Symbol:
Camkk2
Name:
calcium/calmodulin-dependent protein kinase kinase 2
RGD ID:
620092
Description:
Enables calcium/calmodulin-dependent protein kinase activity and calmodulin binding activity. Involved in activation of protein kinase activity. Predicted to be located in cytosol. Orthologous to human CAMKK2 (calcium/calmodulin dependent protein kinase kinase 2); PARTICIPATES IN adenosine monophosphate-activated protein kinase (AMPK) signaling pathway; vascular endothelial growth factor signaling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran; 3,5-dichloro-N-[[(2S)-1-ethyl-2-pyrrolidinyl]methyl]-2-hydroxy-6-methoxybenzamide.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
Ca+/Calmodulin-dependent protein kinase kinase beta (CaM-kinase kinase beta); calcium/calmodulin-dependent protein kinase 2 beta; calcium/calmodulin-dependent protein kinase kinase 2, beta; calcium/calmodulin-dependent protein kinase kinase beta; caM-kinase kinase 2; CaM-kinase kinase beta; caM-KK 2; caM-KK beta; caMKK 2; caMKK beta
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 39,451,828 - 39,505,719 (+) NCBI GRCr8 mRatBN7.2 12 33,791,023 - 33,845,000 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 33,791,052 - 33,843,279 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 12 34,968,796 - 35,019,553 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 12 35,580,228 - 35,630,988 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 12 34,632,361 - 34,683,280 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 12 39,253,409 - 39,302,601 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 39,253,409 - 39,302,601 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 12 41,155,785 - 41,191,356 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 12 34,907,317 - 34,938,479 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 12 34,635,881 - 34,801,867 (+) NCBI Celera 12 35,469,700 - 35,516,023 (+) NCBI Celera Cytogenetic Map 12 q16 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Camkk2 Rat 1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene multiple interactions ISO RGD:732643 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Camkk2 Rat 1,2-dimethylhydrazine increases expression ISO RGD:732643 6480464 1,2-Dimethylhydrazine results in increased expression of CAMKK2 mRNA CTD PMID:22206623 Camkk2 Rat 17alpha-ethynylestradiol increases expression ISO RGD:732643 6480464 Ethinyl Estradiol results in increased expression of CAMKK2 mRNA CTD PMID:17942748 Camkk2 Rat 17alpha-ethynylestradiol multiple interactions ISO RGD:732643 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of CAMKK2 mRNA CTD PMID:17942748 Camkk2 Rat 17beta-estradiol increases expression ISO RGD:737324 6480464 Estradiol results in increased expression of CAMKK2 mRNA CTD PMID:23019147|PMID:31614463 Camkk2 Rat 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one increases expression ISO RGD:737324 6480464 Metribolone results in increased expression of CAMKK2 mRNA CTD PMID:16751804 Camkk2 Rat 17beta-hydroxy-5alpha-androstan-3-one multiple interactions ISO RGD:737324 6480464 Dihydrotestosterone results in increased expression of and affects the localization of CAMKK2 protein CTD PMID:22654108 Camkk2 Rat 17beta-hydroxy-5alpha-androstan-3-one increases expression ISO RGD:737324 6480464 Dihydrotestosterone results in increased expression of CAMKK2 mRNA CTD PMID:22654108|PMID:29581250 Camkk2 Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO RGD:732643 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Camkk2 Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO RGD:732643 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Camkk2 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:732643 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of CAMKK2 mRNA CTD PMID:17942748 Camkk2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of CAMKK2 mRNA CTD PMID:33387578 Camkk2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:732643 6480464 Tetrachlorodibenzodioxin affects the expression of CAMKK2 mRNA CTD PMID:21570461|PMID:26377647 Camkk2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:732643 6480464 Tetrachlorodibenzodioxin results in increased expression of CAMKK2 mRNA CTD PMID:18796159 Camkk2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:732643 6480464 Tetrachlorodibenzodioxin results in decreased expression of CAMKK2 mRNA CTD PMID:19465110 Camkk2 Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2,3,7,8-tetrachlorodibenzofuran results in decreased expression of CAMKK2 mRNA CTD PMID:32109520 Camkk2 Rat 2,4,4'-trichlorobiphenyl multiple interactions ISO RGD:732643 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Camkk2 Rat 3,4-methylenedioxymethamphetamine increases expression ISO RGD:732643 6480464 N-Methyl-3,4-methylenedioxyamphetamine results in increased expression of CAMKK2 mRNA CTD PMID:26251327 Camkk2 Rat 3,4-methylenedioxymethamphetamine increases methylation