Symbol:
Ppih
Name:
peptidylprolyl isomerase H
RGD ID:
1564921
Description:
Predicted to enable peptidyl-prolyl cis-trans isomerase activity and ribonucleoprotein complex binding activity. Predicted to be involved in positive regulation of viral genome replication. Predicted to be located in cytoplasm and nuclear speck. Predicted to be part of U4/U6 snRNP and U4/U6 x U5 tri-snRNP complex. Orthologous to human PPIH (peptidylprolyl isomerase H); PARTICIPATES IN spliceosome pathway; INTERACTS WITH 4,4'-sulfonyldiphenol; 6-propyl-2-thiouracil; alpha-Zearalanol.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
LOC366461; peptidyl-prolyl cis-trans isomerase H; peptidylprolyl isomerase H (cyclophilin H); RGD1564921; similar to peptidyl prolyl isomerase H
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 138,191,624 - 138,209,625 (-) NCBI GRCr8 mRatBN7.2 5 132,906,324 - 132,924,341 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 132,906,328 - 132,924,267 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 135,633,875 - 135,652,694 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 137,390,334 - 137,409,153 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 137,410,930 - 137,429,749 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 138,343,934 - 138,361,743 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 138,352,916 - 138,361,702 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 142,160,007 - 142,178,024 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 139,959,365 - 139,969,320 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 5 131,431,800 - 131,449,612 (-) NCBI Celera Cytogenetic Map 5 q36 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ppih Rat 17alpha-ethynylestradiol affects expression ISO RGD:1615137 6480464 Ethinyl Estradiol affects the expression of PPIH mRNA CTD PMID:17555576 Ppih Rat 17alpha-ethynylestradiol multiple interactions ISO RGD:1615137 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of PPIH mRNA CTD PMID:17942748 Ppih Rat 17alpha-ethynylestradiol increases expression ISO RGD:1615137 6480464 Ethinyl Estradiol results in increased expression of PPIH mRNA CTD PMID:17942748 Ppih Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO RGD:1347300 6480464 2,2',4,4'-tetrabromodiphenyl ether results in decreased expression of PPIH protein CTD PMID:31675489 Ppih Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:1615137 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of PPIH mRNA CTD PMID:17942748 Ppih Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1615137 6480464 Tetrachlorodibenzodioxin affects the expression of PPIH mRNA CTD PMID:21570461 Ppih Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:1615137 6480464 Tetrachlorodibenzodioxin results in decreased expression of PPIH mRNA CTD PMID:25270620 Ppih Rat 2,3-dimethoxynaphthalene-1,4-dione increases expression ISO RGD:1347300 6480464 2,3-dimethoxy-1,4-naphthoquinone results in increased expression of PPIH mRNA CTD PMID:17547211 Ppih Rat 3,4-methylenedioxymethamphetamine decreases expression ISO RGD:1615137 6480464 N-Methyl-3,4-methylenedioxyamphetamine results in decreased expression of PPIH mRNA CTD PMID:20188158 Ppih Rat 3-methylcholanthrene increases expression ISO RGD:1615137 6480464 Methylcholanthrene results in increased expression of PPIH mRNA CTD PMID:20713471 Ppih Rat 4,4'-diaminodiphenylmethane decreases expression ISO RGD:1615137 6480464 4,4'-diaminodiphenylmethane results in decreased expression of PPIH mRNA CTD PMID:18648102 Ppih Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:1615137 6480464 bisphenol S results in increased expression of PPIH mRNA CTD PMID:39298647 Ppih Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of more ... CTD PMID:36041667 Ppih Rat 4-hydroxyphenyl retinamide decreases expression ISO RGD:1615137 6480464 Fenretinide results in decreased expression of PPIH mRNA CTD PMID:28973697 Ppih Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of PPIH mRNA CTD PMID:24780913 Ppih Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of PPIH mRNA CTD PMID:35163327 Ppih Rat antimony(0) increases expression ISO RGD:1347300 6480464 