Symbol:
Cacna1a
Name:
calcium voltage-gated channel subunit alpha1 A
RGD ID:
2244
Description:
Enables calmodulin binding activity and high voltage-gated calcium channel activity. Involved in calcium ion import; chemical synaptic transmission; and regulation of voltage-gated calcium channel activity. Located in perikaryon. Part of voltage-gated calcium channel complex. Is active in calyx of Held and presynaptic active zone membrane. Used to study childhood absence epilepsy. Biomarker of temporal lobe epilepsy. Human ortholog(s) of this gene implicated in brain disease (multiple) and episodic ataxia type 2. Orthologous to human CACNA1A (calcium voltage-gated channel subunit alpha1 A); PARTICIPATES IN alfentanil pharmacodynamics pathway; bupivacaine pharmacodynamics pathway; buprenorphine pharmacodynamics pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; acrylamide.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
BccA1; BI; brain calcium channel 1; brain calcium channel I; brain class A; Calcium channel alpha 1A; calcium channel, L type, alpha-1 polypeptide; calcium channel, L type, alpha-1 polypeptide, isoform 4; calcium channel, voltage-dependent, alpha 1A subunit; calcium channel, voltage-dependent, P/Q type, alpha 1A subunit; Cav2.1; LOC688360; rbA-1; RBA-I; similar to Voltage-dependent P/Q-type calcium channel alpha-1A subunit (Voltage-gated calcium channel alpha subunit Cav2.1) (Calcium channel, L type, alpha-1 polypeptide isoform 4) (Brain calcium channel I) (BI); voltage-dependent P/Q-type calcium channel subunit alpha-1A; voltage-gated calcium channel subunit alpha Cav2.1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
CACNA1A (calcium voltage-gated channel subunit alpha1 A) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, Panther
Mus musculus (house mouse):
Cacna1a (calcium channel, voltage-dependent, P/Q type, alpha 1A subunit) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Cacna1a (calcium voltage-gated channel subunit alpha1 A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
CACNA1A (calcium voltage-gated channel subunit alpha1 A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
CACNA1A (calcium voltage-gated channel subunit alpha1 A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
LOC101960999 (voltage-dependent P/Q-type calcium channel subunit alpha-1A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
CACNA1A (calcium voltage-gated channel subunit alpha1 A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
CACNA1A (calcium voltage-gated channel subunit alpha1 A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Cacna1a (calcium voltage-gated channel subunit alpha1 A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Cacna1a (calcium channel, voltage-dependent, P/Q type, alpha 1A subunit)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
CACNA1A (calcium voltage-gated channel subunit alpha1 A)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
cacna1aa (calcium channel, voltage-dependent, P/Q type, alpha 1A subunit, a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
cacna1ab (calcium channel, voltage-dependent, P/Q type, alpha 1A subunit, b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
CCH1
Alliance
DIOPT (Hieranoid|InParanoid|OrthoFinder|PANTHER)
Drosophila melanogaster (fruit fly):
cac
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
unc-2
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
cacna1a
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Allele / Splice:
Cacna1agry
Is Marker For:
Strains:
WTC.GRY-Cacna1agry /Kyo
F344-Cacna1agry Scn1am1Kyo /Okym
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 19 40,425,560 - 40,724,810 (-) NCBI GRCr8 mRatBN7.2 19 23,520,741 - 23,819,971 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 19 23,520,741 - 23,823,225 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 19 30,343,968 - 30,567,151 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 19 30,998,339 - 31,221,535 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 19 33,221,032 - 33,444,209 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 19 25,453,236 - 25,749,550 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 19 25,526,751 - 25,749,550 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 19 36,502,533 - 36,727,039 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 19 25,188,170 - 25,424,495 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 19 25,194,294 - 25,429,321 (-) NCBI Celera 19 23,074,249 - 23,295,970 (-) NCBI Celera Cytogenetic Map 19 q11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Cacna1a Rat (+)-pilocarpine decreases expression ISO Cacna1a (Mus musculus) 6480464 Pilocarpine results in decreased expression of CACNA1A protein CTD PMID:17265461 Cacna1a Rat (+)-pilocarpine increases expression ISO Cacna1a (Mus musculus) 6480464 Pilocarpine results in increased expression of CACNA1A protein CTD PMID:17265461 Cacna1a Rat 1,2-dimethylhydrazine decreases expression ISO Cacna1a (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of CACNA1A mRNA CTD PMID:22206623 Cacna1a Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Cacna1a (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of CACNA1A mRNA CTD PMID:21570461 Cacna1a Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of CACNA1A mRNA CTD PMID:34747641 Cacna1a Rat 2-palmitoylglycerol increases expression ISO CACNA1A (Homo sapiens) 6480464 2-palmitoylglycerol results in increased expression of CACNA1A mRNA CTD PMID:37199045 Cacna1a Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO Cacna1a (Mus musculus) 6480464 tetrabromobisphenol A results in decreased expression of CACNA1A mRNA CTD PMID:25172293 Cacna1a Rat 4,4'-sulfonyldiphenol affects methylation ISO Cacna1a (Mus musculus) 6480464 bisphenol S affects the methylation of CACNA1A gene CTD PMID:31683443 Cacna1a Rat 4-hydroxynon-2-enal increases expression ISO Cacna1a (Mus musculus) 6480464 4-hydroxy-2-nonenal results in increased expression of CACNA1A mRNA CTD PMID:19191707 Cacna1a Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of CACNA1A mRNA CTD PMID:24780913 Cacna1a Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of CACNA1A mRNA CTD PMID:28959563 Cacna1a Rat aflatoxin B1 increases methylation ISO CACNA1A (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of CACNA1A intron CTD PMID:30157460 Cacna1a Rat all-trans-retinoic acid decreases expression ISO Cacna1a (Mus musculus) 6480464 Tretinoin results in decreased expression of CACNA1A mRNA CTD PMID:16604517 Cacna1a Rat all-trans-retinoic acid decreases expression ISO CACNA1A (Homo sapiens) 6480464 