Symbol:
Arpc3
Name:
actin related protein 2/3 complex, subunit 3
RGD ID:
1311985
Description:
Predicted to be a structural constituent of cytoskeleton. Predicted to contribute to actin filament binding activity. Involved in cellular response to nerve growth factor stimulus. Located in growth cone leading edge. Part of filamentous actin. Used to study Parkinson's disease. Orthologous to human ARPC3 (actin related protein 2/3 complex subunit 3); PARTICIPATES IN insulin responsive facilitative sugar transporter mediated glucose transport pathway; platelet-derived growth factor signaling pathway; Rab family mediated signaling pathway; INTERACTS WITH 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,6-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
actin-related protein 2/3 complex subunit 3; LOC288669
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
ARPC3 (actin related protein 2/3 complex subunit 3) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Arpc3 (actin related protein 2/3 complex, subunit 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Arpc3 (actin related protein 2/3 complex subunit 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
ARPC3 (actin related protein 2/3 complex subunit 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
ARPC3 (actin related protein 2/3 complex subunit 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
LOC101978301 (uncharacterized LOC101978301) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
ARPC3 (actin related protein 2/3 complex subunit 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
ARPC3 (actin related protein 2/3 complex subunit 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Arpc3 (actin related protein 2/3 complex subunit 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
ARPC3 (actin related protein 2/3 complex subunit 3)
Alliance
DIOPT (HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Arpc3 (actin related protein 2/3 complex, subunit 3)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
arpc3 (actin related protein 2/3 complex, subunit 3)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
ARC18
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Arpc3A
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Arpc3B
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
arx-5
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
arpc3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 39,833,569 - 39,847,436 (-) NCBI GRCr8 mRatBN7.2 12 34,172,780 - 34,186,651 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 34,172,780 - 34,186,651 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 12 35,345,197 - 35,359,072 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 12 35,956,610 - 35,970,481 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 12 35,008,933 - 35,022,805 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 12 39,653,951 - 39,667,817 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 39,653,953 - 39,667,849 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 12 41,533,346 - 41,548,335 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 12 35,366,969 - 35,377,111 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 12 35,230,356 - 35,240,663 (-) NCBI Celera 12 35,843,695 - 35,857,566 (-) NCBI Celera Cytogenetic Map 12 q16 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Arpc3 Rat 1,2-dimethylhydrazine multiple interactions ISO RGD:1323729 6480464 Folic Acid inhibits the reaction [1,2-Dimethylhydrazine results in increased expression of ARPC3 mRNA] CTD PMID:22206623 Arpc3 Rat 1,2-dimethylhydrazine increases expression ISO RGD:1323729 6480464 1,2-Dimethylhydrazine results in increased expression of ARPC3 mRNA CTD PMID:22206623 