	35,366,969 - 35,377,111 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	12	35,230,356 - 35,240,663 (-)	NCBI
Celera	12	35,843,695 - 35,857,566 (-)	NCBI		Celera
Cytogenetic Map	12	q16	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

diabetes mellitus (ISO)

Parkinson's disease (IDA)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

1-chloro-2,4-dinitrobenzene (ISO)

17alpha-ethynylestradiol (EXP,ISO)

2,3',4,4',5-Pentachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,6-dimethoxyphenol (ISO)

2,6-dinitrotoluene (EXP)

3,4-methylenedioxymethamphetamine (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (EXP)

5-fluorouracil (ISO)

6-propyl-2-thiouracil (EXP)

all-trans-retinoic acid (ISO)

amitrole (EXP)

amphetamine (EXP)

ampicillin (EXP)

antirheumatic drug (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

Bisphenol B (ISO)

bisphenol F (EXP,ISO)

caffeine (ISO)

captan (ISO)

carbon nanotube (ISO)

dexamethasone (ISO)

dextran sulfate (ISO)

diarsenic trioxide (ISO)

dicrotophos (ISO)

diuron (ISO)

doxorubicin (ISO)

epoxiconazole (ISO)

ethanol (ISO)

folic acid (ISO)

furfural (ISO)

genistein (ISO)

gentamycin (EXP)

hydrogen peroxide (ISO)

indometacin (ISO)

ivermectin (ISO)

methidathion (ISO)

methimazole (EXP)

metronidazole (EXP)

neomycin (EXP)

propiconazole (EXP)

rotenone (ISO)

sodium arsenite (ISO)

sodium chloride (ISO)

sulfadimethoxine (EXP)

sunitinib (ISO)

tamoxifen (ISO)

tetrahydropalmatine (ISO)

thapsigargin (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

triphenyl phosphate (ISO)

triptonide (ISO)

vancomycin (EXP)

vinclozolin (EXP)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

Arp2/3 complex-mediated actin nucleation (IBA,ISO)

cellular response to nerve growth factor stimulus (IEP)

regulation of actin filament polymerization (IEA)

regulation of synaptic vesicle endocytosis (ISO)

Cellular Component

Arp2/3 protein complex (IBA,ISO)

cell leading edge (IDA)

cytoplasm (IEA)

filamentous actin (IDA)

growth cone leading edge (IDA)

lamellipodium (ISO)

membrane (IEA)

Molecular Function

actin filament binding (IBA,ISO)

protein binding (ISO)

structural constituent of cytoskeleton (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

Fc gamma receptor mediated signaling pathway (IEA)

insulin responsive facilitative sugar transporter mediated glucose transport pathway (ISO)

platelet-derived growth factor signaling pathway (ISO)

Rab family mediated signaling pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Relationship between Arp2/3 complex and the barbed ends of actin filaments at the leading edge of carcinoma cells after epidermal growth factor stimulation.	Bailly M, etal., J Cell Biol. 1999 Apr 19;145(2):331-45.
2.	Arp2/3- and cofilin-coordinated actin dynamics is required for insulin-mediated GLUT4 translocation to the surface of muscle cells.	Chiu TT, etal., Mol Biol Cell. 2010 Oct 15;21(20):3529-39. doi: 10.1091/mbc.E10-04-0316. Epub 2010 Aug 25.
3.	Global Gene Expression Profiling in Omental Adipose Tissue of Morbidly Obese Diabetic African Americans.	Doumatey AP, etal., J Endocrinol Metab. 2015 Jun;5(3):199-210.
4.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
6.	Recruitment of the Arp2/3 complex and mena for the stimulation of actin polymerization in growth cones by nerve growth factor.	Goldberg DJ, etal., J Neurosci Res. 2000 May 15;60(4):458-67.
7.	Antiparkinsonian trophic action of glial cell line-derived neurotrophic factor and transforming growth factor beta1 is enhanced after co-infusion in rats.	Gonzalez-Aparicio R, etal., Exp Neurol. 2010 Nov;226(1):136-47. doi: 10.1016/j.expneurol.2010.08.016. Epub 2010 Aug 14.
8.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
9.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
10.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
11.	GOA pipeline	RGD automated data pipeline
12.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
13.	Comprehensive gene review and curation	RGD comprehensive gene curation

