Symbol:
Cnot2
Name:
CCR4-NOT transcription complex, subunit 2
RGD ID:
1311672
Description:
Predicted to enable transcription corepressor binding activity. Predicted to contribute to poly(A)-specific ribonuclease activity. Predicted to be involved in several processes, including negative regulation of intracellular estrogen receptor signaling pathway; positive regulation of cytoplasmic mRNA processing body assembly; and regulation of RNA metabolic process. Predicted to be located in cytosol; nucleoplasm; and plasma membrane. Predicted to be part of CCR4-NOT core complex. Predicted to be active in P-body. Orthologous to human CNOT2 (CCR4-NOT transcription complex subunit 2); PARTICIPATES IN microRNA pathway; RNA degradation pathway; INTERACTS WITH 2,6-dinitrotoluene; 6-propyl-2-thiouracil; bisphenol A.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
CCR4-NOT transcription complex subunit 2; LOC299805
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
CNOT2 (CCR4-NOT transcription complex subunit 2) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB
Mus musculus (house mouse):
Cnot2 (CCR4-NOT transcription complex, subunit 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Cnot2 (CCR4-NOT transcription complex subunit 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
CNOT2 (CCR4-NOT transcription complex subunit 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
CNOT2 (CCR4-NOT transcription complex subunit 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Cnot2 (CCR4-NOT transcription complex subunit 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
CNOT2 (CCR4-NOT transcription complex subunit 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
CNOT2 (CCR4-NOT transcription complex subunit 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Cnot2 (CCR4-NOT transcription complex subunit 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
ZNF696 (zinc finger protein 696) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
CNOT2 (CCR4-NOT transcription complex subunit 2)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Cnot2 (CCR4-NOT transcription complex, subunit 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
cnot2 (CCR4-NOT transcription complex, subunit 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
CDC36
Alliance
DIOPT (OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG15262
Alliance
DIOPT (Ensembl Compara|Hieranoid|PANTHER|PhylomeDB)
Drosophila melanogaster (fruit fly):
Rga
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
ntl-2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
cnot2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 54,016,447 - 54,117,511 (-) NCBI GRCr8 mRatBN7.2 7 52,130,445 - 52,222,338 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 52,130,441 - 52,223,575 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 54,037,151 - 54,128,665 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 56,240,245 - 56,331,759 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 56,018,227 - 56,109,741 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 59,526,105 - 59,617,307 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 59,527,124 - 59,587,385 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 59,537,579 - 59,628,786 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 55,823,982 - 55,880,812 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 55,844,724 - 55,901,542 (-) NCBI Celera 7 48,914,667 - 48,971,519 (-) NCBI Celera Cytogenetic Map 7 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Cnot2 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO CNOT2 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of CNOT2 mRNA CTD PMID:22079256 Cnot2 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO Cnot2 (Mus musculus) 6480464 epigallocatechin gallate