Arpc3 Rat 1-chloro-2,4-dinitrobenzene affects binding ISO RGD:1323728 6480464 Dinitrochlorobenzene binds to ARPC3 protein CTD PMID:32991956 Arpc3 Rat 17alpha-ethynylestradiol affects expression ISO RGD:1323729 6480464 Ethinyl Estradiol affects the expression of ARPC3 mRNA CTD PMID:17555576 Arpc3 Rat 17alpha-ethynylestradiol decreases expression EXP 6480464 Ethinyl Estradiol results in decreased expression of ARPC3 mRNA CTD PMID:29097150 Arpc3 Rat 17alpha-ethynylestradiol multiple interactions ISO RGD:1323729 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of ARPC3 mRNA CTD PMID:17942748 Arpc3 Rat 17alpha-ethynylestradiol increases expression ISO RGD:1323729 6480464 Ethinyl Estradiol results in increased expression of ARPC3 mRNA CTD PMID:17942748 Arpc3 Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of ARPC3 mRNA CTD PMID:17557909 Arpc3 Rat 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO RGD:1323729 6480464 2,3',4,4',5-pentachlorobiphenyl results in increased expression of ARPC3 mRNA CTD PMID:31388691 Arpc3 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:1323729 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of ARPC3 mRNA CTD PMID:17942748 Arpc3 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of ARPC3 mRNA CTD PMID:34747641 Arpc3 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1323729 6480464 Tetrachlorodibenzodioxin affects the expression of ARPC3 mRNA CTD PMID:21570461 Arpc3 Rat 2,6-dimethoxyphenol multiple interactions ISO RGD:1323728 6480464 [Sodium Chloride co-treated with pyrogallol 1,3-dimethyl ether] results in decreased expression of and affects the more ... CTD PMID:38598786 Arpc3 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2,6-dinitrotoluene affects the expression of ARPC3 mRNA CTD PMID:21346803 Arpc3 Rat 3,4-methylenedioxymethamphetamine decreases expression EXP 6480464 N-Methyl-3,4-methylenedioxyamphetamine results in decreased expression of ARPC3 mRNA CTD PMID:30071829 Arpc3 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO RGD:1323728 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ... CTD PMID:28628672 Arpc3 Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:1323729 6480464 bisphenol S results in increased expression of ARPC3 mRNA CTD PMID:39298647 Arpc3 Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of more ... CTD PMID:36041667 Arpc3 Rat 5-fluorouracil decreases expression ISO RGD:1323728 6480464 Fluorouracil results in decreased expression of ARPC3 mRNA CTD PMID:16709241 Arpc3 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of ARPC3 mRNA CTD PMID:30047161 Arpc3 Rat all-trans-retinoic acid increases expression ISO RGD:1323728 6480464 Tretinoin results in increased expression of ARPC3 mRNA CTD PMID:17218384|PMID:33167477 Arpc3 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of ARPC3 mRNA CTD PMID:30047161 Arpc3 Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of ARPC3 mRNA CTD PMID:30779732 Arpc3 Rat ampicillin multiple interactions EXP 6480464 [Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in more ... CTD PMID:30545405 Arpc3 Rat antirheumatic drug decreases expression ISO RGD:1323728 6480464 Antirheumatic Agents results in decreased expression of ARPC3 mRNA CTD PMID:24449571 Arpc3 Rat arsenite(3-) multiple interactions ISO RGD:1323728 6480464 arsenite promotes the reaction [G3BP1 protein binds to ARPC3 mRNA] CTD PMID:32406909 Arpc3 Rat arsenous acid multiple interactions ISO RGD:1323728 6480464 Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to ARPC3 protein] CTD PMID:26598702 Arpc3 Rat arsenous acid increases expression ISO RGD:1323728 6480464 Arsenic Trioxide results in increased expression of ARPC3 protein CTD PMID:25419056 Arpc3 Rat