Antimony results in increased expression of PPIH mRNA CTD PMID:17547211 Ppih Rat arsenous acid increases expression ISO RGD:1347300 6480464 Arsenic Trioxide results in increased expression of PPIH mRNA CTD PMID:17547211 Ppih Rat benzo[a]pyrene decreases methylation ISO RGD:1347300 6480464 Benzo(a)pyrene results in decreased methylation of PPIH promoter CTD PMID:27901495 Ppih Rat beta-lapachone increases expression ISO RGD:1347300 6480464 beta-lapachone results in increased expression of PPIH mRNA CTD PMID:38218311 Ppih Rat bis(2-chloroethyl) sulfide decreases expression ISO RGD:1347300 6480464 Mustard Gas results in decreased expression of PPIH mRNA CTD PMID:25102026 Ppih Rat bisphenol A increases expression ISO RGD:1615137 6480464 bisphenol A results in increased expression of PPIH mRNA CTD PMID:25594700 Ppih Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of more ... CTD PMID:36041667 Ppih Rat bisphenol A affects expression ISO RGD:1347300 6480464 bisphenol A affects the expression of PPIH mRNA CTD PMID:30903817 Ppih Rat bisphenol A decreases expression ISO RGD:1347300 6480464 bisphenol A results in decreased expression of PPIH mRNA; bisphenol A results in decreased expression more ... CTD PMID:29275510|PMID:31675489 Ppih Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of more ... CTD PMID:36041667 Ppih Rat cadmium dichloride decreases expression ISO RGD:1347300 6480464 Cadmium Chloride results in decreased expression of PPIH mRNA CTD PMID:38382870 Ppih Rat calcitriol decreases expression ISO RGD:1347300 6480464 Calcitriol results in decreased expression of PPIH mRNA CTD PMID:21592394 Ppih Rat calcitriol multiple interactions ISO RGD:1347300 6480464 [Testosterone co-treated with Calcitriol] results in decreased expression of PPIH mRNA CTD PMID:21592394 Ppih Rat carbon nanotube increases expression ISO RGD:1615137 6480464 Nanotubes, Carbon analog results in increased expression of PPIH mRNA; Nanotubes, Carbon results in increased more ... CTD PMID:25554681 Ppih Rat CGP 52608 multiple interactions ISO RGD:1347300 6480464 CGP 52608 promotes the reaction [RORA protein binds to PPIH gene] CTD PMID:28238834 Ppih Rat chlorpyrifos decreases expression ISO RGD:1615137 6480464 Chlorpyrifos results in decreased expression of PPIH mRNA CTD PMID:37019170 Ppih Rat chromium atom increases expression ISO RGD:1347300 6480464 Chromium results in increased expression of PPIH mRNA CTD PMID:17547211 Ppih Rat clofibrate decreases expression ISO RGD:1615137 6480464 Clofibrate results in decreased expression of PPIH mRNA CTD PMID:25270620 Ppih Rat cobalt dichloride decreases expression ISO RGD:1347300 6480464 cobaltous chloride results in decreased expression of PPIH mRNA CTD PMID:19376846 Ppih Rat cyclosporin A increases expression ISO RGD:1347300 6480464 Cyclosporine results in increased expression of PPIH mRNA CTD PMID:25562108 Ppih Rat decabromodiphenyl ether increases expression ISO RGD:1347300 6480464 decabromobiphenyl ether results in increased expression of PPIH protein CTD PMID:31675489 Ppih Rat dextran sulfate decreases expression ISO RGD:1615137 6480464 Dextran Sulfate results in decreased expression of PPIH protein CTD PMID:32272095 Ppih Rat dextran sulfate increases expression ISO RGD:1615137 6480464 Dextran Sulfate results in increased expression of PPIH protein CTD PMID:35362542 Ppih Rat dextran sulfate multiple interactions ISO RGD:1615137 6480464 Erianin inhibits the reaction [Dextran Sulfate results in decreased expression of PPIH protein]; evodiamine inhibits more ... CTD PMID:32272095|PMID:35362542 Ppih Rat diarsenic trioxide increases expression ISO RGD:1347300 6480464 Arsenic Trioxide results in increased expression of PPIH mRNA CTD PMID:17547211 Ppih Rat dipotassium bis[mu-tartrato(4-)]diantimonate(2-) trihydrate increases expression ISO RGD:1347300 6480464 Antimony Potassium Tartrate results in increased expression of PPIH mRNA CTD PMID:17547211 Ppih Rat doxorubicin decreases expression ISO RGD:1347300 6480464 Doxorubicin results in decreased expression of PPIH mRNA CTD PMID:29803840 Ppih Rat erianin multiple interactions ISO RGD:1615137 6480464 Erianin inhibits the