ISO RGD:732643 6480464 N-Methyl-3,4-methylenedioxyamphetamine results in increased methylation of CAMKK2 promoter CTD PMID:26251327 Camkk2 Rat 3,5-dichloro-N-[[(2S)-1-ethyl-2-pyrrolidinyl]methyl]-2-hydroxy-6-methoxybenzamide decreases expression EXP 6480464 Raclopride results in decreased expression of CAMKK2 protein CTD PMID:19289156 Camkk2 Rat 3-chloropropane-1,2-diol increases expression ISO RGD:737324 6480464 alpha-Chlorohydrin results in increased expression of CAMKK2 protein CTD PMID:33651226 Camkk2 Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of CAMKK2 protein CTD PMID:33651226 Camkk2 Rat 3-chloropropane-1,2-diol multiple interactions ISO RGD:737324 6480464 4-phenylbutyric acid inhibits the reaction [alpha-Chlorohydrin results in increased expression of CAMKK2 protein] CTD PMID:33651226 Camkk2 Rat 4,4'-sulfonyldiphenol decreases expression ISO RGD:732643 6480464 bisphenol S results in decreased expression of CAMKK2 mRNA CTD PMID:39298647 Camkk2 Rat 4,4'-sulfonyldiphenol decreases methylation ISO RGD:732643 6480464 bisphenol S results in decreased methylation of CAMKK2 promoter CTD PMID:33297965 Camkk2 Rat 4,4'-sulfonyldiphenol increases methylation ISO RGD:732643 6480464 bisphenol S results in increased methylation of CAMKK2 exon CTD PMID:33297965 Camkk2 Rat 4-phenylbutyric acid multiple interactions ISO RGD:737324 6480464 4-phenylbutyric acid inhibits the reaction [alpha-Chlorohydrin results in increased expression of CAMKK2 protein] CTD PMID:33651226 Camkk2 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of CAMKK2 mRNA CTD PMID:24780913 Camkk2 Rat acrylamide decreases expression ISO RGD:737324 6480464 Acrylamide results in decreased expression of CAMKK2 mRNA CTD PMID:32763439 Camkk2 Rat aflatoxin B1 increases methylation ISO RGD:737324 6480464 Aflatoxin B1 results in increased methylation of CAMKK2 gene CTD PMID:27153756 Camkk2 Rat Ampullosporin multiple interactions EXP 6480464 [ampullosporin co-treated with Ketamine] results in increased expression of CAMKK2 mRNA CTD PMID:16635253 Camkk2 Rat arsane affects methylation ISO RGD:737324 6480464 Arsenic affects the methylation of CAMKK2 gene CTD PMID:25304211 Camkk2 Rat arsane multiple interactions ISO RGD:737324 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of CAMKK2 more ... CTD PMID:39836092 Camkk2 Rat arsenic atom affects methylation ISO RGD:737324 6480464 Arsenic affects the methylation of CAMKK2 gene CTD PMID:25304211 Camkk2 Rat arsenic atom multiple interactions ISO RGD:737324 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of CAMKK2 more ... CTD PMID:39836092 Camkk2 Rat arsenite(3-) affects expression ISO RGD:732643 6480464 arsenite affects the expression of CAMKK2 mRNA CTD PMID:33053406 Camkk2 Rat benzo[a]pyrene decreases expression ISO RGD:732643 6480464 Benzo(a)pyrene results in decreased expression of CAMKK2 mRNA CTD PMID:21715664 Camkk2 Rat benzo[a]pyrene affects methylation ISO RGD:737324 6480464 Benzo(a)pyrene affects the methylation of CAMKK2 5' UTR CTD PMID:27901495 Camkk2 Rat benzo[a]pyrene increases methylation ISO RGD:737324 6480464 Benzo(a)pyrene results in increased methylation of CAMKK2 exon CTD PMID:27901495 Camkk2 Rat benzo[a]pyrene multiple interactions ISO RGD:732643 6480464 Benzo(a)pyrene promotes the reaction [AHR protein binds to CAMKK2 promoter] CTD PMID:19654925 Camkk2 Rat Benzo[k]fluoranthene increases expression ISO RGD:732643 6480464 benzo(k)fluoranthene results in increased expression of CAMKK2 mRNA CTD PMID:26377693 Camkk2 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of CAMKK2 mRNA CTD PMID:25181051 Camkk2 Rat bisphenol A affects methylation ISO RGD:737324 6480464 bisphenol A affects the methylation of CAMKK2 gene CTD PMID:33391824 Camkk2 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of CAMKK2 gene CTD PMID:28505145 Camkk2 Rat cadmium atom multiple interactions ISO RGD:737324 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of CAMKK2 more ... CTD PMID:35301059 Camkk2 Rat cadmium dichloride decreases expression ISO RGD:737324 6480464 Cadmium Chloride results in decreased expression of CAMKK2 mRNA CTD PMID:25596134 Camkk2 Rat cadmium dichloride multiple interactions ISO RGD:737324 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of CAMKK2 more ... CTD PMID:35301059 Camkk2 Rat caffeine affects phosphorylation ISO RGD:737324 6480464 Caffeine affects the phosphorylation of CAMKK2 protein CTD PMID:35688186 Camkk2 Rat calcitriol multiple interactions ISO RGD:737324 6480464 CAMKK2 mutant form inhibits the reaction [Calcitriol affects the localization of CAMP protein] CTD PMID:19748465 Camkk2 Rat calcium atom multiple interactions ISO RGD:737324 6480464 CAMKK2 protein affects the reaction [[Calcium co-treated with Ionomycin] results in increased phosphorylation of AKT1 more ... CTD PMID:28634229 Camkk2 Rat calcium(0) multiple interactions ISO RGD:737324 6480464 CAMKK2 protein affects the reaction [[Calcium co-treated with