benzo[a]pyrene decreases methylation ISO RGD:1323728 6480464 Benzo(a)pyrene results in decreased methylation of ARPC3 promoter CTD PMID:27901495 Arpc3 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of ARPC3 mRNA CTD PMID:26982218 Arpc3 Rat bisphenol A decreases expression ISO RGD:1323729 6480464 bisphenol A results in decreased expression of ARPC3 protein CTD PMID:35999755 Arpc3 Rat bisphenol A multiple interactions ISO RGD:1323729 6480464 [Dextran Sulfate co-treated with bisphenol A] results in decreased expression of ARPC3 protein CTD PMID:35999755 Arpc3 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of more ... CTD PMID:36041667 Arpc3 Rat bisphenol A increases expression ISO RGD:1323728 6480464 bisphenol A results in increased expression of ARPC3 protein CTD PMID:33376534|PMID:37567409 Arpc3 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of ARPC3 mRNA CTD PMID:25181051|PMID:30816183|PMID:32145629 Arpc3 Rat bisphenol AF increases expression ISO RGD:1323728 6480464 bisphenol AF results in increased expression of ARPC3 protein CTD PMID:34186270 Arpc3 Rat Bisphenol B increases expression ISO RGD:1323728 6480464 bisphenol B results in increased expression of ARPC3 protein CTD PMID:34186270 Arpc3 Rat bisphenol F multiple interactions ISO RGD:1323728 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ... CTD PMID:28628672 Arpc3 Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of more ... CTD PMID:36041667 Arpc3 Rat caffeine decreases phosphorylation ISO RGD:1323728 6480464 Caffeine results in decreased phosphorylation of ARPC3 protein CTD PMID:35688186 Arpc3 Rat captan decreases expression ISO RGD:1323729 6480464 Captan results in decreased expression of ARPC3 mRNA CTD PMID:31558096 Arpc3 Rat carbon nanotube increases expression ISO RGD:1323729 6480464 Nanotubes, Carbon analog results in increased expression of ARPC3 mRNA; Nanotubes, Carbon results in increased more ... CTD PMID:25554681 Arpc3 Rat dexamethasone multiple interactions ISO RGD:1323728 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ... CTD PMID:28628672 Arpc3 Rat dextran sulfate multiple interactions ISO RGD:1323729 6480464 [Dextran Sulfate co-treated with bisphenol A] results in decreased expression of ARPC3 protein CTD PMID:35999755 Arpc3 Rat dextran sulfate decreases expression ISO RGD:1323729 6480464 Dextran Sulfate results in decreased expression of ARPC3 protein CTD PMID:35999755 Arpc3 Rat diarsenic trioxide increases expression ISO RGD:1323728 6480464 Arsenic Trioxide results in increased expression of ARPC3 protein CTD PMID:25419056 Arpc3 Rat diarsenic trioxide multiple interactions ISO RGD:1323728 6480464 Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to ARPC3 protein] CTD PMID:26598702 Arpc3 Rat dicrotophos decreases expression ISO RGD:1323728 6480464 dicrotophos results in decreased expression of ARPC3 mRNA CTD PMID:28302478 Arpc3 Rat diuron decreases expression ISO RGD:1323728 6480464 Diuron results in decreased expression of ARPC3 mRNA CTD PMID:35967413 Arpc3 Rat doxorubicin decreases expression ISO RGD:1323728 6480464 Doxorubicin results in decreased expression of ARPC3 mRNA CTD PMID:29803840 Arpc3 Rat epoxiconazole increases expression ISO RGD:1323729 6480464 epoxiconazole results in increased expression of ARPC3 mRNA CTD PMID:35436446 Arpc3 Rat ethanol increases expression ISO RGD:1323729 6480464 Ethanol results in increased expression of ARPC3 mRNA CTD PMID:30319688 Arpc3 Rat folic acid multiple interactions ISO RGD:1323729 6480464 Folic Acid inhibits the reaction [1,2-Dimethylhydrazine results in increased expression of ARPC3 mRNA] CTD PMID:22206623 Arpc3 Rat folic acid decreases expression ISO RGD:1323729 6480464 Folic Acid results in