Additional References at PubMed

PMID:9230079	PMID:11741539	PMID:12477932	PMID:15252126	PMID:15294161	PMID:18509026	PMID:19056867	PMID:19946888	PMID:20458337	PMID:21423176	PMID:23376485	PMID:23533145

Genomics

Comparative Map Data

Arpc3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	39,833,569 - 39,847,436 (-)	NCBI		GRCr8
mRatBN7.2	12	34,172,780 - 34,186,651 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	34,172,780 - 34,186,651 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	12	35,345,197 - 35,359,072 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	35,956,610 - 35,970,481 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	35,008,933 - 35,022,805 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	39,653,951 - 39,667,817 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	39,653,953 - 39,667,849 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	12	41,533,346 - 41,548,335 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	12	35,366,969 - 35,377,111 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	12	35,230,356 - 35,240,663 (-)	NCBI
Celera	12	35,843,695 - 35,857,566 (-)	NCBI		Celera
Cytogenetic Map	12	q16	NCBI

ARPC3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	12	110,434,823 - 110,450,337 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	12	110,434,823 - 110,450,422 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	12	110,872,628 - 110,888,142 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	109,357,089 - 109,372,541 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	12	109,335,426 - 109,350,878	NCBI
Celera	12	110,499,460 - 110,514,921 (-)	NCBI		Celera
Cytogenetic Map	12	q24.11	NCBI
HuRef	12	107,890,831 - 107,906,550 (-)	NCBI		HuRef
CHM1_1	12	110,840,525 - 110,856,046 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	12	110,412,518 - 110,428,033 (-)	NCBI		T2T-CHM13v2.0

Arpc3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	122,529,941 - 122,544,244 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	122,529,941 - 122,552,247 (+)	Ensembl		GRCm39 Ensembl
GRCm38	5	122,391,878 - 122,406,181 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	122,391,878 - 122,414,184 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	5	122,841,937 - 122,856,187 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	5	122,652,545 - 122,666,795 (+)	NCBI		MGSCv36	mm8
Celera	5	119,470,471 - 119,484,714 (+)	NCBI		Celera
Cytogenetic Map	5	F	NCBI
cM Map	5	62.34	NCBI

Arpc3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955482	7,350,456 - 7,364,266 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955482	7,350,456 - 7,364,266 (-)	NCBI	ChiLan1.0	ChiLan1.0

ARPC3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	10	118,498,814 - 118,514,420 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	12	118,495,217 - 118,510,697 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	12	108,007,884 - 108,023,386 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	12	111,395,800 - 111,415,170 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	12	111,399,433 - 111,415,156 (-)	Ensembl	panpan1.1		panPan2

ARPC3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	26	8,267,123 - 8,277,779 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	26	8,267,196 - 8,277,688 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	26	8,430,745 - 8,441,421 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	26	8,524,788 - 8,535,469 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	26	8,524,794 - 8,535,367 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	26	8,484,142 - 8,494,810 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	26	8,542,697 - 8,553,529 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	26	8,497,864 - 8,508,751 (-)	NCBI		UU_Cfam_GSD_1.0