reaction [Dextran Sulfate results in decreased expression of PPIH protein] CTD PMID:32272095 Ppih Rat Evodiamine multiple interactions ISO RGD:1615137 6480464 evodiamine inhibits the reaction [Dextran Sulfate results in increased expression of PPIH protein] CTD PMID:35362542 Ppih Rat ivermectin decreases expression ISO RGD:1347300 6480464 Ivermectin results in decreased expression of PPIH protein CTD PMID:32959892 Ppih Rat mercury atom increases expression ISO RGD:1347300 6480464 Mercury results in increased expression of PPIH mRNA CTD PMID:17547211 Ppih Rat mercury(0) increases expression ISO RGD:1347300 6480464 Mercury results in increased expression of PPIH mRNA CTD PMID:17547211 Ppih Rat methamphetamine decreases methylation ISO RGD:1615137 6480464 Methamphetamine results in decreased methylation of PPIH promoter CTD PMID:26307267 Ppih Rat methotrexate decreases expression ISO RGD:1347300 6480464 Methotrexate results in decreased expression of PPIH mRNA CTD PMID:24449571 Ppih Rat methyl methanesulfonate increases expression ISO RGD:1347300 6480464 Methyl Methanesulfonate results in increased expression of PPIH mRNA CTD PMID:23649840 Ppih Rat ozone multiple interactions ISO RGD:1615137 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased more ... CTD PMID:34911549 Ppih Rat paracetamol affects expression ISO RGD:1615137 6480464 Acetaminophen affects the expression of PPIH mRNA CTD PMID:17562736 Ppih Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of PPIH mRNA CTD PMID:35163327 Ppih Rat phenethyl isothiocyanate decreases expression EXP 6480464 phenethyl isothiocyanate results in decreased expression of PPIH mRNA CTD PMID:17616710 Ppih Rat phenobarbital decreases expression ISO RGD:1615137 6480464 Phenobarbital results in decreased expression of PPIH mRNA CTD PMID:25270620 Ppih Rat pirinixic acid multiple interactions ISO RGD:1615137 6480464 PPARA protein affects the reaction [pirinixic acid results in increased expression of PPIH mRNA] CTD PMID:21318169 Ppih Rat pirinixic acid increases expression ISO RGD:1615137 6480464 pirinixic acid results in increased expression of PPIH mRNA CTD PMID:18301758|PMID:21318169 Ppih Rat potassium dichromate increases expression ISO RGD:1347300 6480464 Potassium Dichromate results in increased expression of PPIH mRNA CTD PMID:17547211 Ppih Rat sodium arsenite increases expression ISO RGD:1347300 6480464 sodium arsenite results in increased expression of PPIH mRNA CTD PMID:28595984|PMID:34032870 Ppih Rat sodium arsenite decreases expression ISO RGD:1347300 6480464 sodium arsenite results in decreased expression of PPIH mRNA CTD PMID:38568856 Ppih Rat sunitinib increases expression ISO RGD:1347300 6480464 Sunitinib results in increased expression of PPIH mRNA CTD PMID:31533062 Ppih Rat tamoxifen affects expression ISO RGD:1615137 6480464 Tamoxifen affects the expression of PPIH mRNA CTD PMID:17555576 Ppih Rat testosterone multiple interactions ISO RGD:1347300 6480464 [Testosterone co-treated with Calcitriol] results in decreased expression of PPIH mRNA CTD PMID:21592394 Ppih Rat testosterone decreases expression ISO RGD:1347300 6480464 Testosterone results in decreased expression of PPIH mRNA CTD PMID:21592394 Ppih Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of PPIH mRNA CTD PMID:33387578 Ppih Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of PPIH mRNA CTD PMID:34492290 Ppih Rat titanium dioxide decreases methylation ISO RGD:1615137 6480464 titanium dioxide results in decreased methylation of PPIH promoter CTD PMID:35295148 Ppih Rat Tributyltin oxide decreases expression ISO RGD:1615137 6480464 bis(tri-n-butyltin)oxide results in decreased expression of PPIH mRNA CTD PMID:25270620 Ppih Rat trimellitic anhydride increases expression ISO RGD:1615137 6480464 trimellitic anhydride results in increased expression of PPIH mRNA CTD PMID:19042947 Ppih Rat triptonide increases expression ISO RGD:1615137 6480464 triptonide results in increased expression of PPIH mRNA CTD PMID:33045310 Ppih Rat troglitazone decreases expression ISO RGD:1347300 6480464 troglitazone results in decreased expression of PPIH mRNA CTD PMID:19140230 Ppih Rat valproic acid increases methylation ISO RGD:1347300 6480464 Valproic Acid results in increased methylation of PPIH gene CTD PMID:29154799 Ppih Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of PPIH mRNA CTD PMID:23555832 Ppih Rat Yessotoxin decreases expression ISO RGD:1347300 6480464 yessotoxin analog results in decreased expression of PPIH mRNA CTD PMID:30679557