decreased expression of ARPC3 mRNA CTD PMID:25629700 Arpc3 Rat furfural multiple interactions ISO RGD:1323728 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of more ... CTD PMID:38598786 Arpc3 Rat genistein decreases expression ISO RGD:1323728 6480464 Genistein results in decreased expression of ARPC3 mRNA CTD PMID:22228119 Arpc3 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of ARPC3 mRNA CTD PMID:22061828 Arpc3 Rat gentamycin multiple interactions EXP 6480464 [Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in more ... CTD PMID:30545405 Arpc3 Rat hydrogen peroxide affects expression ISO RGD:1323728 6480464 Hydrogen Peroxide affects the expression of ARPC3 mRNA CTD PMID:21179406 Arpc3 Rat indometacin multiple interactions ISO RGD:1323728 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ... CTD PMID:28628672 Arpc3 Rat ivermectin decreases expression ISO RGD:1323728 6480464 Ivermectin results in decreased expression of ARPC3 protein CTD PMID:32959892 Arpc3 Rat manganese atom multiple interactions ISO RGD:1323728 6480464 [manganese chloride results in increased abundance of Manganese] which results in decreased expression of ARPC3 more ... CTD PMID:39836092 Arpc3 Rat manganese(0) multiple interactions ISO RGD:1323728 6480464 [manganese chloride results in increased abundance of Manganese] which results in decreased expression of ARPC3 more ... CTD PMID:39836092 Arpc3 Rat manganese(II) chloride multiple interactions ISO RGD:1323728 6480464 [manganese chloride results in increased abundance of Manganese] which results in decreased expression of ARPC3 more ... CTD PMID:39836092 Arpc3 Rat methidathion increases expression ISO RGD:1323729 6480464 methidathion results in increased expression of ARPC3 mRNA CTD PMID:34813904 Arpc3 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of ARPC3 mRNA CTD PMID:30047161 Arpc3 Rat metronidazole multiple interactions EXP 6480464 [Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in more ... CTD PMID:30545405 Arpc3 Rat neomycin multiple interactions EXP 6480464 [Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in more ... CTD PMID:30545405 Arpc3 Rat nitrates multiple interactions ISO RGD:1323729 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of ARPC3 more ... CTD PMID:35964746 Arpc3 Rat propiconazole increases expression EXP 6480464 propiconazole results in increased expression of ARPC3 mRNA CTD PMID:30047161 Arpc3 Rat rotenone increases expression ISO RGD:1323728 6480464 Rotenone results in increased expression of ARPC3 mRNA CTD PMID:33512557 Arpc3 Rat sodium arsenite increases expression ISO RGD:1323728 6480464 sodium arsenite results in increased expression of ARPC3 mRNA CTD PMID:38568856 Arpc3 Rat sodium chloride multiple interactions ISO RGD:1323728 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of more ... CTD PMID:38598786 Arpc3 Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of ARPC3 mRNA CTD PMID:30047161 Arpc3 Rat sunitinib increases expression ISO RGD:1323728 6480464 Sunitinib results in increased expression of ARPC3 mRNA CTD PMID:31533062 Arpc3 Rat tamoxifen affects expression ISO RGD:1323729 6480464 Tamoxifen affects the expression of ARPC3 mRNA CTD PMID:17555576 Arpc3 Rat tetrahydropalmatine decreases expression ISO RGD:1323728 6480464 tetrahydropalmatine results in decreased expression of ARPC3 protein CTD PMID:20109541 Arpc3 Rat thapsigargin increases expression ISO RGD:1323728 6480464 Thapsigargin results in increased expression of ARPC3 mRNA CTD PMID:22378314 Arpc3 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of ARPC3 mRNA CTD PMID:34492290 Arpc3 Rat titanium dioxide increases expression ISO RGD:1323729 6480464 titanium dioxide results in increased