LOC101978301
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	156,057,681 - 156,061,635 (+)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936558	3,418,664 - 3,421,693 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ARPC3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	31,814,151 - 31,826,855 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	14	31,814,382 - 31,823,452 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	33,736,371 - 33,745,205 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ARPC3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	11	105,670,798 - 105,685,911 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666037	139,433,833 - 139,450,140 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Arpc3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624747	21,438,612 - 21,454,753 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624747	21,438,602 - 21,451,154 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Arpc3
81 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	25
Count of miRNA genes:	25
Interacting mature miRNAs:	25
Transcripts:	ENSRNOT00000011499
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631560	Apr1	Acute phase response QTL 1	6.1		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	19144362	46669029	Rat
8552964	Pigfal17	Plasma insulin-like growth factor 1 level QTL 17	3.5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564495	46669029	Rat
8693635	Alc28	Alcohol consumption QTL 28	2.7	0.439	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	12	23081340	44726024	Rat
61324	Eae5	Experimental allergic encephalomyelitis QTL 5	14		nervous system integrity trait (VT:0010566)	percentage of study population developing relapsing-remitting experimental autoimmune encephalomyelitis during a period of time (CMO:0001402)	12	19610870	46669029	Rat
9590147	Scort7	Serum corticosterone level QTL 7	13.61	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	12	1	42110980	Rat
1549829	Scl48	Serum cholesterol level QTL 48	5		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	12	9603277	46669029	Rat
737822	Alc10	Alcohol consumption QTL 10	2.2		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	12	19610870	40218516	Rat
70169	Eae13	Experimental allergic encephalomyelitis QTL 13		0.032	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	12	24139202	36638073	Rat
1600386	Calcic2	Intracellular calcium level QTL 2		0.001	platelet physiology trait (VT:0005464)	platelet intracellular calcium level (CMO:0000922)	12	28064433	46669029	Rat
1302792	Scl21	Serum cholesterol level QTL 21	3.8	0.0011	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	12	7196730	46669029	Rat
1556747	Calcic1	Intracellular calcium level QTL 1		3.6	platelet calcium amount (VT:0010500)	platelet intracellular calcium level (CMO:0000922)	12	28064433	40130419	Rat
631829	Alc6	Alcohol consumption QTL 6	4.7		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	12	28607526	37691617	Rat
8693658	Alc33	Alcohol consumption QTL 33	2.1	0.68	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	12	23081340	43551788	Rat
1598855	Bp294	Blood pressure QTL 294	3.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	1	34851688	Rat
1331761	Bp218	Blood pressure QTL 218	2.973		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	11073825	45055165	Rat
8694179	Bw150	Body weight QTL 150	2.9	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	12	1	42110980	Rat
7411545	Bw128	Body weight QTL 128	5.2	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	12	1	42110980	Rat
7411547	Bw129	Body weight QTL 129		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	5564495	46669029	Rat
737979	Pia22	Pristane induced arthritis QTL 22	53.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	1	44465750	Rat
1298081	Cia25	Collagen induced arthritis QTL 25	4.7		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	19610889	35682913	Rat
2300186	Bmd59	Bone mineral density QTL 59	7.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	12	10474137	46669029	Rat
7411660	Foco28	Food consumption QTL 28	10.9	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
70213	Niddm27	Non-insulin dependent diabetes mellitus QTL 27	3.72		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	19835789	38193007	Rat
7411641	Foco19	Food consumption QTL 19	27.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
7411643	Foco20	Food consumption QTL 20		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	20328819	46669029	Rat
5684888	Pia42	Pristane induced arthritis QTL 42			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	19610870	42828880	Rat
1549912	Bp268	Blood pressure QTL 268			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	13182736	46669029	Rat
2302060	Pia37	Pristane induced arthritis QTL 37	6.1	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	12	13198157	46669029	Rat
1641928	Alcrsp5	Alcohol response QTL 5			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	12	12812385	46669029	Rat
1300162	Bp188	Blood pressure QTL 188	3.19		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	32103174	45899022	Rat
8552912	Pigfal6	Plasma insulin-like growth factor 1 level QTL 6	5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564498	46669029	Rat
10059594	Kidm46	Kidney mass QTL 46	3.79	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	12	6107579	46669029	Rat
9590086	Insglur6	Insulin/glucose ratio QTL 6	18.97	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	12	1	42110980	Rat
8552918	Pigfal7	Plasma insulin-like growth factor 1 level QTL 7			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564495	46669029	Rat
1549902	Bp269	Blood pressure QTL 269			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	13182736	46669029	Rat
61404	Bw120	Body weight QTL 120	5.1		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	12	12351619	46669029	Rat
1300175	Cm5	Cardiac mass QTL 5	3.78		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	12	28064433	45899022	Rat
1331787	Rf41	Renal function QTL 41	2.998		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	12	28064557	40218380	Rat
2293699	Bss49	Bone structure and strength QTL 49	5.61	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	12	10474137	46669029	Rat
634351	Apr5	Acute phase response QTL 5	6.7		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	12	1	44503507	Rat
634350	Apr4	Acute phase response QTL 4	6		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	1172005	46172005	Rat
7387292	Kidm42	Kidney mass QTL 42	3.03	0.0004	kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	12	1	36247923	Rat
61421	Cia12	Collagen induced arthritis QTL 12	4.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	13635523	35682913	Rat
2303569	Gluco44	Glucose level QTL 44	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	12812385	46669029	Rat
7411586	Foco5	Food consumption QTL 5	5.4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
2303575	Insul14	Insulin level QTL 14	4		blood insulin amount (VT:0001560)	blood insulin level (CMO:0000349)	12	1	42450532	Rat
7411588	Foco6	Food consumption QTL 6		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
2302042	Pia38	Pristane induced arthritis QTL 38	3.5	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	12	1	44503507	Rat
7411595	Foco9	Food consumption QTL 9	4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
7411597	Foco10	Food consumption QTL 10		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
631543	Bp83	Blood pressure QTL 83	5.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	15550826	38478808	Rat