inhibits the reaction [1 and 3-dichloro-2-propanol results in increased expression of CNOT2 protein] CTD PMID:30092300 Cnot2 Rat 1,2-dimethylhydrazine multiple interactions ISO Cnot2 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of CNOT2 mRNA CTD PMID:22206623 Cnot2 Rat 1,2-dimethylhydrazine decreases expression ISO Cnot2 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of CNOT2 mRNA CTD PMID:22206623 Cnot2 Rat 1,3-dichloropropan-2-ol increases expression ISO Cnot2 (Mus musculus) 6480464 1 and 3-dichloro-2-propanol results in increased expression of CNOT2 protein CTD PMID:30092300 Cnot2 Rat 1,3-dichloropropan-2-ol multiple interactions ISO Cnot2 (Mus musculus) 6480464 epigallocatechin gallate inhibits the reaction [1 and 3-dichloro-2-propanol results in increased expression of CNOT2 protein] CTD PMID:30092300 Cnot2 Rat 17beta-estradiol decreases expression ISO CNOT2 (Homo sapiens) 6480464 Estradiol results in decreased expression of CNOT2 mRNA CTD PMID:19167446 Cnot2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO CNOT2 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the expression of CNOT2 mRNA CTD PMID:22298810 Cnot2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Cnot2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of CNOT2 mRNA CTD PMID:21570461 Cnot2 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of CNOT2 mRNA CTD PMID:21346803 Cnot2 Rat 3,4-methylenedioxymethamphetamine decreases expression ISO Cnot2 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of CNOT2 mRNA CTD PMID:26251327 Cnot2 Rat 3-phenylprop-2-enal decreases expression ISO CNOT2 (Homo sapiens) 6480464 cinnamaldehyde results in decreased expression of CNOT2 mRNA CTD PMID:19524605 Cnot2 Rat 4,4'-diaminodiphenylmethane increases expression ISO Cnot2 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of CNOT2 mRNA CTD PMID:18648102 Cnot2 Rat 4,4'-sulfonyldiphenol multiple interactions ISO CNOT2 (Homo sapiens) 6480464 [bisphenol S co-treated with Fulvestrant] results in decreased methylation of CNOT2 gene CTD PMID:31601247 Cnot2 Rat 4-phenylbutyric acid decreases expression ISO CNOT2 (Homo sapiens) 6480464 4-phenylbutyric acid results in decreased expression of CNOT2 mRNA CTD PMID:14583596 Cnot2 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of CNOT2 mRNA CTD PMID:30047161 Cnot2 Rat aflatoxin B1 decreases methylation ISO CNOT2 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of CNOT2 gene CTD PMID:27153756 Cnot2 Rat aristolochic acid A decreases expression ISO CNOT2 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of CNOT2 mRNA CTD PMID:33212167 Cnot2 Rat Aroclor 1254 decreases expression ISO CNOT2 (Homo sapiens) 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of CNOT2 mRNA CTD PMID:16934159 Cnot2 Rat Aroclor 1254 decreases expression ISO Cnot2 (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of CNOT2 mRNA CTD PMID:23650126 Cnot2 Rat arsenite(3-) multiple interactions ISO CNOT2 (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to CNOT2 mRNA] CTD PMID:32406909 Cnot2 Rat arsenous acid decreases expression ISO CNOT2 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of CNOT2 mRNA CTD PMID:15761015 Cnot2 Rat benzo[a]pyrene increases expression ISO Cnot2 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of CNOT2 mRNA CTD PMID:22228805 Cnot2 Rat benzo[a]pyrene diol epoxide I decreases expression ISO CNOT2 (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 and PMID:20382639 Cnot2 Rat benzo[a]pyrene diol epoxide I increases expression ISO CNOT2 (Homo sapiens) 6480464 7 more ... CTD PMID:26238291 Cnot2 Rat beta-lapachone increases expression ISO CNOT2 (Homo sapiens) 6480464 beta-lapachone results in increased expression of CNOT2 mRNA CTD PMID:38218311 Cnot2 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of