expression of ARPC3 mRNA CTD PMID:23557971 Arpc3 Rat titanium dioxide decreases methylation ISO RGD:1323729 6480464 titanium dioxide results in decreased methylation of ARPC3 gene; titanium dioxide results in decreased methylation more ... CTD PMID:35295148 Arpc3 Rat triphenyl phosphate affects expression ISO RGD:1323728 6480464 triphenyl phosphate affects the expression of ARPC3 mRNA CTD PMID:37042841 Arpc3 Rat triptonide decreases expression ISO RGD:1323729 6480464 triptonide results in decreased expression of ARPC3 mRNA CTD PMID:33045310 Arpc3 Rat vancomycin multiple interactions EXP 6480464 [Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in more ... CTD PMID:30545405 Arpc3 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of ARPC3 mRNA CTD PMID:22570695 Arpc3 Rat vorinostat increases expression ISO RGD:1323728 6480464 vorinostat results in increased expression of ARPC3 mRNA CTD PMID:27188386
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
1,2-dimethylhydrazine (ISO) 1-chloro-2,4-dinitrobenzene (ISO) 17alpha-ethynylestradiol (EXP,ISO) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,6-dimethoxyphenol (ISO) 2,6-dinitrotoluene (EXP) 3,4-methylenedioxymethamphetamine (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) 5-fluorouracil (ISO) 6-propyl-2-thiouracil (EXP) all-trans-retinoic acid (ISO) amitrole (EXP) amphetamine (EXP) ampicillin (EXP) antirheumatic drug (ISO) arsenite(3-) (ISO) arsenous acid (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (EXP,ISO) caffeine (ISO) captan (ISO) carbon nanotube (ISO) dexamethasone (ISO) dextran sulfate (ISO) diarsenic trioxide (ISO) dicrotophos (ISO) diuron (ISO) doxorubicin (ISO) epoxiconazole (ISO) ethanol (ISO) folic acid (ISO) furfural (ISO) genistein (ISO) gentamycin (EXP) hydrogen peroxide (ISO) indometacin (ISO) ivermectin (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methidathion (ISO) methimazole (EXP) metronidazole (EXP) neomycin (EXP) nitrates (ISO) propiconazole (EXP) rotenone (ISO) sodium arsenite (ISO) sodium chloride (ISO) sulfadimethoxine (EXP) sunitinib (ISO) tamoxifen (ISO) tetrahydropalmatine (ISO) thapsigargin (ISO) thioacetamide (EXP) titanium dioxide (ISO) triphenyl phosphate (ISO) triptonide (ISO) vancomycin (EXP) vinclozolin (EXP) vorinostat (ISO)
1.
Relationship between Arp2/3 complex and the barbed ends of actin filaments at the leading edge of carcinoma cells after epidermal growth factor stimulation.
Bailly M, etal., J Cell Biol. 1999 Apr 19;145(2):331-45.
2.
Arp2/3- and cofilin-coordinated actin dynamics is required for insulin-mediated GLUT4 translocation to the surface of muscle cells.
Chiu TT, etal., Mol Biol Cell. 2010 Oct 15;21(20):3529-39. doi: 10.1091/mbc.E10-04-0316. Epub 2010 Aug 25.
3.
Global Gene Expression Profiling in Omental Adipose Tissue of Morbidly Obese Diabetic African Americans.
Doumatey AP, etal., J Endocrinol Metab. 2015 Jun;5(3):199-210.
4.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
6.
Recruitment of the Arp2/3 complex and mena for the stimulation of actin polymerization in growth cones by nerve growth factor.
Goldberg DJ, etal., J Neurosci Res. 2000 May 15;60(4):458-67.
7.
Antiparkinsonian trophic action of glial cell line-derived neurotrophic factor and transforming growth factor beta1 is enhanced after co-infusion in rats.
Gonzalez-Aparicio R, etal., Exp Neurol. 2010 Nov;226(1):136-47. doi: 10.1016/j.expneurol.2010.08.016. Epub 2010 Aug 14.
8.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
9.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
10.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
11.
GOA pipeline
RGD automated data pipeline
12.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
13.