Tretinoin results in decreased expression of CACNA1A mRNA CTD PMID:21934132 Cacna1a Rat allethrin multiple interactions EXP 6480464 Allethrins inhibits the reaction [CACNA1A protein results in increased transport of Calcium] CTD PMID:14634047 Cacna1a Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of CACNA1A mRNA CTD PMID:16483693 Cacna1a Rat antirheumatic drug increases expression ISO CACNA1A (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of CACNA1A mRNA CTD PMID:24449571 Cacna1a Rat arsenite(3-) multiple interactions ISO CACNA1A (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to CACNA1A mRNA] CTD PMID:32406909 Cacna1a Rat arsenous acid decreases expression ISO Cacna1a (Mus musculus) 6480464 Arsenic Trioxide results in decreased expression of CACNA1A mRNA CTD PMID:24831965 Cacna1a Rat aspartame multiple interactions ISO Cacna1a (Mus musculus) 6480464 [Fats more ... CTD PMID:23783067 Cacna1a Rat barium(0) increases transport EXP 6480464 CACNA1A protein results in increased transport of Barium CTD PMID:11313431 Cacna1a Rat benzo[a]pyrene increases mutagenesis ISO CACNA1A (Homo sapiens) 6480464 Benzo(a)pyrene results in increased mutagenesis of CACNA1A gene CTD PMID:25435355 Cacna1a Rat benzo[a]pyrene increases methylation ISO CACNA1A (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of CACNA1A promoter CTD PMID:27901495 Cacna1a Rat benzo[a]pyrene decreases methylation ISO CACNA1A (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of CACNA1A exon CTD PMID:27901495 Cacna1a Rat benzo[a]pyrene affects methylation ISO CACNA1A (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of CACNA1A intron CTD PMID:30157460 Cacna1a Rat benzo[a]pyrene multiple interactions ISO Cacna1a (Mus musculus) 6480464 AHR protein affects the reaction [Benzo(a)pyrene affects the expression of CACNA1A mRNA] CTD PMID:22228805 Cacna1a Rat benzo[a]pyrene decreases expression ISO Cacna1a (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of CACNA1A mRNA CTD PMID:22228805 Cacna1a Rat bis(2-ethylhexyl) phthalate multiple interactions EXP 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with vinclozolin co-treated with prochloraz co-treated with procymidone co-treated with Linuron co-treated with epoxiconazole co-treated with Dichlorodiphenyl Dichloroethylene] results in increased expression of CACNA1A mRNA CTD PMID:25607892 Cacna1a Rat bisphenol A decreases expression ISO CACNA1A (Homo sapiens) 6480464 bisphenol A results in decreased expression of CACNA1A mRNA CTD PMID:25047013 Cacna1a Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of CACNA1A mRNA CTD PMID:25181051 Cacna1a Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with enzacamene co-treated with octylmethoxycinnamate co-treated with butylparaben] results in increased expression of CACNA1A mRNA CTD PMID:25607892 Cacna1a Rat bisphenol F decreases expression EXP 6480464 4 and 4'-bisphenol F results in decreased expression of CACNA1A mRNA CTD PMID:26186136 Cacna1a Rat bisphenol F decreases expression ISO Cacna1a (Mus musculus) 6480464 bisphenol F results in decreased expression of CACNA1A mRNA CTD PMID:38685157 Cacna1a Rat Butylparaben multiple interactions EXP 6480464 [bisphenol A co-treated with enzacamene co-treated with octylmethoxycinnamate co-treated with butylparaben] results in increased expression of CACNA1A mRNA CTD PMID:25607892 Cacna1a Rat cadmium dichloride increases expression ISO CACNA1A (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of CACNA1A mRNA CTD PMID:38568856 Cacna1a Rat calcium atom increases transport EXP 6480464 CACNA1A protein results in increased transport of Calcium CTD PMID:14634047 Cacna1a Rat calcium atom multiple interactions EXP 6480464 Allethrins inhibits the reaction [CACNA1A protein results in increased transport of Calcium] CTD PMID:14634047 Cacna1a Rat calcium(0) increases transport EXP 6480464 CACNA1A protein results in increased transport of Calcium CTD PMID:14634047 Cacna1a Rat calcium(0) multiple interactions EXP 6480464 Allethrins inhibits the reaction [CACNA1A protein results in increased transport of Calcium] CTD PMID:14634047 Cacna1a Rat cannabidiol affects methylation EXP 6480464 Cannabidiol affects the methylation of CACNA1A gene CTD PMID:30521419 Cacna1a Rat carbamazepine affects expression ISO CACNA1A (Homo sapiens) 6480464 Carbamazepine affects the expression of CACNA1A mRNA CTD PMID:25979313 Cacna1a Rat CGP 52608 multiple interactions ISO CACNA1A (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to CACNA1A gene] CTD PMID:28238834 Cacna1a Rat choline multiple interactions ISO Cacna1a (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of CACNA1A gene CTD PMID:20938992 Cacna1a Rat cisplatin increases expression ISO Cacna1a (Mus musculus) 6480464 Cisplatin results in increased expression of CACNA1A mRNA CTD PMID:21151649 Cacna1a Rat clofibrate increases expression ISO Cacna1a (Mus musculus) 6480464 Clofibrate results in increased expression of CACNA1A mRNA CTD PMID:17585979 Cacna1a Rat clozapine decreases expression ISO Cacna1a (Mus musculus) 6480464 Clozapine results in decreased expression of CACNA1A mRNA CTD PMID:14647396 Cacna1a Rat clozapine decreases expression EXP 6480464 Clozapine results in decreased expression of CACNA1A mRNA CTD PMID:16715494 Cacna1a Rat copper atom multiple interactions ISO CACNA1A (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in increased expression of CACNA1A mRNA CTD PMID:20971185 Cacna1a Rat copper(0) multiple interactions ISO CACNA1A (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in increased expression of CACNA1A mRNA CTD PMID:20971185 Cacna1a Rat coumarin increases phosphorylation ISO CACNA1A (Homo sapiens) 6480464 coumarin results in increased phosphorylation of CACNA1A protein CTD PMID:35688186 Cacna1a Rat cypermethrin decreases expression ISO CACNA1A (Homo sapiens) 6480464 cypermethrin results in decreased expression of CACNA1A protein CTD PMID:36063984 Cacna1a Rat DDE multiple interactions EXP 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with vinclozolin co-treated with prochloraz co-treated with procymidone co-treated with Linuron co-treated with epoxiconazole co-treated with Dichlorodiphenyl Dichloroethylene] results in increased expression of CACNA1A mRNA CTD PMID:25607892 Cacna1a Rat DDT increases methylation EXP 6480464 DDT results in increased methylation of CACNA1A gene CTD PMID:31682807 Cacna1a Rat diarsenic trioxide decreases expression ISO Cacna1a (Mus musculus) 6480464 Arsenic Trioxide results in decreased expression of CACNA1A mRNA CTD PMID:24831965 Cacna1a Rat dibutyl phthalate increases expression ISO