Ionomycin] results in increased phosphorylation of AKT1 more ... CTD PMID:28634229 Camkk2 Rat carbon disulfide increases expression EXP 6480464 Carbon Disulfide results in increased expression of CAMKK2 protein CTD PMID:27530093 Camkk2 Rat carboplatin affects response to substance ISO RGD:737324 6480464 CAMKK2 protein affects the susceptibility to Carboplatin CTD PMID:28634229 Camkk2 Rat chloroacetaldehyde increases expression ISO RGD:737324 6480464 chloroacetaldehyde results in increased expression of CAMKK2 mRNA CTD PMID:25596134 Camkk2 Rat chloroprene decreases expression ISO RGD:732643 6480464 Chloroprene results in decreased expression of CAMKK2 mRNA CTD PMID:23125180 Camkk2 Rat chlorpyrifos decreases expression ISO RGD:732643 6480464 Chlorpyrifos results in decreased expression of CAMKK2 mRNA CTD PMID:37019170 Camkk2 Rat cidofovir anhydrous increases expression ISO RGD:737324 6480464 Cidofovir results in increased expression of CAMKK2 mRNA CTD PMID:25596134 Camkk2 Rat ciguatoxin CTX1B affects expression ISO RGD:732643 6480464 Ciguatoxins affects the expression of CAMKK2 mRNA CTD PMID:18353800 Camkk2 Rat cisplatin decreases expression ISO RGD:737324 6480464 Cisplatin results in decreased expression of CAMKK2 mRNA CTD PMID:27594783 Camkk2 Rat cisplatin increases expression ISO RGD:737324 6480464 Cisplatin results in increased expression of CAMKK2 mRNA CTD PMID:25596134 Camkk2 Rat clodronic acid increases expression ISO RGD:737324 6480464 Clodronic Acid results in increased expression of CAMKK2 mRNA CTD PMID:25596134 Camkk2 Rat clopidogrel multiple interactions ISO RGD:732643 6480464 clopidogrel inhibits the reaction [Lipopolysaccharides results in increased expression of CAMKK2 mRNA] CTD PMID:19172522 Camkk2 Rat clozapine decreases expression EXP 6480464 Clozapine results in decreased expression of CAMKK2 protein CTD PMID:19289156 Camkk2 Rat cobalt dichloride decreases expression ISO RGD:737324 6480464 cobaltous chloride results in decreased expression of CAMKK2 mRNA CTD PMID:19320972 Camkk2 Rat colforsin daropate hydrochloride increases expression ISO RGD:737324 6480464 Colforsin results in increased expression of CAMKK2 mRNA CTD PMID:16751804 Camkk2 Rat copper(II) sulfate decreases expression ISO RGD:737324 6480464 Copper Sulfate results in decreased expression of CAMKK2 mRNA CTD PMID:19549813 Camkk2 Rat coumarin increases phosphorylation ISO RGD:737324 6480464 coumarin results in increased phosphorylation of CAMKK2 protein CTD PMID:35688186 Camkk2 Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of CAMKK2 mRNA CTD PMID:26577399 Camkk2 Rat desipramine decreases expression ISO RGD:732643 6480464 Desipramine results in decreased expression of CAMKK2 mRNA CTD PMID:15555640 Camkk2 Rat dioxygen affects expression ISO RGD:737324 6480464 Oxygen deficiency affects the expression of CAMKK2 mRNA CTD PMID:25596134 Camkk2 Rat doxorubicin decreases expression ISO RGD:737324 6480464 Doxorubicin results in decreased expression of CAMKK2 mRNA CTD PMID:29803840 Camkk2 Rat ethanol affects splicing ISO RGD:732643 6480464 Ethanol affects the splicing of CAMKK2 mRNA CTD PMID:30319688 Camkk2 Rat ethyl methanesulfonate decreases expression ISO RGD:737324 6480464 Ethyl Methanesulfonate results in decreased expression of CAMKK2 mRNA CTD PMID:23649840 Camkk2 Rat fenvalerate increases expression EXP 6480464 fenvalerate results in increased expression of CAMKK2 mRNA CTD PMID:30307764 Camkk2 Rat FR900359 decreases phosphorylation ISO RGD:737324 6480464 FR900359 results in decreased phosphorylation of CAMKK2 protein CTD PMID:37730182 Camkk2 Rat genistein decreases expression ISO RGD:737324 6480464 Genistein results in decreased expression of CAMKK2 mRNA CTD PMID:15378649 Camkk2 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of CAMKK2 mRNA CTD PMID:33387578 Camkk2 Rat Geraniin increases expression ISO RGD:732643 6480464 Geraniin results in increased expression of CAMKK2 protein CTD PMID:36706894 Camkk2 Rat Geraniin multiple interactions ISO RGD:732643 6480464 STO 609 inhibits the reaction [Geraniin results in increased expression of CAMKK2 protein] CTD PMID:36706894 Camkk2 Rat haloperidol decreases expression EXP 6480464 Haloperidol results in decreased expression of CAMKK2 protein CTD PMID:19289156 Camkk2 Rat ifosfamide increases expression ISO RGD:737324 6480464 Ifosfamide results in increased expression of CAMKK2 mRNA CTD PMID:25596134 Camkk2 Rat imidacloprid decreases expression ISO RGD:732643 6480464 imidacloprid results in decreased expression of CAMKK2 protein CTD PMID:27960282 Camkk2 Rat imidacloprid multiple interactions ISO RGD:732643 6480464 Dietary Fats promotes the reaction [imidacloprid results in decreased expression of CAMKK2 protein] CTD PMID:27960282 Camkk2 Rat ionomycin multiple interactions ISO RGD:737324 6480464 CAMKK2 protein affects the reaction [[Calcium co-treated with Ionomycin] results in increased phosphorylation of AKT1 more ... CTD PMID:28634229 Camkk2 Rat