Markers in Region

RH133976

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	34,182,468 - 34,182,663 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	39,663,639 - 39,663,833	NCBI	Rnor6.0
Rnor_5.0	12	41,544,156 - 41,544,350	UniSTS	Rnor5.0
RGSC_v3.4	12	35,376,657 - 35,376,851	UniSTS	RGSC3.4
Celera	12	35,853,390 - 35,853,584	UniSTS
RH 3.4 Map	12	605.8	UniSTS
Cytogenetic Map	12	q16	UniSTS

BF412122

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	34,179,199 - 34,179,350 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	39,660,371 - 39,660,521	NCBI	Rnor6.0
Rnor_5.0	12	41,539,766 - 41,539,916	UniSTS	Rnor5.0
RGSC_v3.4	12	35,373,389 - 35,373,539	UniSTS	RGSC3.4
Celera	12	35,850,122 - 35,850,272	UniSTS
RH 3.4 Map	12	596.2	UniSTS
Cytogenetic Map	12	q16	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001105933	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC104314	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC166554	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473973	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219862	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221109	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ232132	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ232695	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000012	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000011499 ⟹ ENSRNOP00000011499

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	34,172,780 - 34,186,651 (-)	Ensembl
Rnor_6.0 Ensembl	12	39,653,953 - 39,667,849 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000099673 ⟹ ENSRNOP00000082825

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	34,172,780 - 34,183,407 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000108586 ⟹ ENSRNOP00000096174

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	34,173,698 - 34,186,651 (-)	Ensembl

RefSeq Acc Id:

NM_001105933 ⟹ NP_001099403

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	39,833,569 - 39,847,436 (-)	NCBI
mRatBN7.2	12	34,172,780 - 34,186,651 (-)	NCBI
Rnor_6.0	12	39,653,951 - 39,667,817 (-)	NCBI
Rnor_5.0	12	41,533,346 - 41,548,335 (-)	NCBI
RGSC_v3.4	12	35,366,969 - 35,377,111 (-)	RGD
Celera	12	35,843,695 - 35,857,566 (-)	RGD

Sequence:

show sequence

CCGCCTCTTCCGGCTTATTTCCGCCCACTCCACCCAGTCTAGTTTGCCGGAAACGCTGCTCCGC
TTTACCTGGGTTCAGCATCTCTAGATCGAATCCGGACACCGACAAAATGCCGGCTTACCACTCT
TCTCTCATGGACCCTGACACCAAGCTCATTGGCAACATGGCACTGCTGCCCATCCGAAGCCAGT
TCAAAGGACCCGCCCCTCGAGAGACGAAAGACACGGATATTGTGGATGAAGCCATCTATTACTT
CAAGGCCAACGTCTTCTTCAAGAACTATGAAATTAAGAATGAAGCGGACAGGACCTTGATCTAC
ATCACACTCTACATTTCTGAGTGTCTAAAGAAGCTCCAAAAGTGCAACTCCAGAAGCCAAGGCG
AGAAAGAAATGTACACGCTAGGAATCACCAACTTTCCCATTCCTGGCGAGCCTGGCTTTCCCCT
CAACGCCATTTACGCCAAACCTGCCAGCAAACAGGAGGATGAAACGATGCGCGCGTACCTACAG
CAGCTGAGGCAAGAGACCGGACTGAGGCTTTGTGACAAAGTTTTTGACCCTCAGAATGATAAAC
CAAGCAAGTGGTGGACTTGCTTTGTGAAGAGACAGTTCATGAACAAGAGTCTTTCGGGGCCCGG
GCAGTGAGAGGAGCCATGGTCAGCATCGCATTGAGGTGTACACAGTCCTATGTGTTTGTTCTTA
ACGTGTCACGAGAGGAGAGAGCCTGTCTACCGGGAAAGCTCTCGGTCAAGAGTTTGGAGGGTGG
GTGTCGGGTTTGAATTTCAAGCTGGTACTTCATATGTAATAAATGTCGCTGCTTATGTTAGACA
GACATTGAATTAAAACATTTTTGAGAAAAAGCGTACACAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001099403	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI66554	(Get FASTA)	NCBI Sequence Viewer
	EDM13686	(Get FASTA)	NCBI Sequence Viewer
	EDM13687	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000011499.5
	ENSRNOP00000082825.1
	ENSRNOP00000096174.1