CNOT2 mRNA CTD PMID:25181051 Cnot2 Rat bisphenol A increases methylation ISO CNOT2 (Homo sapiens) 6480464 bisphenol A results in increased methylation of CNOT2 gene CTD PMID:31601247 Cnot2 Rat bisphenol A decreases expression ISO Cnot2 (Mus musculus) 6480464 bisphenol A results in decreased expression of CNOT2 mRNA CTD PMID:33221593 Cnot2 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Genistein] results in increased methylation of CNOT2 gene CTD PMID:28505145 Cnot2 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of CNOT2 gene CTD PMID:28505145 Cnot2 Rat Brodifacoum increases expression EXP 6480464 bromfenacoum results in increased expression of CNOT2 protein CTD PMID:28903499 Cnot2 Rat butanal decreases expression ISO CNOT2 (Homo sapiens) 6480464 butyraldehyde results in decreased expression of CNOT2 mRNA CTD PMID:26079696 Cnot2 Rat cadmium dichloride decreases expression ISO CNOT2 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of CNOT2 mRNA CTD PMID:38568856 Cnot2 Rat caffeine decreases phosphorylation ISO CNOT2 (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of CNOT2 protein CTD PMID:35688186 Cnot2 Rat CGP 52608 multiple interactions ISO CNOT2 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to CNOT2 gene] CTD PMID:28238834 Cnot2 Rat diarsenic trioxide decreases expression ISO CNOT2 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of CNOT2 mRNA CTD PMID:15761015 Cnot2 Rat Dibutyl phosphate affects expression ISO CNOT2 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of CNOT2 mRNA CTD PMID:37042841 Cnot2 Rat dibutyl phthalate decreases expression ISO Cnot2 (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of CNOT2 mRNA CTD PMID:21266533 Cnot2 Rat dicrotophos decreases expression ISO CNOT2 (Homo sapiens) 6480464 dicrotophos results in decreased expression of CNOT2 mRNA CTD PMID:28302478 Cnot2 Rat enzyme inhibitor multiple interactions ISO CNOT2 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of CNOT2 protein CTD PMID:23301498 Cnot2 Rat fenthion decreases expression ISO Cnot2 (Mus musculus) 6480464 Fenthion results in decreased expression of CNOT2 mRNA CTD PMID:34813904 Cnot2 Rat folic acid multiple interactions ISO Cnot2 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of CNOT2 mRNA CTD PMID:22206623 Cnot2 Rat formaldehyde decreases expression ISO CNOT2 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of CNOT2 mRNA CTD PMID:20655997 Cnot2 Rat FR900359 increases phosphorylation ISO CNOT2 (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of CNOT2 protein CTD PMID:37730182 Cnot2 Rat fulvestrant multiple interactions ISO CNOT2 (Homo sapiens) 6480464 [bisphenol S co-treated with Fulvestrant] results in decreased methylation of CNOT2 gene CTD PMID:31601247 Cnot2 Rat genistein multiple interactions EXP 6480464 [bisphenol A co-treated with Genistein] results in increased methylation of CNOT2 gene CTD PMID:28505145 Cnot2 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of CNOT2 mRNA CTD PMID:22061828 Cnot2 Rat hexadecanoic acid increases phosphorylation ISO CNOT2 (Homo sapiens) 6480464 Palmitic Acid results in increased phosphorylation of CNOT2 protein CTD PMID:28073184 Cnot2 Rat hydrogen peroxide affects expression ISO CNOT2 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of CNOT2 mRNA CTD PMID:20044591 Cnot2 Rat ivermectin decreases expression ISO CNOT2 (Homo sapiens) 6480464 Ivermectin results in decreased expression of CNOT2 protein CTD PMID:32959892 Cnot2 Rat manganese atom decreases expression ISO CNOT2 (Homo sapiens) 6480464 Manganese results in decreased expression of CNOT2 mRNA CTD PMID:17175027 Cnot2 Rat manganese(0) decreases expression ISO CNOT2 (Homo sapiens) 6480464 Manganese results in decreased expression of CNOT2 mRNA CTD PMID:17175027 Cnot2 Rat manganese(II) chloride