isoflavones decreases expression ISO RGD:737324 6480464 Isoflavones results in decreased expression of CAMKK2 mRNA CTD PMID:17374662 Camkk2 Rat isoprenaline decreases phosphorylation EXP 6480464 Isoproterenol results in decreased phosphorylation of CAMKK2 protein CTD PMID:27491814 Camkk2 Rat ketamine multiple interactions EXP 6480464 [ampullosporin co-treated with Ketamine] results in increased expression of CAMKK2 mRNA CTD PMID:16635253 Camkk2 Rat lead diacetate multiple interactions ISO RGD:732643 6480464 [lead acetate results in increased abundance of Lead] which results in increased methylation of CAMKK2 more ... CTD PMID:33445541 Camkk2 Rat lead(0) multiple interactions ISO RGD:732643 6480464 [lead acetate results in increased abundance of Lead] which results in increased methylation of CAMKK2 more ... CTD PMID:33445541 Camkk2 Rat lipopolysaccharide multiple interactions ISO RGD:732643 6480464 clopidogrel inhibits the reaction [Lipopolysaccharides results in increased expression of CAMKK2 mRNA] CTD PMID:19172522 Camkk2 Rat lithium atom increases expression EXP 6480464 Lithium results in increased expression of CAMKK2 protein CTD PMID:19289156 Camkk2 Rat lithium hydride increases expression EXP 6480464 Lithium results in increased expression of CAMKK2 protein CTD PMID:19289156 Camkk2 Rat manganese(II) chloride increases expression ISO RGD:732643 6480464 manganese chloride results in increased expression of CAMKK2 mRNA CTD PMID:15295902 Camkk2 Rat methotrexate affects expression ISO RGD:732643 6480464 Methotrexate affects the expression of CAMKK2 mRNA CTD PMID:18502557 Camkk2 Rat methoxychlor increases methylation EXP 6480464 Methoxychlor results in increased methylation of CAMKK2 gene CTD PMID:23303685 Camkk2 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of CAMKK2 gene CTD PMID:35440735 Camkk2 Rat methyl methanesulfonate decreases expression ISO RGD:737324 6480464 Methyl Methanesulfonate results in decreased expression of CAMKK2 mRNA CTD PMID:23649840 Camkk2 Rat microcystin-LR multiple interactions ISO RGD:732643 6480464 CAMKK2 protein affects the reaction [cyanoginosin LR results in decreased expression of SQSTM1 protein]; CAMKK2 more ... CTD PMID:33290805 Camkk2 Rat microcystin-LR increases phosphorylation ISO RGD:732643 6480464 cyanoginosin LR results in increased phosphorylation of CAMKK2 protein CTD PMID:33290805 Camkk2 Rat okadaic acid decreases expression ISO RGD:737324 6480464 Okadaic Acid results in decreased expression of CAMKK2 mRNA CTD PMID:38832940 Camkk2 Rat ozone multiple interactions ISO RGD:737324 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of CAMKK2 mRNA CTD PMID:35430440 Camkk2 Rat paracetamol affects expression ISO RGD:732643 6480464 Acetaminophen affects the expression of CAMKK2 mRNA CTD PMID:17562736 Camkk2 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of CAMKK2 mRNA CTD PMID:33387578 Camkk2 Rat PCB138 multiple interactions ISO RGD:732643 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Camkk2 Rat phenobarbital multiple interactions ISO RGD:732643 6480464 NR1I3 protein affects the reaction [Phenobarbital results in decreased expression of CAMKK2 mRNA] CTD PMID:19482888 Camkk2 Rat phenobarbital decreases expression ISO RGD:732643 6480464 Phenobarbital results in decreased expression of CAMKK2 mRNA CTD PMID:19482888 Camkk2 Rat pirinixic acid multiple interactions ISO RGD:732643 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in more ... CTD PMID:19710929 Camkk2 Rat pirinixic acid increases expression ISO RGD:732643 6480464 pirinixic acid results in increased expression of CAMKK2 mRNA CTD PMID:18301758 Camkk2 Rat pregnenolone 16alpha-carbonitrile increases expression EXP 6480464 Pregnenolone Carbonitrile results in increased expression of CAMKK2 mRNA CTD PMID:19162173 Camkk2 Rat propiconazole decreases expression ISO RGD:732643 6480464 propiconazole results in decreased expression of CAMKK2 mRNA CTD PMID:21278054 Camkk2 Rat PX-866 affects response to substance ISO RGD:737324 6480464 CAMKK2 protein affects the susceptibility to PX-866 CTD PMID:28634229 Camkk2 Rat risperidone decreases expression EXP 6480464 Risperidone results in decreased expression of CAMKK2 protein CTD PMID:19289156 Camkk2 Rat rotenone affects expression ISO RGD:732643 6480464 Rotenone affects the expression of CAMKK2 mRNA CTD PMID:23186747 Camkk2 Rat scopolamine decreases expression EXP 6480464 Scopolamine results in decreased expression of CAMKK2 mRNA CTD PMID:17540011 Camkk2 Rat sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of CAMKK2 mRNA; sodium arsenite results in increased expression more ... CTD PMID:25089838 Camkk2 Rat sodium arsenite multiple interactions ISO RGD:737324 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of CAMKK2 more ... CTD PMID:39836092 Camkk2 Rat sodium arsenite decreases expression ISO RGD:737324 6480464 sodium arsenite results in decreased expression of CAMKK2 mRNA CTD PMID:38568856 Camkk2 Rat Soman