Cacna1a (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of CACNA1A mRNA CTD PMID:21266533 Cacna1a Rat dibutyl phthalate multiple interactions EXP 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with vinclozolin co-treated with prochloraz co-treated with procymidone co-treated with Linuron co-treated with epoxiconazole co-treated with Dichlorodiphenyl Dichloroethylene] results in increased expression of CACNA1A mRNA CTD PMID:25607892 Cacna1a Rat dichlorine multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] results in increased expression of CACNA1A mRNA CTD PMID:18636392 Cacna1a Rat dorsomorphin multiple interactions ISO CACNA1A (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Cacna1a Rat entinostat increases expression ISO CACNA1A (Homo sapiens) 6480464 entinostat results in increased expression of CACNA1A mRNA CTD PMID:27188386 Cacna1a Rat enzacamene multiple interactions EXP 6480464 [bisphenol A co-treated with enzacamene co-treated with octylmethoxycinnamate co-treated with butylparaben] results in increased expression of CACNA1A mRNA CTD PMID:25607892 Cacna1a Rat epoxiconazole multiple interactions EXP 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with vinclozolin co-treated with prochloraz co-treated with procymidone co-treated with Linuron co-treated with epoxiconazole co-treated with Dichlorodiphenyl Dichloroethylene] results in increased expression of CACNA1A mRNA CTD PMID:25607892 Cacna1a Rat ethanol multiple interactions ISO Cacna1a (Mus musculus) 6480464 Ethanol affects the expression of and affects the splicing of CACNA1A mRNA CTD PMID:30319688 Cacna1a Rat ethanol increases expression ISO Cacna1a (Mus musculus) 6480464 Ethanol results in increased expression of CACNA1A mRNA CTD PMID:30319688 Cacna1a Rat fenvalerate increases expression EXP 6480464 fenvalerate results in increased expression of CACNA1A mRNA CTD PMID:30307764 Cacna1a Rat folic acid multiple interactions ISO Cacna1a (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of CACNA1A gene CTD PMID:20938992 Cacna1a Rat folic acid decreases expression ISO Cacna1a (Mus musculus) 6480464 Folic Acid results in decreased expression of CACNA1A mRNA CTD PMID:25629700 Cacna1a Rat folic acid increases expression ISO Cacna1a (Mus musculus) 6480464 Folic Acid results in increased expression of CACNA1A mRNA CTD PMID:25006883 Cacna1a Rat gabapentin decreases activity EXP 6480464 gabapentin results in decreased activity of CACNA1A protein CTD PMID:12770949 Cacna1a Rat gabapentin multiple interactions ISO Cacna1a (Mus musculus) 6480464 gabapentin promotes the reaction [[omega-Agatoxin IVA results in decreased activity of CACNA1A protein] which results in decreased susceptibility to Potassium Chloride] CTD PMID:12817894 Cacna1a Rat gamma-aminobutyric acid decreases expression EXP 6480464 gamma-Aminobutyric Acid results in decreased expression of CACNA1A mRNA CTD PMID:26924987 Cacna1a Rat glyphosate affects methylation EXP 6480464 Glyphosate affects the methylation of CACNA1A gene CTD PMID:35440735 Cacna1a Rat haloperidol decreases expression EXP 6480464 Haloperidol results in decreased expression of CACNA1A mRNA CTD PMID:16715494 Cacna1a Rat haloperidol decreases expression ISO Cacna1a (Mus musculus) 6480464 Haloperidol results in decreased expression of CACNA1A mRNA CTD PMID:14647396 Cacna1a Rat L-methionine multiple interactions ISO Cacna1a (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of CACNA1A gene CTD PMID:20938992 Cacna1a Rat linuron multiple interactions EXP 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with vinclozolin co-treated with prochloraz co-treated with procymidone co-treated with Linuron co-treated with epoxiconazole co-treated with Dichlorodiphenyl Dichloroethylene] results in increased expression of CACNA1A mRNA CTD PMID:25607892 Cacna1a Rat methotrexate increases expression ISO CACNA1A (Homo sapiens) 6480464 Methotrexate results in increased expression of CACNA1A mRNA CTD PMID:24449571 Cacna1a Rat methoxychlor increases methylation EXP 6480464 Methoxychlor results in increased methylation of CACNA1A gene CTD PMID:23303685 Cacna1a Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of CACNA1A gene CTD PMID:35440735 Cacna1a Rat mono(2-ethylhexyl) phthalate decreases expression ISO CACNA1A (Homo sapiens) 6480464 mono-(2-ethylhexyl)phthalate results in decreased expression of CACNA1A mRNA CTD PMID:36314267 Cacna1a Rat monosodium L-glutamate multiple interactions ISO Cacna1a (Mus musculus) 6480464 [Fats more ... CTD PMID:23783067 Cacna1a Rat N,N-diethyl-m-toluamide multiple interactions EXP 6480464 [Permethrin co-treated with DEET] affects the methylation of CACNA1A gene CTD PMID:33148267 Cacna1a Rat N-ethyl-N-nitrosourea increases mutagenesis ISO Cacna1a (Mus musculus) 6480464 Ethylnitrosourea results in increased mutagenesis of CACNA1A exon and Ethylnitrosourea results in increased mutagenesis of CACNA1A gene CTD PMID:16724327 and PMID:17376154 Cacna1a Rat N-methyl-D-aspartic acid multiple interactions ISO Cacna1a (Mus musculus) 6480464 N-Methylaspartate inhibits the reaction [gelsenicine results in increased phosphorylation of CACNA1A protein] CTD PMID:34389372 Cacna1a Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with caffeic acid phenethyl ester] results in decreased expression of CACNA1A mRNA CTD PMID:20360939 Cacna1a Rat nitric oxide multiple interactions EXP 6480464 CACNA1A protein affects the reaction [Potassium Chloride results in increased abundance of Nitric Oxide] CTD PMID:12770949 Cacna1a Rat Nor-9-carboxy-delta9-THC multiple interactions ISO CACNA1A (Homo sapiens) 6480464 [Cannabinoids results in increased abundance of 11-nor-delta(9)-tetrahydrocannabinol-9-carboxylic acid] which affects the methylation of CACNA1A gene CTD PMID:30521419 Cacna1a Rat ozone multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] results in increased expression of CACNA1A mRNA CTD PMID:18636392 Cacna1a Rat ozone multiple interactions ISO Cacna1a (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of CACNA1A mRNA CTD PMID:34911549 Cacna1a Rat perfluorohexanesulfonic acid decreases expression ISO Cacna1a (Mus musculus) 6480464 perfluorohexanesulfonic acid results in decreased expression of CACNA1A mRNA CTD PMID:37995155 Cacna1a Rat perfluorooctane-1-sulfonic acid increases expression ISO Cacna1a (Mus musculus) 6480464 perfluorooctane sulfonic acid results in increased expression of CACNA1A mRNA CTD PMID:26300304 Cacna1a Rat permethrin multiple interactions EXP 6480464 [Permethrin co-treated with DEET] affects the methylation of CACNA1A gene CTD PMID:33148267 Cacna1a Rat phenethyl