Molecular Function
Only show annotations with direct experimental evidence (0 objects hidden)
Ppih Rat isomerase activity enables IEA UniProtKB-KW:KW-0413 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Ppih Rat peptidyl-prolyl cis-trans isomerase activity enables ISO RGD:1347300 1624291 PMID:20676357, PMID:9570313 RGD PMID:20676357|PMID:9570313 Ppih Rat peptidyl-prolyl cis-trans isomerase activity enables IEA InterPro:IPR002130|InterPro:IPR020892 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Ppih Rat peptidyl-prolyl cis-trans isomerase activity enables IEA EC:5.2.1.8 1600115 GO_REF:0000003 UniProt GO_REF:0000003 Ppih Rat peptidyl-prolyl cis-trans isomerase activity enables IEA UniProtKB:O43447|ensembl:ENSP00000306614 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Ppih Rat peptidyl-prolyl cis-trans isomerase activity enables IEA RHEA:16237 1600115 GO_REF:0000116 RHEA GO_REF:0000116 Ppih Rat peptidyl-prolyl cis-trans isomerase activity enables IEA UniRule:UR000248790 1600115 GO_REF:0000104 UniProt GO_REF:0000104 Ppih Rat peptidyl-prolyl cis-trans isomerase activity enables IEA InterPro:IPR002130|InterPro:IPR020892|InterPro:IPR024936 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Ppih Rat peptidyl-prolyl cis-trans isomerase activity enables IEA UniProtKB-KW:KW-0697 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Ppih Rat protein binding enables ISO RGD:1347300 1624291 UniProtKB:O43172|UniProtKB:P0C6X7-PRO_0000037309|UniProtKB:P42858|UniProtKB:P98170|UniProtKB:Q7L591-3|UniProtKB:Q8TBB1|UniProtKB:Q92802|UniProtKB:Q99633|UniProtKB:Q9GZT8|UniProtKB:Q9NP55|UniProtKB:Q9UHD9 PMID:16723661, PMID:19615732, PMID:22046132, PMID:22365833, PMID:25383878, PMID:25416956, PMID:25959826, PMID:27107012, PMID:29997244, PMID:32296183, PMID:32814053, PMID:33961781, PMID:9570313 RGD PMID:16723661|PMID:19615732|PMID:22046132|PMID:22365833|PMID:25383878|PMID:25416956|PMID:25959826|PMID:27107012|PMID:29997244|PMID:32296183|PMID:32814053|PMID:33961781|PMID:9570313 Ppih Rat ribonucleoprotein complex binding enables ISO RGD:1347300 1624291 PMID:9570313 RGD PMID:9570313 Ppih Rat ribonucleoprotein complex binding enables IEA UniProtKB:O43447|ensembl:ENSP00000306614 1600115 GO_REF:0000107 Ensembl GO_REF:0000107
Imported Annotations - KEGG (archival)
17alpha-ethynylestradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,3-dimethoxynaphthalene-1,4-dione (ISO) 3,4-methylenedioxymethamphetamine (ISO) 3-methylcholanthrene (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (EXP) alpha-Zearalanol (EXP) antimony(0) (ISO) arsenous acid (ISO) benzo[a]pyrene (ISO) beta-lapachone (ISO) bis(2-chloroethyl) sulfide (ISO) bisphenol A (EXP,ISO) bisphenol F (EXP) cadmium dichloride (ISO) calcitriol (ISO) carbon nanotube (ISO) CGP 52608 (ISO) chlorpyrifos (ISO) chromium atom (ISO) clofibrate (ISO) cobalt dichloride (ISO) cyclosporin A (ISO) decabromodiphenyl ether (ISO) dextran sulfate (ISO) diarsenic trioxide (ISO) dipotassium bis[mu-tartrato(4-)]diantimonate(2-) trihydrate (ISO) doxorubicin (ISO) erianin (ISO) Evodiamine (ISO) ivermectin (ISO) mercury atom (ISO) mercury(0) (ISO) methamphetamine (ISO) methotrexate (ISO) methyl methanesulfonate (ISO) ozone (ISO) paracetamol (ISO) perfluorooctanoic acid (EXP) phenethyl isothiocyanate (EXP) phenobarbital (ISO) pirinixic acid (ISO) potassium dichromate (ISO) sodium arsenite (ISO) sunitinib (ISO) tamoxifen (ISO) testosterone (ISO) tetrachloromethane (EXP) thioacetamide (EXP) titanium dioxide (ISO) Tributyltin oxide (ISO) trimellitic anhydride (ISO) triptonide (ISO) troglitazone (ISO) valproic acid (ISO) vinclozolin (EXP) Yessotoxin (ISO)