decreases expression EXP 6480464 Soman results in decreased expression of CAMKK2 mRNA CTD PMID:19281266 Camkk2 Rat testosterone increases expression ISO RGD:737324 6480464 Testosterone results in increased expression of CAMKK2 mRNA CTD PMID:33359661 Camkk2 Rat tetrachloromethane decreases expression ISO RGD:732643 6480464 Carbon Tetrachloride results in decreased expression of CAMKK2 mRNA CTD PMID:17484886 Camkk2 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of CAMKK2 mRNA CTD PMID:34492290 Camkk2 Rat thiram decreases expression ISO RGD:737324 6480464 Thiram results in decreased expression of CAMKK2 mRNA CTD PMID:38568856 Camkk2 Rat titanium dioxide increases methylation ISO RGD:732643 6480464 titanium dioxide results in increased methylation of CAMKK2 gene CTD PMID:35295148 Camkk2 Rat titanium dioxide decreases methylation ISO RGD:732643 6480464 titanium dioxide results in decreased methylation of CAMKK2 promoter CTD PMID:35295148 Camkk2 Rat triphenyl phosphate affects expression ISO RGD:737324 6480464 triphenyl phosphate affects the expression of CAMKK2 mRNA CTD PMID:37042841 Camkk2 Rat trovafloxacin decreases expression ISO RGD:732643 6480464 trovafloxacin results in decreased expression of CAMKK2 mRNA CTD PMID:35537566 Camkk2 Rat valproic acid decreases expression ISO RGD:737324 6480464 Valproic Acid results in decreased expression of CAMKK2 mRNA CTD PMID:29154799 Camkk2 Rat valproic acid affects splicing EXP 6480464 Valproic Acid affects the splicing of CAMKK2 mRNA CTD PMID:29427782 Camkk2 Rat vanadium atom decreases expression ISO RGD:737324 6480464 Vanadium results in decreased expression of CAMKK2 mRNA CTD PMID:19000753 Camkk2 Rat vanadium(0) decreases expression ISO RGD:737324 6480464 Vanadium results in decreased expression of CAMKK2 mRNA CTD PMID:19000753 Camkk2 Rat zearalenone increases phosphorylation ISO RGD:732643 6480464 Zearalenone results in increased phosphorylation of CAMKK2 protein CTD PMID:31982503 Camkk2 Rat zearalenone multiple interactions ISO RGD:732643 6480464 2-aminoethyl diphenylborinate inhibits the reaction [Zearalenone results in increased phosphorylation of CAMKK2 protein]; STO 609 more ... CTD PMID:31982503
Imported Annotations - PID (archival)
1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one (ISO) 17beta-hydroxy-5alpha-androstan-3-one (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2,4,4'-trichlorobiphenyl (ISO) 3,4-methylenedioxymethamphetamine (ISO) 3,5-dichloro-N-[[(2S)-1-ethyl-2-pyrrolidinyl]methyl]-2-hydroxy-6-methoxybenzamide (EXP) 3-chloropropane-1,2-diol (EXP,ISO) 4,4'-sulfonyldiphenol (ISO) 4-phenylbutyric acid (ISO) 6-propyl-2-thiouracil (EXP) acrylamide (ISO) aflatoxin B1 (ISO) Ampullosporin (EXP) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) benzo[a]pyrene (ISO) Benzo[k]fluoranthene (ISO) bisphenol A (EXP,ISO) cadmium atom (ISO) cadmium dichloride (ISO) caffeine (ISO) calcitriol (ISO) calcium atom (ISO) calcium(0) (ISO) carbon disulfide (EXP) carboplatin (ISO) chloroacetaldehyde (ISO) chloroprene (ISO) chlorpyrifos (ISO) cidofovir anhydrous (ISO) ciguatoxin CTX1B (ISO) cisplatin (ISO) clodronic acid (ISO) clopidogrel (ISO) clozapine (EXP) cobalt dichloride (ISO) colforsin daropate hydrochloride (ISO) copper(II) sulfate (ISO) coumarin (ISO) Cuprizon (EXP) desipramine (ISO) dioxygen (ISO) doxorubicin (ISO) ethanol (ISO) ethyl methanesulfonate (ISO) fenvalerate (EXP) FR900359 (ISO) genistein (ISO) gentamycin (EXP) Geraniin (ISO) haloperidol (EXP) ifosfamide (ISO) imidacloprid (ISO) ionomycin (ISO) isoflavones (ISO) isoprenaline (EXP) ketamine (EXP) lead diacetate (ISO) lead(0) (ISO) lipopolysaccharide (ISO) lithium atom (EXP) lithium hydride (EXP) manganese(II) chloride (ISO) methotrexate (ISO) methoxychlor (EXP) methyl methanesulfonate (ISO) microcystin-LR (ISO) okadaic acid (ISO) ozone (ISO) paracetamol (EXP,ISO) PCB138 (ISO) phenobarbital (ISO) pirinixic acid (ISO) pregnenolone 16alpha-carbonitrile (EXP) propiconazole (ISO) PX-866 (ISO) risperidone (EXP) rotenone (ISO) scopolamine (EXP) sodium arsenite (EXP,ISO) Soman (EXP) testosterone (ISO) tetrachloromethane (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) triphenyl phosphate (ISO) trovafloxacin (ISO) valproic acid (EXP,ISO) vanadium atom (ISO) vanadium(0) (ISO) zearalenone (ISO)
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
Calmodulin-dependent protein kinase kinase-beta is an alternative upstream kinase for AMP-activated protein kinase.
Hawley SA, etal., Cell Metab. 2005 Jul;2(1):9-19.
3.
Molecular cloning of Ca2+/calmodulin-dependent protein kinase kinase beta.
Kitani T, etal., J Biochem (Tokyo) 1997 Jul;122(1):243-50.
4.
CAMKK2, Regulated by Promoter Methylation, is a Prognostic Marker in Diffuse Gliomas.
Liu DM, etal., CNS Neurosci Ther. 2016 Jun;22(6):518-24. doi: 10.1111/cns.12531. Epub 2016 Mar 25.
5.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
6.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
8.