decreases expression ISO CNOT2 (Homo sapiens) 6480464 manganese chloride results in decreased expression of CNOT2 mRNA CTD PMID:17175027 Cnot2 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of CNOT2 mRNA CTD PMID:30047161 Cnot2 Rat methyl methanesulfonate increases expression ISO CNOT2 (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of CNOT2 mRNA CTD PMID:23649840 Cnot2 Rat ochratoxin A decreases acetylation ISO CNOT2 (Homo sapiens) 6480464 ochratoxin A results in decreased acetylation of CNOT2 promoter CTD PMID:29098329 Cnot2 Rat ochratoxin A multiple interactions ISO CNOT2 (Homo sapiens) 6480464 [ochratoxin A results in decreased acetylation of CNOT2 promoter] which results in decreased expression of CNOT2 mRNA CTD PMID:29098329 Cnot2 Rat ochratoxin A decreases expression ISO CNOT2 (Homo sapiens) 6480464 ochratoxin A results in decreased expression of CNOT2 mRNA CTD PMID:29098329 Cnot2 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of CNOT2 mRNA CTD PMID:25729387 Cnot2 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of CNOT2 mRNA CTD PMID:33387578 Cnot2 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Cnot2 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Pectins] results in decreased expression of CNOT2 mRNA CTD PMID:36331819 Cnot2 Rat potassium chromate decreases expression ISO CNOT2 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of CNOT2 mRNA CTD PMID:22079256 Cnot2 Rat potassium chromate multiple interactions ISO CNOT2 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of CNOT2 mRNA CTD PMID:22079256 Cnot2 Rat pregnenolone 16alpha-carbonitrile decreases expression EXP 6480464 Pregnenolone Carbonitrile results in decreased expression of CNOT2 mRNA CTD PMID:30047161 Cnot2 Rat sodium arsenate decreases expression ISO Cnot2 (Mus musculus) 6480464 sodium arsenate results in decreased expression of CNOT2 mRNA CTD PMID:30953684 Cnot2 Rat sulfadimethoxine decreases expression EXP 6480464 Sulfadimethoxine results in decreased expression of CNOT2 mRNA CTD PMID:30047161 Cnot2 Rat titanium dioxide increases methylation ISO Cnot2 (Mus musculus) 6480464 titanium dioxide results in increased methylation of CNOT2 gene and titanium dioxide results in increased methylation of CNOT2 promoter CTD PMID:35295148 Cnot2 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of CNOT2 mRNA CTD PMID:25729387 Cnot2 Rat topotecan decreases expression EXP 6480464 Topotecan results in decreased expression of CNOT2 mRNA CTD PMID:25729387 Cnot2 Rat trichostatin A decreases expression ISO CNOT2 (Homo sapiens) 6480464 trichostatin A results in decreased expression of CNOT2 mRNA CTD PMID:24935251 Cnot2 Rat trichostatin A affects expression ISO CNOT2 (Homo sapiens) 6480464 trichostatin A affects the expression of CNOT2 mRNA CTD PMID:28542535 Cnot2 Rat triptonide increases expression ISO Cnot2 (Mus musculus) 6480464 triptonide results in increased expression of CNOT2 mRNA CTD PMID:33045310 Cnot2 Rat triptonide affects expression ISO Cnot2 (Mus musculus) 6480464 triptonide affects the expression of CNOT2 mRNA CTD PMID:33045310 Cnot2 Rat troglitazone decreases expression ISO Cnot2 (Mus musculus) 6480464 troglitazone results in decreased expression of CNOT2 mRNA CTD PMID:28973697 Cnot2 Rat valproic acid affects expression ISO Cnot2 (Mus musculus) 6480464 Valproic Acid affects the expression of CNOT2 mRNA CTD PMID:17963808 Cnot2 Rat valproic acid affects expression ISO CNOT2 (Homo sapiens) 6480464 Valproic Acid affects the expression of CNOT2 mRNA CTD PMID:25979313 Cnot2 Rat valproic acid decreases methylation ISO CNOT2 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of CNOT2 gene CTD PMID:29154799 Cnot2 Rat valproic acid decreases expression ISO CNOT2 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of CNOT2 mRNA CTD PMID:22083351 more ...