Ppih Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 138,191,624 - 138,209,625 (-) NCBI GRCr8 mRatBN7.2 5 132,906,324 - 132,924,341 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 132,906,328 - 132,924,267 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 135,633,875 - 135,652,694 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 137,390,334 - 137,409,153 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 137,410,930 - 137,429,749 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 138,343,934 - 138,361,743 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 138,352,916 - 138,361,702 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 142,160,007 - 142,178,024 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 139,959,365 - 139,969,320 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 5 131,431,800 - 131,449,612 (-) NCBI Celera Cytogenetic Map 5 q36 NCBI
PPIH Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 42,658,423 - 42,681,654 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 42,658,335 - 42,676,758 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 43,124,094 - 43,142,429 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 42,896,635 - 42,915,016 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 42,793,140 - 42,811,521 NCBI Celera 1 41,405,975 - 41,424,356 (+) NCBI Celera Cytogenetic Map 1 p34.2 NCBI HuRef 1 41,244,218 - 41,262,600 (+) NCBI HuRef CHM1_1 1 43,240,906 - 43,259,287 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 42,528,918 - 42,552,149 (+) NCBI T2T-CHM13v2.0
Ppih Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 119,157,207 - 119,177,720 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 119,157,207 - 119,177,743 (-) Ensembl GRCm39 Ensembl GRCm38 4 119,300,010 - 119,320,523 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 119,300,010 - 119,320,546 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 118,972,615 - 118,993,128 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 118,797,947 - 118,818,411 (-) NCBI MGSCv36 mm8 Celera 4 118,027,842 - 118,048,366 (-) NCBI Celera Cytogenetic Map 4 D2.1 NCBI cM Map 4 55.34 NCBI
Ppih Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955537 2,211,410 - 2,230,452 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955537 2,211,566 - 2,229,444 (+) NCBI ChiLan1.0 ChiLan1.0
PPIH Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 184,130,421 - 184,153,502 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 183,272,085 - 183,295,157 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 41,958,260 - 41,981,598 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 43,336,039 - 43,354,609 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 43,336,039 - 43,353,898 (+) Ensembl panpan1.1 panPan2
PPIH Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 15 671,323 - 689,627 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 15 671,324 - 689,544 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 15 926,045 - 944,371 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 15 752,681 - 771,039 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 15 752,682 - 770,962 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 15 662,128 - 680,381 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 15 723,569 - 741,836 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 15 738,714 - 757,011 (-) NCBI UU_Cfam_GSD_1.0
Ppih Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 58,179,131 - 58,200,103 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936474 24,003,827 - 24,024,922 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936474 24,003,963 - 24,024,885 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PPIH Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 168,742,005 - 168,760,286 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 168,741,999 - 168,760,350 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 156,223,015 - 156,241,360 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PPIH Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 90,250,959 - 90,275,275 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 90,256,081 - 90,274,751 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666033 26,635,055 - 26,659,466 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Ppih
.