RefSeq Acc Id:	NP_001099403 ⟸ NM_001105933
- UniProtKB:	B2GV73 (UniProtKB/TrEMBL), F1LRL8 (UniProtKB/TrEMBL), A0A9K3Y7C4 (UniProtKB/TrEMBL), A0A8I5ZU90 (UniProtKB/TrEMBL)
- Sequence:	show sequence MPAYHSSLMDPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDEAIYYFKANVFFKNYEIKNEA DRTLIYITLYISECLKKLQKCNSRSQGEKEMYTLGITNFPIPGEPGFPLNAIYAKPASKQEDET MRAYLQQLRQETGLRLCDKVFDPQNDKPSKWWTCFVKRQFMNKSLSGPGQ hide sequence

Ensembl Acc Id:

ENSRNOP00000011499 ⟸ ENSRNOT00000011499

Ensembl Acc Id:

ENSRNOP00000082825 ⟸ ENSRNOT00000099673

Ensembl Acc Id:

ENSRNOP00000096174 ⟸ ENSRNOT00000108586

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-B2GV73-F1-model_v2	AlphaFold	B2GV73	1-178	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13698645

Promoter ID:

EPDNEW_R9169

Type:

initiation region

Name:

Arpc3_1

Description:

actin related protein 2/3 complex, subunit 3

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	12	39,667,791 - 39,667,851	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1311985	AgrOrtholog
BioCyc Gene	G2FUF-19253	BioCyc
Ensembl Genes	ENSRNOG00000008673	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000011499.8	UniProtKB/TrEMBL
	ENSRNOT00000099673.1	UniProtKB/TrEMBL
	ENSRNOT00000108586.1	UniProtKB/TrEMBL
Gene3D-CATH	1.10.1760.10	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7311069	IMAGE-MGC_LOAD
InterPro	ARP2/3_p21-Arc	UniProtKB/TrEMBL
	ARPC3_sf	UniProtKB/TrEMBL
KEGG Report	rno:288669	UniProtKB/TrEMBL
MGC_CLONE	MGC:188163	IMAGE-MGC_LOAD
NCBI Gene	288669	ENTREZGENE
PANTHER	ACTIN-RELATED PROTEIN 2/3 COMPLEX SUBUNIT 3	UniProtKB/TrEMBL
	P21-Arc	UniProtKB/TrEMBL
Pfam	P21-Arc	UniProtKB/TrEMBL
PhenoGen	Arpc3	PhenoGen
PIRSF	ARP2/3_P21-Arc	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000008673	RatGTEx
Superfamily-SCOP	ARP2/3_P21-Arc	UniProtKB/TrEMBL
UniProt	A0A8I5ZU90	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6AL89_RAT	UniProtKB/TrEMBL
	A0A9K3Y7C4	ENTREZGENE, UniProtKB/TrEMBL
	B2GV73	ENTREZGENE, UniProtKB/TrEMBL
	F1LRL8	ENTREZGENE
UniProt Secondary	F1LRL8	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-04-30	Arpc3	actin related protein 2/3 complex, subunit 3	Arpc3_predicted	actin related protein 2/3 complex, subunit 3 (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Arpc3_predicted	actin related protein 2/3 complex, subunit 3 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

Send us a Message

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)