GOA pipeline
RGD automated data pipeline
9.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
10.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
Camkk2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 39,451,828 - 39,505,719 (+) NCBI GRCr8 mRatBN7.2 12 33,791,023 - 33,845,000 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 33,791,052 - 33,843,279 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 12 34,968,796 - 35,019,553 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 12 35,580,228 - 35,630,988 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 12 34,632,361 - 34,683,280 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 12 39,253,409 - 39,302,601 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 39,253,409 - 39,302,601 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 12 41,155,785 - 41,191,356 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 12 34,907,317 - 34,938,479 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 12 34,635,881 - 34,801,867 (+) NCBI Celera 12 35,469,700 - 35,516,023 (+) NCBI Celera Cytogenetic Map 12 q16 NCBI
CAMKK2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 12 121,237,692 - 121,297,819 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 12 121,237,675 - 121,298,308 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 12 121,675,495 - 121,735,622 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 12 120,159,878 - 120,220,494 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 12 120,138,216 - 120,197,225 NCBI Celera 12 121,313,250 - 121,374,183 (-) NCBI Celera Cytogenetic Map 12 q24.31 NCBI HuRef 12 118,685,098 - 118,755,528 (-) NCBI HuRef CHM1_1 12 121,644,332 - 121,704,907 (-) NCBI CHM1_1 T2T-CHM13v2.0 12 121,228,458 - 121,289,212 (-) NCBI T2T-CHM13v2.0
Camkk2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 122,856,064 - 122,918,295 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 122,869,233 - 122,917,472 (-) Ensembl GRCm39 Ensembl GRCm38 5 122,718,380 - 122,779,522 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 122,731,170 - 122,779,409 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 123,183,197 - 123,214,303 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 122,993,805 - 123,024,911 (-) NCBI MGSCv36 mm8 Celera 5 119,811,042 - 119,842,555 (-) NCBI Celera Cytogenetic Map 5 F NCBI cM Map 5 62.55 NCBI
Camkk2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955482 7,000,010 - 7,029,623 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955482 7,000,010 - 7,029,623 (+) NCBI ChiLan1.0 ChiLan1.0
CAMKK2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 10 129,322,640 - 129,383,236 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 12 129,319,014 - 129,379,567 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 12 118,835,862 - 118,896,918 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 12 122,206,552 - 122,267,631 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 12 122,206,552 - 122,267,631 (-) Ensembl panpan1.1 panPan2
CAMKK2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 26 7,848,191 - 7,895,317 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 26 7,847,466 - 7,893,410 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 26 8,012,962 - 8,060,085 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 26 8,105,183 - 8,153,475 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 26 8,105,181 - 8,153,475 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 26 8,064,970 - 8,113,415 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 26 8,123,749 - 8,171,998 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 26 8,079,881 - 8,128,342 (+) NCBI UU_Cfam_GSD_1.0
Camkk2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405118 156,416,414 - 156,449,106 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936558 3,030,289 - 3,061,227 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936558 3,030,343 - 3,060,191 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
CAMKK2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 14 31,312,049 - 31,366,499 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 14 31,307,418 - 31,366,504 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 14 33,169,763 - 33,229,746 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
CAMKK2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 11 116,613,003 - 116,648,389 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 11 116,615,996 - 116,653,261 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666037 128,411,296 - 128,468,994 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Camkk2
.
Predicted Target Of
Count of predictions: 242 Count of miRNA genes: 155 Interacting mature miRNAs: 175 Transcripts: ENSRNOT00000001774 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
631560 Apr1 Acute phase response QTL 1 6.1 orosomucoid 1 amount (VT:0010541) plasma orosomucoid 1 level (CMO:0001467) 12 19144362 46669029 Rat 8552964 Pigfal17 Plasma insulin-like growth factor 1 level QTL 17 3.5 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564495 46669029 Rat 8693635 Alc28 Alcohol consumption QTL 28 2.7 0.439 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 12 23081340 44726024 Rat 61324 Eae5 Experimental allergic encephalomyelitis QTL 5 14 nervous system integrity trait (VT:0010566) percentage of study population developing relapsing-remitting experimental autoimmune encephalomyelitis during a period of time (CMO:0001402) 12 19610870 46669029 Rat 9590147 Scort7 Serum corticosterone level QTL 7 13.61 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 12 1 42110980 Rat 1549829 Scl48 Serum cholesterol level QTL 48 5 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 12 9603277 46669029 Rat 737822 Alc10 Alcohol consumption QTL 10 2.2 consumption behavior trait (VT:0002069) ethanol drink intake rate (CMO:0001407) 12 19610870 40218516 Rat 70169 Eae13 Experimental allergic encephalomyelitis QTL 13 0.032 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 12 24139202 36638073 Rat 1600386 Calcic2 Intracellular calcium level QTL 2 0.001 platelet physiology trait (VT:0005464) platelet intracellular calcium level (CMO:0000922) 12 28064433 46669029 Rat 1302792 Scl21 Serum cholesterol level QTL 21 3.8 0.0011 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 12 7196730 46669029 Rat 1556747 Calcic1 Intracellular calcium level QTL 1 3.6 platelet calcium amount (VT:0010500) platelet intracellular calcium level (CMO:0000922) 12 28064433 40130419 Rat 631829 Alc6 Alcohol consumption QTL 6 4.7 consumption behavior trait (VT:0002069) ethanol drink intake rate (CMO:0001407) 12 28607526 37691617 Rat 8693658 Alc33 Alcohol consumption QTL 33 2.1 0.68 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 12 23081340 43551788 Rat 1598855 Bp294 Blood pressure QTL 294 3.