Predicted Target Of
Count of predictions: 132 Count of miRNA genes: 102 Interacting mature miRNAs: 109 Transcripts: ENSRNOT00000064712, ENSRNOT00000067943 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1331796 Thshl2 Thyroid stimulating hormone level QTL 2 2.3 blood thyroid-stimulating hormone amount (VT:0005119) serum thyroid stimulating hormone level (CMO:0001248) 5 97059760 147465714 Rat 10053720 Scort26 Serum corticosterone level QTL 26 2.06 0.0147 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 5 124965598 166875058 Rat 1549845 Scl44 Serum cholesterol level QTL 44 6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 40128307 148607290 Rat 8552960 Pigfal15 Plasma insulin-like growth factor 1 level QTL 15 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 111416838 156416838 Rat 1300122 Wbc1 White blood cell count QTL 1 2.75 leukocyte quantity (VT:0000217) total white blood cell count (CMO:0000365) 5 125392826 139989768 Rat 7365049 Bp359 Blood pressure QTL 359 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 128071929 134724733 Rat 61452 Ciaa5 CIA Autoantibody QTL 5 3.5 blood autoantibody amount (VT:0003725) calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281) 5 94858972 143070159 Rat 70156 Niddm30 Non-insulin dependent diabetes mellitus QTL 30 3.98 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 5 129132447 151006154 Rat 8552908 Pigfal4 Plasma insulin-like growth factor 1 level QTL 4 6.6 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 128506074 166875058 Rat 1331803 Rf32 Renal function QTL 32 2.798 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 5 129132428 143070159 Rat 61393 Bp7 Blood pressure QTL 7 4.5 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 60293434 161481680 Rat 7794791 Mcs33 Mammary carcinoma susceptibility QTL 33 1.93 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 5 131345754 166875058 Rat 7207486 Bss109 Bone structure and strength QTL 109 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 5 106906205 151906205 Rat 7207481 Bss106 Bone structure and strength QTL 106 7.9 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 5 106906205 151906205 Rat 1302790 Scl20 Serum cholesterol level QTL 20 6.4 0.0001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 82394392 166664054 Rat 1598861 Cm64 Cardiac mass QTL 64 2.9 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 127798274 166875058 Rat 1578766 Tcas11 Tongue tumor susceptibility QTL 11 4.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 5 46711509 161317411 Rat 631505 Bp103 Blood pressure QTL 103 3.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 132717196 165560427 Rat 1549838 Bss4 Bone structure and strength QTL 4 9.2 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 5 106906205 151906205 Rat 1641920 Colcs1 Colorectal carcinoma susceptibility QTL 1 2.99 0.0055 intestine integrity trait (VT:0010554) benign colorectal tumor surface area measurement (CMO:0001799) 5 121846814 166846814 Rat 1581505 Rf54 Renal function QTL 54 kidney physiology trait (VT:0002136) kidney 20-HETE level (CMO:0001854) 5 128033842 133011550 Rat 2317753 Glom24 Glomerulus QTL 24 3.1 kidney glomerulus integrity trait (VT:0010546) kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269) 5 97570330 136479578 Rat 8694169 Bw148 Body weight QTL 148 5 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 128506074 166875058 Rat 8657050 Bw146 Body weight QTL 146 19.84 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 108938288 153938288 Rat 1581510 Cm54 Cardiac mass QTL 54 3.4 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 5 120740824 143608494 Rat 1576312 Emca8 Estrogen-induced mammary cancer QTL 8 4.1 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 50328551 141643988 Rat 