caffeate multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with caffeic acid phenethyl ester] results in decreased expression of CACNA1A mRNA CTD PMID:20360939 Cacna1a Rat phenylmercury acetate multiple interactions ISO CACNA1A (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of CACNA1A mRNA CTD PMID:27188386 Cacna1a Rat pirinixic acid multiple interactions ISO Cacna1a (Mus musculus) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in increased expression of CACNA1A mRNA CTD PMID:19710929 Cacna1a Rat potassium chloride multiple interactions ISO Cacna1a (Mus musculus) 6480464 [omega-Agatoxin IVA results in decreased activity of CACNA1A protein] which results in decreased susceptibility to Potassium Chloride and gabapentin promotes the reaction [[omega-Agatoxin IVA results in decreased activity of CACNA1A protein] which results in decreased susceptibility to Potassium Chloride] CTD PMID:12817894 Cacna1a Rat potassium chloride multiple interactions EXP 6480464 CACNA1A protein affects the reaction [Potassium Chloride results in increased abundance of Nitric Oxide] CTD PMID:12770949 Cacna1a Rat prochloraz multiple interactions EXP 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with vinclozolin co-treated with prochloraz co-treated with procymidone co-treated with Linuron co-treated with epoxiconazole co-treated with Dichlorodiphenyl Dichloroethylene] results in increased expression of CACNA1A mRNA CTD PMID:25607892 Cacna1a Rat procymidone multiple interactions EXP 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with vinclozolin co-treated with prochloraz co-treated with procymidone co-treated with Linuron co-treated with epoxiconazole co-treated with Dichlorodiphenyl Dichloroethylene] results in increased expression of CACNA1A mRNA CTD PMID:25607892 Cacna1a Rat rotenone decreases expression ISO CACNA1A (Homo sapiens) 6480464 Rotenone results in decreased expression of CACNA1A mRNA CTD PMID:33512557 Cacna1a Rat sarin decreases expression EXP 6480464 Sarin results in decreased expression of CACNA1A mRNA CTD PMID:16733813 Cacna1a Rat SB 431542 multiple interactions ISO CACNA1A (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Cacna1a Rat silver atom decreases expression EXP 6480464 Silver analog results in decreased expression of CACNA1A mRNA and Silver analog results in decreased expression of CACNA1A protein CTD PMID:26068065 Cacna1a Rat silver(0) decreases expression EXP 6480464 Silver analog results in decreased expression of CACNA1A mRNA and Silver analog results in decreased expression of CACNA1A protein CTD PMID:26068065 Cacna1a Rat sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of CACNA1A mRNA CTD PMID:21297353 and PMID:35314868 Cacna1a Rat sodium arsenite increases expression ISO Cacna1a (Mus musculus) 6480464 sodium arsenite results in increased expression of CACNA1A mRNA CTD PMID:37682722 Cacna1a Rat succimer multiple interactions ISO CACNA1A (Homo sapiens) 6480464 [Succimer co-treated with Magnetite Nanoparticles] results in increased expression of CACNA1A mRNA CTD PMID:26378955 Cacna1a Rat temozolomide decreases expression ISO CACNA1A (Homo sapiens) 6480464 Temozolomide results in decreased expression of CACNA1A mRNA CTD PMID:31758290 Cacna1a Rat testosterone decreases expression ISO CACNA1A (Homo sapiens) 6480464 Testosterone results in decreased expression of CACNA1A mRNA CTD PMID:33359661 Cacna1a Rat Testosterone propionate increases expression ISO Cacna1a (Mus musculus) 6480464 Testosterone Propionate results in increased expression of CACNA1A mRNA CTD PMID:15601916 Cacna1a Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of CACNA1A mRNA CTD PMID:16644059 Cacna1a Rat thapsigargin increases expression ISO CACNA1A (Homo sapiens) 6480464 Thapsigargin results in increased expression of CACNA1A mRNA CTD PMID:19442820 Cacna1a Rat titanium dioxide increases methylation ISO Cacna1a (Mus musculus) 6480464 titanium dioxide results in increased methylation of CACNA1A promoter CTD PMID:35295148 Cacna1a Rat titanium dioxide decreases methylation ISO Cacna1a (Mus musculus) 6480464 titanium dioxide results in decreased methylation of CACNA1A gene CTD PMID:35295148 Cacna1a Rat trichostatin A increases expression ISO CACNA1A (Homo sapiens) 6480464 trichostatin A results in increased expression of CACNA1A mRNA CTD PMID:24935251 Cacna1a Rat triclosan decreases expression ISO CACNA1A (Homo sapiens) 6480464 Triclosan results in decreased expression of CACNA1A mRNA CTD PMID:30510588 Cacna1a Rat triphenyl phosphate affects expression ISO CACNA1A (Homo sapiens) 6480464 triphenyl phosphate affects the expression of CACNA1A mRNA CTD PMID:37042841 Cacna1a Rat triptonide decreases expression ISO Cacna1a (Mus musculus) 6480464 triptonide results in decreased expression of CACNA1A mRNA CTD PMID:33045310 Cacna1a Rat valproic acid affects expression ISO CACNA1A (Homo sapiens) 6480464 Valproic Acid affects the expression of CACNA1A mRNA CTD PMID:25979313 Cacna1a Rat valproic acid affects splicing EXP 6480464 Valproic Acid affects the splicing of CACNA1A mRNA CTD PMID:29427782 Cacna1a Rat valproic acid increases expression ISO CACNA1A (Homo sapiens) 6480464 Valproic Acid results in increased expression of CACNA1A mRNA CTD PMID:23179753 more ... Cacna1a Rat vinclozolin multiple interactions EXP 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with vinclozolin co-treated with prochloraz co-treated with procymidone co-treated with Linuron co-treated with epoxiconazole co-treated with Dichlorodiphenyl Dichloroethylene] results in increased expression of CACNA1A mRNA CTD PMID:25607892 Cacna1a Rat vinclozolin decreases methylation EXP 6480464 vinclozolin results in decreased methylation of CACNA1A gene CTD PMID:31079544 Cacna1a Rat vorinostat multiple interactions ISO CACNA1A (Homo sapiens) 6480464 [NOG protein co-treated with Vorinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of CACNA1A mRNA CTD PMID:27188386
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