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 12 1 34851688 Rat 1331761 Bp218 Blood pressure QTL 218 2.973 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 12 11073825 45055165 Rat 8694179 Bw150 Body weight QTL 150 2.9 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 12 1 42110980 Rat 7411545 Bw128 Body weight QTL 128 5.2 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 12 1 42110980 Rat 7411547 Bw129 Body weight QTL 129 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 6 5564495 46669029 Rat 737979 Pia22 Pristane induced arthritis QTL 22 53.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 1 44465750 Rat 1298081 Cia25 Collagen induced arthritis QTL 25 4.7 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 19610889 35682913 Rat 2300186 Bmd59 Bone mineral density QTL 59 7.1 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 12 10474137 46669029 Rat 7411660 Foco28 Food consumption QTL 28 10.9 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 70213 Niddm27 Non-insulin dependent diabetes mellitus QTL 27 3.72 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 12 19835789 38193007 Rat 7411641 Foco19 Food consumption QTL 19 27.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 7411643 Foco20 Food consumption QTL 20 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 20328819 46669029 Rat 5684888 Pia42 Pristane induced arthritis QTL 42 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 19610870 42828880 Rat 1549912 Bp268 Blood pressure QTL 268 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 10 13182736 46669029 Rat 2302060 Pia37 Pristane induced arthritis QTL 37 6.1 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 12 13198157 46669029 Rat 1641928 Alcrsp5 Alcohol response QTL 5 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 12 12812385 46669029 Rat 1300162 Bp188 Blood pressure QTL 188 3.19 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 12 32103174 45899022 Rat 8552912 Pigfal6 Plasma insulin-like growth factor 1 level QTL 6 5 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564498 46669029 Rat 10059594 Kidm46 Kidney mass QTL 46 3.79 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 12 6107579 46669029 Rat 9590086 Insglur6 Insulin/glucose ratio QTL 6 18.97 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 12 1 42110980 Rat 8552918 Pigfal7 Plasma insulin-like growth factor 1 level QTL 7 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564495 46669029 Rat 1549902 Bp269 Blood pressure QTL 269 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 12 13182736 46669029 Rat 61404 Bw120 Body weight QTL 120 5.1 body mass (VT:0001259) body mass index (BMI) (CMO:0000105) 12 12351619 46669029 Rat 1300175 Cm5 Cardiac mass QTL 5 3.78 heart mass (VT:0007028) heart left ventricle weight to body weight ratio (CMO:0000530) 12 28064433 45899022 Rat 1331787 Rf41 Renal function QTL 41 2.998 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 12 28064557 40218380 Rat 2293699 Bss49 Bone structure and strength QTL 49 5.61 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra trabecular cross-sectional area (CMO:0001692) 12 10474137 46669029 Rat 634351 Apr5 Acute phase response QTL 5 6.7 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 12 1 44503507 Rat 634350 Apr4 Acute phase response QTL 4 6 orosomucoid 1 amount (VT:0010541) plasma orosomucoid 1 level (CMO:0001467) 12 1172005 46172005 Rat 7387292 Kidm42 Kidney mass QTL 42 3.03 0.0004 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 12 1 36247923 Rat 61421 Cia12 Collagen induced arthritis QTL 12 4.6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 13635523 35682913 Rat 2303569 Gluco44 Glucose level QTL 44 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 12 12812385 46669029 Rat 7411586 Foco5 Food consumption QTL 5 5.4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 2303575 Insul14 Insulin level QTL 14 4 blood insulin amount (VT:0001560) blood insulin level (CMO:0000349) 12 1 42450532 Rat 7411588 Foco6 Food consumption QTL 6 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 2302042 Pia38 Pristane induced arthritis QTL 38 3.5 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 12 1 44503507 Rat 7411595 Foco9 Food consumption QTL 9 4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 7411597 Foco10 Food consumption QTL 10 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 631543 Bp83 Blood pressure QTL 83 5.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 12 15550826 38478808 Rat
DXMgh7
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 X 112,124,540 - 112,124,758 (+) MAPPER mRatBN7.2 mRatBN7.2 12 33,819,167 - 33,819,400 (+) MAPPER mRatBN7.2 Rnor_6.0 12 39,282,339 - 39,282,571 NCBI Rnor6.0 Rnor_6.0 X 119,394,326 - 119,394,543 NCBI Rnor6.0 Rnor_5.0 12 41,171,094 - 41,171,326 UniSTS Rnor5.0 Rnor_5.0 X 119,539,148 - 119,539,365 UniSTS Rnor5.0 RGSC_v3.4 12 34,918,461 - 34,918,693 UniSTS RGSC3.4 Celera 12 35,496,132 - 35,496,364 UniSTS Celera X 111,378,557 - 111,378,785 UniSTS SHRSP x BN Map X 33.1599 RGD SHRSP x BN Map X 33.1599 UniSTS FHH x ACI Map X 34.6 RGD Cytogenetic Map X q34 UniSTS Cytogenetic Map 12 q16 UniSTS
RH144353
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 33,793,171 - 33,793,286 (+) MAPPER mRatBN7.2 Rnor_6.0 12 39,255,495 - 39,255,609 NCBI Rnor6.0 Rnor_5.0 12 41,145,422 - 41,145,536 UniSTS Rnor5.0 RGSC_v3.4 12 34,895,902 - 34,896,016 UniSTS RGSC3.4 Celera 12 35,471,782 - 35,471,896 UniSTS RH 3.4 Map 12 598.7 UniSTS Cytogenetic Map 12 q16 UniSTS