Comprehensive gene review and curation
RGD comprehensive gene curation
Arpc3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 39,833,569 - 39,847,436 (-) NCBI GRCr8 mRatBN7.2 12 34,172,780 - 34,186,651 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 34,172,780 - 34,186,651 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 12 35,345,197 - 35,359,072 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 12 35,956,610 - 35,970,481 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 12 35,008,933 - 35,022,805 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 12 39,653,951 - 39,667,817 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 39,653,953 - 39,667,849 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 12 41,533,346 - 41,548,335 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 12 35,366,969 - 35,377,111 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 12 35,230,356 - 35,240,663 (-) NCBI Celera 12 35,843,695 - 35,857,566 (-) NCBI Celera Cytogenetic Map 12 q16 NCBI
ARPC3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 12 110,434,823 - 110,450,337 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 12 110,434,823 - 110,450,422 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 12 110,872,628 - 110,888,142 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 12 109,357,089 - 109,372,541 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 12 109,335,426 - 109,350,878 NCBI Celera 12 110,499,460 - 110,514,921 (-) NCBI Celera Cytogenetic Map 12 q24.11 NCBI HuRef 12 107,890,831 - 107,906,550 (-) NCBI HuRef CHM1_1 12 110,840,525 - 110,856,046 (-) NCBI CHM1_1 T2T-CHM13v2.0 12 110,412,518 - 110,428,033 (-) NCBI T2T-CHM13v2.0
Arpc3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 122,529,941 - 122,544,244 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 122,529,941 - 122,552,247 (+) Ensembl GRCm39 Ensembl GRCm38 5 122,391,878 - 122,406,181 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 122,391,878 - 122,414,184 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 122,841,937 - 122,856,187 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 122,652,545 - 122,666,795 (+) NCBI MGSCv36 mm8 Celera 5 119,470,471 - 119,484,714 (+) NCBI Celera Cytogenetic Map 5 F NCBI cM Map 5 62.34 NCBI
Arpc3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955482 7,350,456 - 7,364,266 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955482 7,350,456 - 7,364,266 (-) NCBI ChiLan1.0 ChiLan1.0
ARPC3 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 10 118,498,814 - 118,514,420 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 12 118,495,217 - 118,510,697 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 12 108,007,884 - 108,023,386 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 12 111,395,800 - 111,415,170 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 12 111,399,433 - 111,415,156 (-) Ensembl panpan1.1 panPan2
ARPC3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 26 8,267,123 - 8,277,779 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 26 8,267,196 - 8,277,688 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 26 8,430,745 - 8,441,421 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 26 8,524,788 - 8,535,469 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 26 8,524,794 - 8,535,367 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 26 8,484,142 - 8,494,810 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 26 8,542,697 - 8,553,529 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 26 8,497,864 - 8,508,751 (-) NCBI UU_Cfam_GSD_1.0
LOC101978301
ARPC3 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 14 31,814,151 - 31,826,855 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 14 31,814,382 - 31,823,452 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 14 33,736,371 - 33,745,205 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ARPC3
Arpc3
.
Predicted Target Of
Count of predictions: 25 Count of miRNA genes: 25 Interacting mature miRNAs: 25 Transcripts: ENSRNOT00000011499 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