(+)-pilocarpine (ISO) 1,2-dimethylhydrazine (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-palmitoylglycerol (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxynon-2-enal (ISO) 6-propyl-2-thiouracil (EXP) acrylamide (EXP) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) allethrin (EXP) ammonium chloride (EXP) antirheumatic drug (ISO) arsenite(3-) (ISO) arsenous acid (ISO) aspartame (ISO) barium(0) (EXP) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (EXP) bisphenol A (EXP,ISO) bisphenol F (EXP,ISO) Butylparaben (EXP) cadmium dichloride (ISO) calcium atom (EXP) calcium(0) (EXP) cannabidiol (EXP) carbamazepine (ISO) CGP 52608 (ISO) choline (ISO) cisplatin (ISO) clofibrate (ISO) clozapine (EXP,ISO) copper atom (ISO) copper(0) (ISO) coumarin (ISO) cypermethrin (ISO) DDE (EXP) DDT (EXP) diarsenic trioxide (ISO) dibutyl phthalate (EXP,ISO) dichlorine (EXP) dorsomorphin (ISO) entinostat (ISO) enzacamene (EXP) epoxiconazole (EXP) ethanol (ISO) fenvalerate (EXP) folic acid (ISO) gabapentin (EXP,ISO) gamma-aminobutyric acid (EXP) glyphosate (EXP) haloperidol (EXP,ISO) L-methionine (ISO) linuron (EXP) methotrexate (ISO) methoxychlor (EXP) mono(2-ethylhexyl) phthalate (ISO) monosodium L-glutamate (ISO) N,N-diethyl-m-toluamide (EXP) N-ethyl-N-nitrosourea (ISO) N-methyl-D-aspartic acid (ISO) N-nitrosodiethylamine (EXP) nitric oxide (EXP) Nor-9-carboxy-delta9-THC (ISO) ozone (EXP,ISO) perfluorohexanesulfonic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) permethrin (EXP) phenethyl caffeate (EXP) phenylmercury acetate (ISO) pirinixic acid (ISO) potassium chloride (EXP,ISO) prochloraz (EXP) procymidone (EXP) rotenone (ISO) sarin (EXP) SB 431542 (ISO) silver atom (EXP) silver(0) (EXP) sodium arsenite (EXP,ISO) succimer (ISO) temozolomide (ISO) testosterone (ISO) Testosterone propionate (ISO) tetrachloromethane (EXP) thapsigargin (ISO) titanium dioxide (ISO) trichostatin A (ISO) triclosan (ISO) triphenyl phosphate (ISO) triptonide (ISO) valproic acid (EXP,ISO) vinclozolin (EXP) vorinostat (ISO)
Biological Process
adult walking behavior (ISO) behavioral response to pain (ISO) calcium ion import (IDA,IMP) calcium ion import across plasma membrane (IBA) calcium ion transmembrane transport (IEA,ISO) calcium ion transport (IDA,IEA,IMP,ISO) calcium ion-regulated exocytosis of neurotransmitter (ISO) calcium-ion regulated exocytosis (ISO) cellular response to amyloid-beta (IEA,ISO) central nervous system neuron differentiation (ISO) cerebellar molecular layer development (ISO) cerebellar Purkinje cell differentiation (ISO) cerebellar Purkinje cell layer development (ISO) cerebellum maturation (ISO) chemical synaptic transmission (IMP,ISO) cholecystokinin signaling pathway (ISO) dendrite morphogenesis (ISO) establishment of localization in cell (ISO) G protein-coupled opioid receptor signaling pathway (ISO) gamma-aminobutyric acid secretion (ISO) gamma-aminobutyric acid signaling pathway (ISO) glucose homeostasis (ISO) hormone biosynthetic process (ISO) intracellular chloride ion homeostasis (ISO) membrane depolarization (ISO) modulation of chemical synaptic transmission (IEA,ISO) monoatomic ion transmembrane transport (IEA) monoatomic ion transport (IEA) musculoskeletal movement, spinal reflex action (ISO) negative regulation of hormone biosynthetic process (ISO) negative regulation of neuron apoptotic process (ISO) nervous system process (ISO) neuromuscular process (ISO) neuromuscular process controlling balance (ISO) neuromuscular synaptic transmission (ISO) neuron apoptotic process (ISO) neuron cellular homeostasis (ISO) neuron-neuron synaptic transmission (ISO) positive regulation of cytosolic calcium ion concentration (IEA,ISO,ISS) receptor clustering (ISO) regulation of acetylcholine secretion, neurotransmission (ISO) regulation of axonogenesis (ISO) regulation of calcium ion-dependent exocytosis (ISO) regulation of hormone levels (ISO) regulation of membrane potential (ISO) regulation of presynaptic cytosolic calcium ion concentration (IEA) regulation of sulfur amino acid metabolic process (ISO) regulation of voltage-gated calcium channel activity (IMP) response to amyloid-beta (IEA,ISO) response to pain (ISO) rhythmic synaptic transmission (ISO) somatostatin signaling pathway (ISO) spinal cord motor neuron differentiation (ISO) synapse assembly (ISO) synaptic transmission, GABAergic (ISO) synaptic transmission, glutamatergic (ISO) transmembrane transport (IEA) transmission of nerve impulse (ISO) vestibular nucleus development (ISO)
Cellular Component
calyx of Held (IDA) cell projection (IEA,ISO) cytoplasm (IEA,ISO) dendrite (ISO) glutamatergic synapse (ISO) membrane (IEA) monoatomic ion channel complex (IEA) neuronal cell body (IBA,IDA,ISO) nucleus (IEA,ISO) perikaryon (IDA) plasma membrane (IEA,ISO) postsynaptic membrane (ISO) presynaptic active zone membrane (IDA,ISO) protein-containing complex (IDA) somatodendritic compartment (IEA) voltage-gated calcium channel complex (IBA,IDA,IEA,ISO,TAS)
1.
BKCa-Cav channel complexes mediate rapid and localized Ca2+-activated K+ signaling.
Berkefeld H, etal., Science. 2006 Oct 27;314(5799):615-20.
2.
Genetic heterogeneity in Italian families with familial hemiplegic migraine.
Carrera P, etal., Neurology. 1999 Jul 13;53(1):26-33.
3.
Voltage-gated calcium channels.
Catterall WA Cold Spring Harb Perspect Biol. 2011 Aug 1;3(8):a003947. doi: 10.1101/cshperspect.a003947.
4.
Two sets of amino acids of the domain I of Cav2.3 Ca(2+) channels contribute to their high sensitivity to extracellular protons.
Cens T, etal., Pflugers Arch. 2011 Aug;462(2):303-14. doi: 10.1007/s00424-011-0974-x. Epub 2011 May 25.
5.
Direct interaction of the calcium sensor protein synaptotagmin I with a cytoplasmic domain of the alpha1A subunit of the P/Q-type calcium channel.
Charvin N, etal., EMBO J. 1997 Aug 1;16(15):4591-6.
6.
Association between the alpha(1a) calcium channel gene CACNA1A and idiopathic generalized epilepsy.
Chioza B, etal., Neurology 2001 May 8;56(9):1245-6.
7.
The E1015K variant in the synprint region of the CaV2.1 channel alters channel function and is associated with different migraine phenotypes.
Condliffe SB, etal., J Biol Chem. 2013 Nov 22;288(47):33873-83. doi: 10.1074/jbc.M113.497701. Epub 2013 Oct 9.
8.
Mutations in the Cacnl1a4 calcium channel gene are associated with seizures, cerebellar degeneration, and ataxia in tottering and leaner mutant mice.
Doyle J, etal., Mamm Genome. 1997 Feb;8(2):113-20.
9.
Fragile X mental retardation protein controls synaptic vesicle exocytosis by modulating N-type calcium channel density.
Ferron L, etal., Nat Commun. 2014 Apr 7;5:3628. doi: 10.1038/ncomms4628.
10.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
11.
Release probability of hippocampal glutamatergic terminals scales with the size of the active zone.
Holderith N, etal., Nat Neurosci. 2012 Jun 10;15(7):988-97. doi: 10.1038/nn.3137.
12.
Abundant expression and cytoplasmic aggregations of 1A voltage-dependent calcium channel protein associated with neurodegeneration in spinocerebellar ataxia type 6.
Ishikawa K, etal., Hum Mol Genet. 1999 Jul;8(7):1185-93.
13.
Modulation of CaV2.1 channels by Ca2+/calmodulin-dependent protein kinase II bound to the C-terminal domain.