Imported Annotations - KEGG (archival)
(-)-epigallocatechin 3-gallate (ISO) 1,2-dimethylhydrazine (ISO) 1,3-dichloropropan-2-ol (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,6-dinitrotoluene (EXP) 3,4-methylenedioxymethamphetamine (ISO) 3-phenylprop-2-enal (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 4-phenylbutyric acid (ISO) 6-propyl-2-thiouracil (EXP) aflatoxin B1 (ISO) aristolochic acid A (ISO) Aroclor 1254 (ISO) arsenite(3-) (ISO) arsenous acid (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) beta-lapachone (ISO) bisphenol A (EXP,ISO) Brodifacoum (EXP) butanal (ISO) cadmium dichloride (ISO) caffeine (ISO) CGP 52608 (ISO) diarsenic trioxide (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (ISO) dicrotophos (ISO) enzyme inhibitor (ISO) fenthion (ISO) folic acid (ISO) formaldehyde (ISO) FR900359 (ISO) fulvestrant (ISO) genistein (EXP) gentamycin (EXP) hexadecanoic acid (ISO) hydrogen peroxide (ISO) ivermectin (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methimazole (EXP) methyl methanesulfonate (ISO) ochratoxin A (ISO) oxaliplatin (EXP) paracetamol (EXP) perfluorooctane-1-sulfonic acid (ISO) potassium chromate (ISO) pregnenolone 16alpha-carbonitrile (EXP) sodium arsenate (ISO) sulfadimethoxine (EXP) titanium dioxide (ISO) topotecan (EXP) trichostatin A (ISO) triptonide (ISO) troglitazone (ISO) valproic acid (ISO)
Cnot2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 54,016,447 - 54,117,511 (-) NCBI GRCr8 mRatBN7.2 7 52,130,445 - 52,222,338 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 52,130,441 - 52,223,575 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 54,037,151 - 54,128,665 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 56,240,245 - 56,331,759 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 56,018,227 - 56,109,741 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 59,526,105 - 59,617,307 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 59,527,124 - 59,587,385 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 59,537,579 - 59,628,786 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 55,823,982 - 55,880,812 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 55,844,724 - 55,901,542 (-) NCBI Celera 7 48,914,667 - 48,971,519 (-) NCBI Celera Cytogenetic Map 7 q22 NCBI
CNOT2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 12 70,243,018 - 70,354,993 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 12 70,243,002 - 70,354,993 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 12 70,636,798 - 70,748,773 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 12 68,923,044 - 69,035,040 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 12 68,923,488 - 69,033,960 NCBI Celera 12 70,300,448 - 70,412,447 (+) NCBI Celera Cytogenetic Map 12 q15 NCBI HuRef 12 67,686,934 - 67,798,932 (+) NCBI HuRef CHM1_1 12 70,606,077 - 70,718,081 (+) NCBI CHM1_1 T2T-CHM13v2.0 12 70,222,411 - 70,334,463 (+) NCBI T2T-CHM13v2.0
Cnot2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 10 116,321,065 - 116,418,891 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 10 116,321,066 - 116,417,416 (-) Ensembl GRCm39 Ensembl GRCm38 10 116,485,160 - 116,581,900 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 10 116,485,161 - 116,581,511 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 10 115,922,217 - 116,018,567 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 10 115,889,276 - 115,985,621 (-) NCBI MGSCv36 mm8 Celera 10 118,426,741 - 118,523,052 (-) NCBI Celera Cytogenetic Map 10 D2 NCBI cM Map 10 64.76 NCBI
Cnot2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955405 10,451,414 - 10,547,229 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955405 10,451,414 - 10,547,229 (+) NCBI ChiLan1.0 ChiLan1.0
CNOT2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 10 78,258,520 - 78,370,806 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 12 78,255,483 - 78,367,205 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 12 67,753,703 - 67,865,375 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 12 70,520,722 - 70,633,149 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 12 70,520,722 - 70,633,149 (+) Ensembl panpan1.1 panPan2
CNOT2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 10 12,057,269 - 12,174,405 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 10 12,009,762 - 12,172,427 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 10 11,995,863 - 12,112,451 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 10 12,188,879 - 12,305,324 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 10 12,141,268 - 12,305,312 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 10 12,055,404 - 12,171,985 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 10 12,302,721 - 12,419,265 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 10 12,426,002 - 12,542,252 (+) NCBI UU_Cfam_GSD_1.0
Cnot2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404945 46,069,715 - 46,170,762 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936545 7,938,934 - 8,042,117 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936545 7,938,934 - 8,040,409 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
CNOT2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 5 34,426,394 - 34,549,310 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 5 34,470,911 - 34,548,968 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 5 37,132,108 - 37,207,783 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
CNOT2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 11 65,823,294 - 65,932,588 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 11 65,861,353 - 65,934,042 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666037 179,752,841 - 179,862,945 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Cnot2
.