1641912 Alcrsp18 Alcohol response QTL 18 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 5 35189153 141643988 Rat 1576314 Eutr1 Estrogen induced uterine response QTL 1 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 2138965 166875058 Rat 2317056 Wbc3 White blood cell count QTL 3 2.51 0.01 leukocyte quantity (VT:0000217) white blood cell count (CMO:0000027) 5 105999803 150999803 Rat 634349 Bp139 Blood pressure QTL 139 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 128924607 166875058 Rat 7394710 Emca12 Estrogen-induced mammary cancer QTL 12 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 124160767 133749643 Rat 724525 Bp147 Blood pressure QTL 147 4.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 126424772 166875058 Rat 1598847 Cm62 Cardiac mass QTL 62 3.4 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 108845856 153845856 Rat 2293642 Bss37 Bone structure and strength QTL 37 4.64 0.0001 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 5 120740824 151018848 Rat 1578673 Bmd13 Bone mineral density QTL 13 4.9 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 5 103689353 148689353 Rat 738018 Anxrr4 Anxiety related response QTL 4 5.1 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 5 130130159 166875058 Rat 7207488 Bss110 Bone structure and strength QTL 1 8.4 femur strength trait (VT:0010010) femur stiffness (CMO:0001674) 5 106906205 151906205 Rat 8694441 Bw169 Body weight QTL 169 17.61 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 5 111416838 156416838 Rat 631527 Tls1 T-lymphoma susceptibility QTL 1 0 0.001 thymus integrity trait (VT:0010555) post-insult time to onset of T-cell lymphoma (CMO:0001907) 5 90450144 135450144 Rat 7207491 Bss112 Bone structure and strength QTL 112 7 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 5 106906205 151906205 Rat 8694389 Bw160 Body weight QTL 160 6.17 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 5 111416838 156416838 Rat 61426 Scl2 Serum cholesterol level QTL 2 7.3 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 59793399 143070159 Rat 1354598 Srn6 Serum renin concentration QTL 6 3.8 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 5 69540295 151018848 Rat 8694198 Abfw3 Abdominal fat weight QTL 3 16.13 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 5 111416838 156416838 Rat 1298089 Scl14 Serum cholesterol level QTL 14 5.8 0.0004 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 108845856 153845856 Rat 1598819 Bp292 Blood pressure QTL 292 4.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 127798274 166875058 Rat 1358187 Emca1 Estrogen-induced mammary cancer QTL 1 4.4 mammary gland integrity trait (VT:0010552) post-insult time to mammary tumor formation (CMO:0000345) 5 99216724 148607142 Rat
D5Got61
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 132,914,427 - 132,914,706 (+) MAPPER mRatBN7.2 Rnor_6.0 5 138,351,877 - 138,352,155 NCBI Rnor6.0 Rnor_5.0 5 142,168,168 - 142,168,446 UniSTS Rnor5.0 RGSC_v3.4 5 139,891,233 - 139,891,512 RGD RGSC3.4 RGSC_v3.4 5 139,891,234 - 139,891,512 UniSTS RGSC3.4 RGSC_v3.1 5 139,896,460 - 139,896,738 RGD Celera 5 131,439,743 - 131,440,021 UniSTS RH 3.4 Map 5 870.8 UniSTS RH 3.4 Map 5 870.8 RGD RH 2.0 Map 5 863.1 RGD Cytogenetic Map 5 q36 UniSTS
RH138343
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 132,912,194 - 132,912,346 (+) MAPPER mRatBN7.2 Rnor_6.0 5 138,349,644 - 138,349,795 NCBI Rnor6.0 Rnor_5.0 5 142,165,717 - 142,165,868 UniSTS Rnor5.0 RGSC_v3.4 5 139,889,001 - 139,889,152 UniSTS RGSC3.4 Celera 5 131,437,510 - 131,437,661 UniSTS RH 3.4 Map 5 866.2 UniSTS RH 3.4 Map 5 868.5 UniSTS Cytogenetic Map 5 q36 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000064712 ⟹ ENSRNOP00000063468