Jiang X, etal., Proc Natl Acad Sci U S A. 2008 Jan 8;105(1):341-6. Epub 2007 Dec 27.
14.
RIM proteins tether Ca2+ channels to presynaptic active zones via a direct PDZ-domain interaction.
Kaeser PS, etal., Cell. 2011 Jan 21;144(2):282-95. doi: 10.1016/j.cell.2010.12.029.
15.
Sisters homozygous for the spinocerebellar ataxia type 6 (SCA6)/CACNA1A gene associated with different clinical phenotypes.
Kato T, etal., Clin Genet 2000 Jul;58(1):69-73.
16.
Novel splice site CACNA1A mutation causing episodic ataxia type 2.
Kaunisto MA, etal., Neurogenetics 2004 Feb;5(1):69-73. Epub 2003 Oct 7.
17.
Modulation of CaV2.1 channels by the neuronal calcium-binding protein visinin-like protein-2.
Lautermilch NJ, etal., J Neurosci. 2005 Jul 27;25(30):7062-70.
18.
Differential modulation of Ca(v)2.1 channels by calmodulin and Ca2+-binding protein 1.
Lee A, etal., Nat Neurosci 2002 Mar;5(3):210-7.
19.
Molecular determinants of Ca(2+)/calmodulin-dependent regulation of Ca(v)2.1 channels.
Lee A, etal., Proc Natl Acad Sci U S A 2003 Dec 23;100(26):16059-64. Epub 2003 Dec 12.
20.
Class A calcium channel variants in pancreatic islets and their role in insulin secretion.
Ligon B, etal., J Biol Chem 1998 May 29;273(22):13905-11.
21.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
22.
Voltage-gated calcium channels in adult rat inferior colliculus neurons.
N'Gouemo P and Morad M, Neuroscience 2003;120(3):815-26.
23.
Nanoscale distribution of presynaptic Ca(2+) channels and its impact on vesicular release during development.
Nakamura Y, etal., Neuron. 2015 Jan 7;85(1):145-158. doi: 10.1016/j.neuron.2014.11.019. Epub 2014 Dec 18.
24.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
25.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
26.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
27.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
28.
The polyglutamine expansion in spinocerebellar ataxia type 6 causes a beta subunit-specific enhanced activation of P/Q-type calcium channels in Xenopus oocytes.
Restituito S, etal., J Neurosci. 2000 Sep 1;20(17):6394-403.
29.
GOA pipeline
RGD automated data pipeline
30.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
31.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
32.
Presynaptic Cav2.1 and Cav2.2 differentially influence release dynamics at hippocampal excitatory synapses.
Scheuber A, etal., J Neurosci. 2004 Nov 17;24(46):10402-9.
33.
Primary structure of a calcium channel that is highly expressed in the rat cerebellum.
Starr TV, etal., Proc Natl Acad Sci U S A 1991 Jul 1;88(13):5621-5.
34.
Role of spinal Cav2.2 and Cav2.1 ion channels in bladder nociception.
Su X, etal., J Urol. 2008 Jun;179(6):2464-9. doi: 10.1016/j.juro.2008.01.088. Epub 2008 Apr 23.
35.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
36.
The ataxic groggy rat has a missense mutation in the P/Q-type voltage-gated Ca(2+) channel alpha(1A) subunit gene and exhibits absence seizures.
Tokuda S, etal., Brain Res. 2006 Dec 28;.
37.
Regulation of calcium channel alpha(1A) subunit splice variant mRNAs in kainate-induced temporal lobe epilepsy.
Vigues S, etal., Neurobiol Dis. 1999 Aug;6(4):288-301.
38.
Differential distribution of voltage-gated calcium channels in dopaminergic neurons of the rat retina.
Witkovsky P, etal., J Comp Neurol. 2006 Jul 20;497(3):384-96.
39.
The role of voltage-gated calcium channels in pancreatic beta-cell physiology and pathophysiology.
Yang SN and Berggren PO, Endocr Rev. 2006 Oct;27(6):621-76. Epub 2006 Jul 25.
40.
Molecular characterization and nephron distribution of a family of transcripts encoding the pore-forming subunit of Ca2+ channels in the kidney.
Yu AS, etal., Proc Natl Acad Sci U S A 1992 Nov 1;89(21):10494-8.
41.
Molecular mechanism for divergent regulation of Cav1.2 Ca2+ channels by calmodulin and Ca2+-binding protein-1.
Zhou H, etal., J Biol Chem. 2005 Aug 19;280(33):29612-9. Epub 2005 Jun 26.
42.
Autosomal dominant cerebellar ataxia (SCA6) associated with small polyglutamine expansions in the alpha 1A-voltage-dependent calcium channel.
Zhuchenko O, etal., Nat Genet. 1997 Jan;15(1):62-9.
Cacna1a Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 19 40,425,560 - 40,724,810 (-) NCBI GRCr8 mRatBN7.2 19 23,520,741 - 23,819,971 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 19 23,520,741 - 23,823,225 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 19 30,343,968 - 30,567,151 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 19 30,998,339 - 31,221,535 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 19 33,221,032 - 33,444,209 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 19 25,453,236 - 25,749,550 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 19 25,526,751 - 25,749,550 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 19 36,502,533 - 36,727,039 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 19 25,188,170 - 25,424,495 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 19 25,194,294 - 25,429,321 (-) NCBI Celera 19 23,074,249 - 23,295,970 (-) NCBI Celera Cytogenetic Map 19 q11 NCBI
CACNA1A Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 19 13,206,442 - 13,506,479 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 19 13,206,442 - 13,624,489 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 19 13,317,256 - 13,617,293 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 19 13,178,256 - 13,478,274 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 19 13,179,114 - 13,478,317 NCBI Celera 19 13,207,639 - 13,507,772 (-) NCBI Celera Cytogenetic Map 19 p13.13 NCBI HuRef 19 12,889,634 - 13,189,171 (-) NCBI HuRef CHM1_1 19 13,318,256 - 13,618,198 (-) NCBI CHM1_1 T2T-CHM13v2.0 19 13,331,719 - 13,631,840 (-) NCBI T2T-CHM13v2.0
Cacna1a Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 85,065,257 - 85,366,880 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 85,065,268 - 85,366,875 (+) Ensembl GRCm39 Ensembl GRCm38 8 84,338,631 - 84,640,251 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 84,338,639 - 84,640,246 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 86,939,263 - 87,164,148 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 87,305,469 - 87,530,351 (+) NCBI MGSCv36 mm8 Celera 8 88,715,985 - 88,942,662 (+) NCBI Celera Cytogenetic Map 8 C2- C3 NCBI cM Map 8 40.95 NCBI
Cacna1a Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955415 32,183,442 - 32,400,595 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955415 32,182,536 - 32,457,511 (-) NCBI ChiLan1.0 ChiLan1.0
CACNA1A Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 20 18,136,613 - 18,555,581 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 19 17,137,272 - 17,556,602 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 19 12,769,586 - 13,189,022 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 19 13,506,232 - 13,804,815 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 19 13,507,102 - 13,804,729 (-) Ensembl panpan1.1 panPan2
CACNA1A Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 20 48,747,087 - 49,036,627 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 20 48,821,025 - 49,036,032 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 20 48,694,916 - 48,910,172 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 20 49,339,396 - 49,554,755 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 20 49,280,733 - 49,553,801 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 20 48,549,923 - 48,765,101 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 20 48,976,279 - 49,191,383 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 20 49,219,720 - 49,435,029 (+) NCBI UU_Cfam_GSD_1.0
LOC101960999 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405118 208,078,478 - 208,143,320 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936659 2,192,610 - 2,392,638 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936659 2,201,606 - 2,269,625 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
CACNA1A Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 2 65,514,509 - 65,871,182 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 2 65,491,784 - 65,871,068 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 2 65,921,411 - 66,176,189 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
CACNA1A
Cacna1a
.