BE106902
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 33,839,020 - 33,839,182 (+) MAPPER mRatBN7.2 Rnor_6.0 12 39,302,433 - 39,302,594 NCBI Rnor6.0 Rnor_5.0 12 41,191,188 - 41,191,349 UniSTS Rnor5.0 RGSC_v3.4 12 34,938,311 - 34,938,472 UniSTS RGSC3.4 Celera 12 35,515,855 - 35,516,016 UniSTS RH 3.4 Map 12 603.0 UniSTS Cytogenetic Map 12 q16 UniSTS
BE116442
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 33,834,935 - 33,835,110 (+) MAPPER mRatBN7.2 Rnor_6.0 12 39,298,347 - 39,298,521 NCBI Rnor6.0 Rnor_5.0 12 41,187,102 - 41,187,276 UniSTS Rnor5.0 RGSC_v3.4 12 34,934,226 - 34,934,400 UniSTS RGSC3.4 Celera 12 35,511,770 - 35,511,944 UniSTS RH 3.4 Map 12 597.2 UniSTS Cytogenetic Map 12 q16 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000001774 ⟹ ENSRNOP00000001774
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 33,791,090 - 33,839,189 (+) Ensembl Rnor_6.0 Ensembl 12 39,253,409 - 39,302,601 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000097411 ⟹ ENSRNOP00000081396
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 33,791,052 - 33,843,279 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000109897 ⟹ ENSRNOP00000093619
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 33,791,052 - 33,841,835 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000117141 ⟹ ENSRNOP00000085154
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 33,791,090 - 33,839,189 (+) Ensembl
RefSeq Acc Id:
NM_001395661 ⟹ NP_001382590
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 39,451,896 - 39,475,937 (+) NCBI mRatBN7.2 12 33,791,090 - 33,815,106 (+) NCBI
RefSeq Acc Id:
NM_031338 ⟹ NP_112628
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 39,451,896 - 39,502,653 (+) NCBI mRatBN7.2 12 33,791,090 - 33,841,826 (+) NCBI Rnor_6.0 12 39,253,409 - 39,302,601 (+) NCBI Rnor_5.0 12 41,155,785 - 41,191,356 (+) NCBI RGSC_v3.4 12 34,907,317 - 34,938,479 (+) RGD Celera 12 35,469,700 - 35,516,023 (+) RGD
Sequence:
CCGGACCGAGTCGAGCCGAGCCAAGCCGAGCCGGGGGCGCAGAGCGCGGGAGGCGGCGGCGCGGAGCCCAGGCAGCTCTACTGCTGATGGAAGTGCTCCGGCCTGGCCGATGAAGTTGGTACACACAC
hide sequence
RefSeq Acc Id:
XM_039089810 ⟹ XP_038945738
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 39,452,121 - 39,502,575 (+) NCBI mRatBN7.2 12 33,791,260 - 33,841,748 (+) NCBI
RefSeq Acc Id:
XM_039089811 ⟹ XP_038945739
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 39,451,828 - 39,502,575 (+) NCBI mRatBN7.2 12 33,791,023 - 33,841,748 (+) NCBI
RefSeq Acc Id:
XM_039089812 ⟹ XP_038945740
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 39,451,828 - 39,502,575 (+) NCBI mRatBN7.2 12 33,791,023 - 33,841,748 (+) NCBI
RefSeq Acc Id:
XM_039089813 ⟹ XP_038945741
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 39,451,828 - 39,502,575 (+) NCBI mRatBN7.2 12 33,791,023 - 33,841,748 (+) NCBI
RefSeq Acc Id:
XM_039089814 ⟹ XP_038945742
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 39,451,828 - 39,505,719 (+) NCBI mRatBN7.2 12 33,791,023 - 33,845,000 (+) NCBI
RefSeq Acc Id:
XM_039089815 ⟹ XP_038945743
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 39,451,828 - 39,502,575 (+) NCBI mRatBN7.2 12 33,791,023 - 33,841,748 (+) NCBI
RefSeq Acc Id:
XM_039089816 ⟹ XP_038945744
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 39,451,828 - 39,505,719 (+) NCBI mRatBN7.2 12 33,791,023 - 33,845,000 (+) NCBI
RefSeq Acc Id:
XM_039089817 ⟹ XP_038945745
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 39,465,070 - 39,502,575 (+) NCBI mRatBN7.2 12 33,804,231 - 33,841,748 (+) NCBI
RefSeq Acc Id:
NP_112628 ⟸ NM_031338
- Peptide Label:
isoform 1
- UniProtKB:
O88831 (UniProtKB/Swiss-Prot)
- Sequence:
MSSCVSSQPTSDRAAPQDELGSGGVSRESQKPCEALRGLSSLSIHLGMESFIVVTECEPGRGVDLSLARDQPLEADGQELPLDASEPESRSLLSGGKMSLQERSQGGPASSSSLDMNGRCICPSLSYS
hide sequence
Ensembl Acc Id:
ENSRNOP00000001774 ⟸ ENSRNOT00000001774
RefSeq Acc Id:
XP_038945742 ⟸ XM_039089814
- Peptide Label:
isoform X5
- UniProtKB:
O88831 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_038945744 ⟸ XM_039089816
- Peptide Label:
isoform X7
- UniProtKB:
O88831 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_038945740 ⟸ XM_039089812
- Peptide Label:
isoform X3
- UniProtKB:
O88831 (UniProtKB/Swiss-Prot), A0A8I6GKR3 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038945741 ⟸ XM_039089813
- Peptide Label:
isoform X4
- UniProtKB:
O88831 (UniProtKB/Swiss-Prot), A0A8I5ZSP8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038945739 ⟸ XM_039089811
- Peptide Label:
isoform X2
- UniProtKB:
O88831 (UniProtKB/Swiss-Prot), F1LPT4 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038945743 ⟸ XM_039089815
- Peptide Label:
isoform X6
- UniProtKB:
O88831 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_038945738 ⟸ XM_039089810
- Peptide Label:
isoform X1
- UniProtKB:
O88831 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_038945745 ⟸ XM_039089817
- Peptide Label:
isoform X8
- UniProtKB:
A6J176 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000085154 ⟸ ENSRNOT00000117141
Ensembl Acc Id:
ENSRNOP00000081396 ⟸ ENSRNOT00000097411
Ensembl Acc Id:
ENSRNOP00000093619 ⟸ ENSRNOT00000109897
RefSeq Acc Id:
NP_001382590 ⟸ NM_001395661
- Peptide Label:
isoform 2
RGD ID: 13698640 Promoter ID: EPDNEW_R9163 Type: multiple initiation site Name: Camkk2_1 Description: calcium/calmodulin-dependent protein kinase kinase 2 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 12 39,253,421 - 39,253,481 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-03-15
Camkk2
calcium/calmodulin-dependent protein kinase kinase 2
Camkk2
calcium/calmodulin-dependent protein kinase kinase 2, beta
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2004-09-10
Camkk2
calcium/calmodulin-dependent protein kinase kinase 2, beta
Ca+/Calmodulin-dependent protein kinase kinase beta (CaM-kinase kinase beta)
Name updated
1299863 APPROVED
2002-08-07
Camkk2
Ca+/Calmodulin-dependent protein kinase kinase beta (CaM-kinase kinase beta)
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_process
activates calmodulin-dependent protein kinase IV
632354