631560 Apr1 Acute phase response QTL 1 6.1 orosomucoid 1 amount (VT:0010541) plasma orosomucoid 1 level (CMO:0001467) 12 19144362 46669029 Rat 8552964 Pigfal17 Plasma insulin-like growth factor 1 level QTL 17 3.5 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564495 46669029 Rat 8693635 Alc28 Alcohol consumption QTL 28 2.7 0.439 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 12 23081340 44726024 Rat 61324 Eae5 Experimental allergic encephalomyelitis QTL 5 14 nervous system integrity trait (VT:0010566) percentage of study population developing relapsing-remitting experimental autoimmune encephalomyelitis during a period of time (CMO:0001402) 12 19610870 46669029 Rat 9590147 Scort7 Serum corticosterone level QTL 7 13.61 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 12 1 42110980 Rat 1549829 Scl48 Serum cholesterol level QTL 48 5 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 12 9603277 46669029 Rat 737822 Alc10 Alcohol consumption QTL 10 2.2 consumption behavior trait (VT:0002069) ethanol drink intake rate (CMO:0001407) 12 19610870 40218516 Rat 70169 Eae13 Experimental allergic encephalomyelitis QTL 13 0.032 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 12 24139202 36638073 Rat 1600386 Calcic2 Intracellular calcium level QTL 2 0.001 platelet physiology trait (VT:0005464) platelet intracellular calcium level (CMO:0000922) 12 28064433 46669029 Rat 1302792 Scl21 Serum cholesterol level QTL 21 3.8 0.0011 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 12 7196730 46669029 Rat 1556747 Calcic1 Intracellular calcium level QTL 1 3.6 platelet calcium amount (VT:0010500) platelet intracellular calcium level (CMO:0000922) 12 28064433 40130419 Rat 631829 Alc6 Alcohol consumption QTL 6 4.7 consumption behavior trait (VT:0002069) ethanol drink intake rate (CMO:0001407) 12 28607526 37691617 Rat 8693658 Alc33 Alcohol consumption QTL 33 2.1 0.68 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 12 23081340 43551788 Rat 1598855 Bp294 Blood pressure QTL 294 3.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 12 1 34851688 Rat 1331761 Bp218 Blood pressure QTL 218 2.973 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 12 11073825 45055165 Rat 8694179 Bw150 Body weight QTL 150 2.9 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 12 1 42110980 Rat 7411545 Bw128 Body weight QTL 128 5.2 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 12 1 42110980 Rat 7411547 Bw129 Body weight QTL 129 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 6 5564495 46669029 Rat 737979 Pia22 Pristane induced arthritis QTL 22 53.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 1 44465750 Rat 1298081 Cia25 Collagen induced arthritis QTL 25 4.7 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 19610889 35682913 Rat 2300186 Bmd59 Bone mineral density QTL 59 7.1 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 12 10474137 46669029 Rat 7411660 Foco28 Food consumption QTL 28 10.9 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 70213 Niddm27 Non-insulin dependent diabetes mellitus QTL 27 3.72 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 12 19835789 38193007 Rat 7411641 Foco19 Food consumption QTL 19 27.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 7411643 Foco20 Food consumption QTL 20 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 20328819 46669029 Rat 5684888 Pia42 Pristane induced arthritis QTL 42 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 19610870 42828880 Rat 1549912 Bp268 Blood pressure QTL 268 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 10 13182736 46669029 Rat 2302060 Pia37 Pristane induced arthritis QTL 37 6.1 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 12 13198157 46669029 Rat 1641928 Alcrsp5 Alcohol response QTL 5 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 12 12812385 46669029 Rat 1300162 Bp188 Blood pressure QTL 188 3.19 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 12 32103174 45899022 Rat 8552912 Pigfal6 Plasma insulin-like growth factor 1 level QTL 6 5 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564498 46669029 Rat 10059594 Kidm46 Kidney mass QTL 46 3.79 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 12 6107579 46669029 Rat 9590086 Insglur6 Insulin/glucose ratio QTL 6 18.97 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 12 1 42110980 Rat 8552918 Pigfal7 Plasma insulin-like growth factor 1 level QTL 7 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564495 46669029 Rat 1549902 Bp269 Blood pressure QTL 269 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 12 13182736 46669029 Rat 61404 Bw120 Body weight QTL 120 5.1 body mass (VT:0001259) body mass index (BMI) (CMO:0000105) 12 12351619 46669029 Rat 1300175 Cm5 Cardiac mass QTL 5 3.78 heart mass (VT:0007028) heart left ventricle weight to body weight ratio (CMO:0000530) 12 28064433 45899022 Rat 1331787 Rf41 