Predicted Target Of
Count of predictions: 109 Count of miRNA genes: 93 Interacting mature miRNAs: 100 Transcripts: ENSRNOT00000067921, ENSRNOT00000068563 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1549847 Bss8 Bone structure and strength QTL 8 4 lumbar vertebra strength trait (VT:0010574) vertebra ultimate force (CMO:0001678) 19 1 31963836 Rat 61447 Tcas1 Tongue tumor susceptibility QTL 1 6.08 tongue integrity trait (VT:0010553) squamous cell carcinoma of the tongue maximum tumor diameter (CMO:0001875) 19 2316121 47316121 Rat 631681 Cm12 Cardiac mass QTL 12 3.33 0.00053 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 19 1 28982497 Rat 9590298 Uminl5 Urine mineral level QTL 5 3.59 0.001 urine mineral amount (VT:0015086) urine electrolyte level (CMO:0000593) 19 1 36824771 Rat 1331737 Uae29 Urinary albumin excretion QTL 29 5.5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 19 4096155 55283277 Rat 2298478 Eau8 Experimental allergic uveoretinitis QTL 8 0.0163 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 19 17154433 57337602 Rat 1578764 Stresp19 Stress response QTL 19 3.6 0.001 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 19 15630201 57337602 Rat 1558656 Prcs1 Prostate cancer susceptibility QTL 1 5 prostate integrity trait (VT:0010571) percentage of study population developing ventral prostate tumorous lesions during a period of time (CMO:0000943) 19 15114598 34521833 Rat 9590090 Insglur8 Insulin/glucose ratio QTL 8 10.81 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 19 1 36824771 Rat 1331788 Rf45 Renal function QTL 45 2.818 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 19 15605023 46559041 Rat 724566 Uae12 Urinary albumin excretion QTL 12 5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 19 2187927 56457239 Rat 724565 Tcas5 Tongue tumor susceptibility QTL 5 10.04 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 19 9977753 39654489 Rat 61407 Scl12 Serum cholesterol level QTL 12 0.001 blood HDL cholesterol amount (VT:0000184) serum high density lipoprotein cholesterol level (CMO:0000361) 19 13926401 30303727 Rat 8552935 Pigfal10 Plasma insulin-like growth factor 1 level QTL 10 5.7 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 19 1 36824771 Rat 61350 Bp32 Blood pressure QTL 32 0.012 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 19 20483575 57337602 Rat 7411549 Bw130 Body weight QTL 130 5 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 19 15455860 57337602 Rat 10054132 Srcrt9 Stress Responsive Cort QTL 9 2.87 0.0017 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 19 1 27355345 Rat 724518 Uae19 Urinary albumin excretion QTL 19 5.5 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 19 7457249 42983518 Rat 8694186 Bw152 Body weight QTL 152 3.34 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 19 569374 45569374 Rat 61423 Cia14 Collagen induced arthritis QTL 14 3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 19 10827970 43544039 Rat 7411590 Foco7 Food consumption QTL 7 6.8 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 19 1 24688055 Rat 631678 Cm9 Cardiac mass QTL 9 4.27 0.0001 aorta mass (VT:0002845) aorta weight (CMO:0000076) 19 1 28982497 Rat 9590250 Scort11 Serum corticosterone level QTL 11 23.45 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 19 1 36824771 Rat 2317848 Alcrsp21 Alcohol response QTL 21 1.899999976158142 0.05 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 19 3204777 48204777 Rat 9589102 Slep13 Serum leptin concentration QTL 13 4.63 0.001 blood leptin amount (VT:0005667) plasma leptin level (CMO:0000781) 19 569374 45569374 Rat 7247442 Uae39 Urinary albumin excretion QTL 39 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 19 2187927 46708701 Rat
Cacna1a
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 19 23,528,755 - 23,529,138 (-) MAPPER mRatBN7.2 Rnor_6.0 19 25,741,154 - 25,741,536 NCBI Rnor6.0 Rnor_5.0 19 36,718,569 - 36,718,951 UniSTS Rnor5.0 RGSC_v3.4 19 25,194,835 - 25,195,218 UniSTS RGSC3.4 Celera 19 23,082,377 - 23,082,759 UniSTS Cytogenetic Map 19 q11 UniSTS
RH143033
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 19 23,746,224 - 23,746,369 (-) MAPPER mRatBN7.2 mRatBN7.2 19 23,745,974 - 23,746,369 (-) MAPPER mRatBN7.2 Rnor_6.0 19 25,525,749 - 25,525,893 NCBI Rnor6.0 Rnor_6.0 19 25,525,749 - 25,526,172 NCBI Rnor6.0 Rnor_5.0 19 36,501,531 - 36,501,954 UniSTS Rnor5.0 Rnor_5.0 19 36,501,531 - 36,501,675 UniSTS Rnor5.0 RGSC_v3.4 19 25,425,115 - 25,425,259 UniSTS RGSC3.4 Celera 19 23,296,539 - 23,296,683 UniSTS Cytogenetic Map 19 q11 UniSTS
RH137733
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 19 23,642,907 - 23,643,067 (-) MAPPER mRatBN7.2 Rnor_6.0 19 25,629,237 - 25,629,396 NCBI Rnor6.0 Rnor_5.0 19 36,604,642 - 36,604,801 UniSTS Rnor5.0 RGSC_v3.4 19 25,318,888 - 25,319,047 UniSTS RGSC3.4 Celera 19 23,193,847 - 23,194,006 UniSTS Cytogenetic Map 19 q11 UniSTS
RH140588
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 19 23,557,895 - 23,558,114 (-) MAPPER mRatBN7.2 Rnor_6.0 19 25,712,179 - 25,712,397 NCBI Rnor6.0 Rnor_5.0 19 36,689,645 - 36,689,863 UniSTS Rnor5.0 RGSC_v3.4 19 25,225,045 - 25,225,263 UniSTS RGSC3.4 Celera 19 23,112,051 - 23,112,269 UniSTS Cytogenetic Map 19 q11 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
87
86
55
25
55
6
214
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000083448 ⟹ ENSRNOP00000070304
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 19 23,520,741 - 23,745,646 (-) Ensembl Rnor_6.0 Ensembl 19 25,526,751 - 25,749,550 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000102295 ⟹ ENSRNOP00000080121
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 19 23,520,741 - 23,823,225 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000106526 ⟹ ENSRNOP00000096924