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 132,916,003 - 132,924,267 (-) Ensembl Rnor_6.0 Ensembl 5 138,353,452 - 138,361,702 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000067943 ⟹ ENSRNOP00000059353
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 132,915,467 - 132,924,267 (-) Ensembl Rnor_6.0 Ensembl 5 138,352,916 - 138,361,702 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000098415 ⟹ ENSRNOP00000076976
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 132,915,757 - 132,924,267 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000108155 ⟹ ENSRNOP00000088556
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 132,906,328 - 132,924,265 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000112897 ⟹ ENSRNOP00000079411
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 132,912,180 - 132,924,265 (-) Ensembl
RefSeq Acc Id:
NM_001399453 ⟹ NP_001386382
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 138,191,624 - 138,209,580 (-) NCBI mRatBN7.2 5 132,906,324 - 132,924,280 (-) NCBI
RefSeq Acc Id:
XM_006238771 ⟹ XP_006238833
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 138,197,493 - 138,209,625 (-) NCBI mRatBN7.2 5 132,912,046 - 132,924,341 (-) NCBI Rnor_6.0 5 138,349,495 - 138,361,743 (-) NCBI Rnor_5.0 5 142,160,007 - 142,178,024 (-) NCBI
Sequence:
CCTGTCACCGGAAGTTAGGCTTCTACTTCCGAGTCAAAGCCATGGCGGTGGCAAATTCAAGTCCCGTCAATCCAGTGGTCTTCTTTGATGTCAGTATTGGCGGCCAGGAAGTTGGTCGCATGAAGATC
hide sequence
RefSeq Acc Id:
XM_006238772 ⟹ XP_006238834
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 138,197,493 - 138,209,625 (-) NCBI mRatBN7.2 5 132,912,046 - 132,924,341 (-) NCBI Rnor_6.0 5 138,349,495 - 138,361,743 (-) NCBI Rnor_5.0 5 142,160,007 - 142,178,024 (-) NCBI
Sequence:
CCTGTCACCGGAAGTTAGGCTTCTACTTCCGAGTCAAAGCCATGGCGGTGGCAAATTCAAGTCC
hide sequence
RefSeq Acc Id:
XP_006238833 ⟸ XM_006238771
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I5ZMT9 (UniProtKB/TrEMBL), A6JZN2 (UniProtKB/TrEMBL), A0A8I6A6F0 (UniProtKB/TrEMBL)
- Sequence:
MAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCS
hide sequence
RefSeq Acc Id:
XP_006238834 ⟸ XM_006238772
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I5ZMT9 (UniProtKB/TrEMBL), A6JZN2 (UniProtKB/TrEMBL), A0A8I6A6F0 (UniProtKB/TrEMBL)
- Sequence:
MAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGST
hide sequence
Ensembl Acc Id:
ENSRNOP00000059353 ⟸ ENSRNOT00000067943
Ensembl Acc Id:
ENSRNOP00000063468 ⟸ ENSRNOT00000064712
Ensembl Acc Id:
ENSRNOP00000088556 ⟸ ENSRNOT00000108155
Ensembl Acc Id:
ENSRNOP00000076976 ⟸ ENSRNOT00000098415
Ensembl Acc Id:
ENSRNOP00000079411 ⟸ ENSRNOT00000112897
RefSeq Acc Id:
NP_001386382 ⟸ NM_001399453
- UniProtKB:
A0A8I6A6F0 (UniProtKB/TrEMBL), A0A8I5ZMT9 (UniProtKB/TrEMBL), A6JZN2 (UniProtKB/TrEMBL)
RGD ID: 13693984 Promoter ID: EPDNEW_R4505 Type: multiple initiation site Name: Ppih_1 Description: peptidylprolyl isomerase H SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 5 138,361,727 - 138,361,787 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-01-21
Ppih
peptidylprolyl isomerase H
Ppih
peptidylprolyl isomerase H (cyclophilin H)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2010-05-05
Ppih
peptidylprolyl isomerase H (cyclophilin H)
RGD1564921
similar to peptidyl prolyl isomerase H
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
RGD1564921
similar to peptidyl prolyl isomerase H
RGD1564921_predicted
similar to peptidyl prolyl isomerase H (predicted)
'predicted' is removed
2292626 APPROVED
2006-03-07
RGD1564921_predicted
similar to peptidyl prolyl isomerase H (predicted)
LOC366461
similar to peptidyl prolyl isomerase H
Symbol and Name status set to approved
1299863 APPROVED
2006-02-09
LOC366461
similar to peptidyl prolyl isomerase H
Symbol and Name status set to provisional
70820 PROVISIONAL