Renal function QTL 41 2.998 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 12 28064557 40218380 Rat 2293699 Bss49 Bone structure and strength QTL 49 5.61 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra trabecular cross-sectional area (CMO:0001692) 12 10474137 46669029 Rat 634351 Apr5 Acute phase response QTL 5 6.7 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 12 1 44503507 Rat 634350 Apr4 Acute phase response QTL 4 6 orosomucoid 1 amount (VT:0010541) plasma orosomucoid 1 level (CMO:0001467) 12 1172005 46172005 Rat 7387292 Kidm42 Kidney mass QTL 42 3.03 0.0004 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 12 1 36247923 Rat 61421 Cia12 Collagen induced arthritis QTL 12 4.6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 13635523 35682913 Rat 2303569 Gluco44 Glucose level QTL 44 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 12 12812385 46669029 Rat 7411586 Foco5 Food consumption QTL 5 5.4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 2303575 Insul14 Insulin level QTL 14 4 blood insulin amount (VT:0001560) blood insulin level (CMO:0000349) 12 1 42450532 Rat 7411588 Foco6 Food consumption QTL 6 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 2302042 Pia38 Pristane induced arthritis QTL 38 3.5 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 12 1 44503507 Rat 7411595 Foco9 Food consumption QTL 9 4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 7411597 Foco10 Food consumption QTL 10 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 631543 Bp83 Blood pressure QTL 83 5.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 12 15550826 38478808 Rat
RH133976
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 34,182,468 - 34,182,663 (+) MAPPER mRatBN7.2 Rnor_6.0 12 39,663,639 - 39,663,833 NCBI Rnor6.0 Rnor_5.0 12 41,544,156 - 41,544,350 UniSTS Rnor5.0 RGSC_v3.4 12 35,376,657 - 35,376,851 UniSTS RGSC3.4 Celera 12 35,853,390 - 35,853,584 UniSTS RH 3.4 Map 12 605.8 UniSTS Cytogenetic Map 12 q16 UniSTS
BF412122
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 34,179,199 - 34,179,350 (+) MAPPER mRatBN7.2 Rnor_6.0 12 39,660,371 - 39,660,521 NCBI Rnor6.0 Rnor_5.0 12 41,539,766 - 41,539,916 UniSTS Rnor5.0 RGSC_v3.4 12 35,373,389 - 35,373,539 UniSTS RGSC3.4 Celera 12 35,850,122 - 35,850,272 UniSTS RH 3.4 Map 12 596.2 UniSTS Cytogenetic Map 12 q16 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000011499 ⟹ ENSRNOP00000011499
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 34,172,780 - 34,186,651 (-) Ensembl Rnor_6.0 Ensembl 12 39,653,953 - 39,667,849 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000099673 ⟹ ENSRNOP00000082825
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 34,172,780 - 34,183,407 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000108586 ⟹ ENSRNOP00000096174
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 34,173,698 - 34,186,651 (-) Ensembl
RefSeq Acc Id:
NM_001105933 ⟹ NP_001099403
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 39,833,569 - 39,847,436 (-) NCBI mRatBN7.2 12 34,172,780 - 34,186,651 (-) NCBI Rnor_6.0 12 39,653,951 - 39,667,817 (-) NCBI Rnor_5.0 12 41,533,346 - 41,548,335 (-) NCBI RGSC_v3.4 12 35,366,969 - 35,377,111 (-) RGD Celera 12 35,843,695 - 35,857,566 (-) RGD
Sequence:
CCGCCTCTTCCGGCTTATTTCCGCCCACTCCACCCAGTCTAGTTTGCCGGAAACGCTGCTCCGCTTTACCTGGGTTCAGCATCTCTAGATCGAATCCGGACACCGACAAAATGCCGGCTTACCACTCT
hide sequence
RefSeq Acc Id:
NP_001099403 ⟸ NM_001105933
- UniProtKB:
B2GV73 (UniProtKB/TrEMBL), F1LRL8 (UniProtKB/TrEMBL), A0A9K3Y7C4 (UniProtKB/TrEMBL), A0A8I5ZU90 (UniProtKB/TrEMBL)
- Sequence:
MPAYHSSLMDPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDEAIYYFKANVFFKNYEIKNEADRTLIYITLYISECLKKLQKCNSRSQGEKEMYTLGITNFPIPGEPGFPLNAIYAKPASKQEDET
hide sequence
Ensembl Acc Id:
ENSRNOP00000011499 ⟸ ENSRNOT00000011499
Ensembl Acc Id:
ENSRNOP00000082825 ⟸ ENSRNOT00000099673
Ensembl Acc Id:
ENSRNOP00000096174 ⟸ ENSRNOT00000108586
RGD ID: 13698645 Promoter ID: EPDNEW_R9169 Type: initiation region Name: Arpc3_1 Description: actin related protein 2/3 complex, subunit 3 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 12 39,667,791 - 39,667,851 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-04-30
Arpc3
actin related protein 2/3 complex, subunit 3
Arpc3_predicted
actin related protein 2/3 complex, subunit 3 (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Arpc3_predicted
actin related protein 2/3 complex, subunit 3 (predicted)
Symbol and Name status set to approved
70820 APPROVED