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 19 23,520,741 - 23,823,225 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000114797 ⟹ ENSRNOP00000078109
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 19 23,520,741 - 23,565,281 (-) Ensembl
RefSeq Acc Id:
NM_012918 ⟹ NP_037050
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 40,425,560 - 40,650,468 (-) NCBI mRatBN7.2 19 23,520,741 - 23,745,646 (-) NCBI Rnor_6.0 19 25,526,751 - 25,749,550 (+) NCBI Rnor_5.0 19 36,502,533 - 36,727,039 (+) NCBI RGSC_v3.4 19 25,188,170 - 25,424,495 (-) RGD Celera 19 23,074,249 - 23,295,970 (-) NCBI
Sequence:
ATGGCCCGCTTTGGAGACGAGATGCCGGGCCGCTACGGCGCAGGCGGAGGAGGCTCAGGGCCGGCCGCCGGGGTGGTCGTGGGCGCCGCGGGCGGCCGAGGAGCCGGGGGCAGCCGGCAGGGCGGGCA
hide sequence
RefSeq Acc Id:
XM_039097487 ⟹ XP_038953415
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 40,426,808 - 40,724,802 (-) NCBI mRatBN7.2 19 23,521,989 - 23,819,963 (-) NCBI
RefSeq Acc Id:
XM_063277789 ⟹ XP_063133859
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 40,426,808 - 40,724,802 (-) NCBI
RefSeq Acc Id:
XM_063277790 ⟹ XP_063133860
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 40,426,808 - 40,724,803 (-) NCBI
RefSeq Acc Id:
XM_063277791 ⟹ XP_063133861
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 40,426,808 - 40,724,802 (-) NCBI
RefSeq Acc Id:
XM_063277792 ⟹ XP_063133862
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 40,426,808 - 40,724,802 (-) NCBI
RefSeq Acc Id:
XM_063277793 ⟹ XP_063133863
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 40,426,808 - 40,724,803 (-) NCBI
RefSeq Acc Id:
XM_063277794 ⟹ XP_063133864
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 40,426,808 - 40,651,714 (-) NCBI
RefSeq Acc Id:
XM_063277795 ⟹ XP_063133865
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 40,426,808 - 40,724,801 (-) NCBI
RefSeq Acc Id:
XM_063277796 ⟹ XP_063133866
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 40,467,473 - 40,724,810 (-) NCBI
RefSeq Acc Id:
XM_063277797 ⟹ XP_063133867
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 40,464,371 - 40,724,810 (-) NCBI
RefSeq Acc Id:
XM_063277798 ⟹ XP_063133868
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 40,463,531 - 40,724,809 (-) NCBI
RefSeq Acc Id:
XM_063277799 ⟹ XP_063133869
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 40,464,431 - 40,724,809 (-) NCBI
RefSeq Acc Id:
NP_037050 ⟸ NM_012918
- UniProtKB:
A0A0G2JXK1 (UniProtKB/TrEMBL)
- Sequence:
MARFGDEMPGRYGAGGGGSGPAAGVVVGAAGGRGAGGSRQGGQPGAQRMYKQSMAQRARTMALYNPIPVRQNCLTVNRSLFLFSEDNVVRKYAKKITEWPPFEYMILATIIANCIVLALEQHLPDDDK
hide sequence
Ensembl Acc Id:
ENSRNOP00000070304 ⟸ ENSRNOT00000083448
RefSeq Acc Id:
XP_038953415 ⟸ XM_039097487
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I5ZPG4 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000096924 ⟸ ENSRNOT00000106526
Ensembl Acc Id:
ENSRNOP00000080121 ⟸ ENSRNOT00000102295
Ensembl Acc Id:
ENSRNOP00000078109 ⟸ ENSRNOT00000114797
RefSeq Acc Id:
XP_063133860 ⟸ XM_063277790
- Peptide Label:
isoform X3
- UniProtKB:
A0A8I5ZPG4 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063133863 ⟸ XM_063277793
- Peptide Label:
isoform X6
- UniProtKB:
A0A8I5ZPG4 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063133862 ⟸ XM_063277792
- Peptide Label:
isoform X5
- UniProtKB:
A0A8I5ZPG4 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063133861 ⟸ XM_063277791
- Peptide Label:
isoform X4
- UniProtKB:
A0A8I5ZPG4 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063133859 ⟸ XM_063277789
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I5ZPG4 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063133865 ⟸ XM_063277795
- Peptide Label:
isoform X8
- UniProtKB:
Q01541 (UniProtKB/Swiss-Prot), P54282 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_063133864 ⟸ XM_063277794
- Peptide Label:
isoform X7
- UniProtKB:
A0A0G2JXK1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063133868 ⟸ XM_063277798
- Peptide Label:
isoform X11
- UniProtKB:
A6IY89 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063133867 ⟸ XM_063277797
- Peptide Label:
isoform X10
- UniProtKB:
A6IY89 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063133869 ⟸ XM_063277799
- Peptide Label:
isoform X11
- UniProtKB:
A6IY89 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063133866 ⟸ XM_063277796
- Peptide Label:
isoform X9
- UniProtKB:
A6IY89 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-02-11
Cacna1a
calcium voltage-gated channel subunit alpha1 A
Cacna1a
calcium channel, voltage-dependent, P/Q type, alpha 1A subunit
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2013-03-29
Cacna1a
calcium channel, voltage-dependent, P/Q type, alpha 1A subunit
LOC688360
similar to Voltage-dependent P/Q-type calcium channel alpha-1A subunit (Voltage-gated calcium channel alpha subunit Cav2.1) (Calcium channel, L type, alpha-1 polypeptide isoform 4) (Brain calcium channel I) (BI)
Data merged from RGD:1590014
737654 PROVISIONAL
2006-11-20
LOC688360
similar to Voltage-dependent P/Q-type calcium channel alpha-1A subunit (Voltage-gated calcium channel alpha subunit Cav2.1) (Calcium channel, L type, alpha-1 polypeptide isoform 4) (Brain calcium channel I) (BI)
Symbol and Name status set to provisional
70820 PROVISIONAL
2004-09-10
Cacna1a
calcium channel, voltage-dependent, P/Q type, alpha 1A subunit
calcium channel, voltage-dependent, alpha 1A subunit
Name updated
1299863 APPROVED
2002-11-06
Cacna1a
calcium channel, voltage-dependent, alpha 1A subunit
Calcium channel alpha 1A
Name updated
625702 APPROVED
2002-06-10
Cacna1a
Calcium channel alpha 1A
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_expression
expressed in central nervous system, heart and pituitary and not expressed in spleen, kidney or liver
1299846
gene_function
a voltage-gated calcium channel
634678
gene_process
involved in secretion coupling in beta cells
634678