Predicted Target Of
Count of predictions: 157 Count of miRNA genes: 124 Interacting mature miRNAs: 134 Transcripts: ENSRNOT00000066396 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
7411569 Bw137 Body weight QTL 137 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 7 21921195 66921195 Rat 1300179 Kidm5 Kidney mass QTL 5 3.51 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 7 43747012 135012528 Rat 2293667 Bss42 Bone structure and strength QTL 42 7.25 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 7 47651439 92651439 Rat 10053722 Scort27 Serum corticosterone level QTL 27 2.41 0.0083 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 7 43228750 88228750 Rat 1578652 Bmd15 Bone mineral density QTL 15 5.2 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 7 9866467 60460686 Rat 1641885 Alcrsp9 Alcohol response QTL 9 alcohol metabolism trait (VT:0015089) blood ethanol level (CMO:0000535) 7 24099606 69099606 Rat 1549840 Bss5 Bone structure and strength QTL 5 9.8 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 7 24751841 69751841 Rat 1300127 Srn1 Serum renin concentration QTL 1 3.87 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 7 29409683 84928080 Rat 10059605 Kidm47 Kidney mass QTL 47 2.91 0.05 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 7 47251783 65728867 Rat 2293678 Bss24 Bone structure and strength QTL 24 6.71 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 7 47651439 92651439 Rat 1358361 Sradr5 Stress Responsive Adrenal Weight QTL 5 5.55 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 7 43747012 108555253 Rat 2298547 Neuinf5 Neuroinflammation QTL 5 3.7 nervous system integrity trait (VT:0010566) spinal cord Cd74 protein level (CMO:0002131) 7 9462246 58265113 Rat 631513 Scl7 Serum cholesterol level QTL 7 4.1 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 7 37960569 82960569 Rat 10059592 Kidm45 Kidney mass QTL 45 3.95 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 7 7573985 52573985 Rat 10755440 Coatc10 Coat color QTL 10 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 7496499 52496499 Rat 2293685 Bmd21 Bone mineral density QTL 21 4.2 0.0003 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 7 47651439 92651439 Rat 10755453 Coatc12 Coat color QTL 12 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 31112832 76112832 Rat 631504 Cm27 Cardiac mass QTL 27 3.45 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 7 44421311 118198041 Rat 1354639 Spl5 Serum phospholipid level QTL 5 3.9 blood LDL phospholipid amount (VT:0010505) blood low density lipoprotein phospholipid level (CMO:0001568) 7 19654317 52888450 Rat 10755451 Coatc11 Coat color QTL 11 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 17944357 62944357 Rat 634326 Hc3 Hypercalciuria QTL 3 2.1 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 7 42787314 87787314 Rat 2317059 Aia15 Adjuvant induced arthritis QTL 15 2.46 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 7 17004598 62004598 Rat 2293696 Bmd32 Bone mineral density QTL 32 5.1 0.0001 femur strength trait (VT:0010010) femoral neck polar moment of inertia (CMO:0001670) 7 47651439 92651439 Rat 7411605 Foco14 Food consumption QTL 14 24.1 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 7 34293282 79293282 Rat 1643004 Pain2 Pain QTL 2 1 mechanical nociception trait (VT:0002734) self mutilation severity score (CMO:0002145) 7 9462246 98011544 Rat 738030 Anxrr8 Anxiety related response QTL 8 4.1 exploratory behavior trait (VT:0010471) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 46590070 91590070 Rat 1300149 Cm6 Cardiac mass QTL 6 4.09 heart mass (VT:0007028) heart left ventricle weight to body weight ratio (CMO:0000530) 7 43747099 102228765 Rat 631534 Lnnr1 Liver neoplastic nodule remodeling QTL 1 3.85 0.001 liver integrity trait (VT:0010547) liver remodeling tumorous lesion number to liver total tumorous lesion number ratio (CMO:0001705) 7 34293282 79293282 Rat 634336 Anxrr17 Anxiety related response QTL 17 3.66 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 924703 115097879 Rat 2293707 Bss32 Bone structure and strength QTL 32 7.64 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 7 47651439 92651439 Rat 61357 Bp38 Blood pressure QTL 38 1.6 0.052 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 41333674 119109060 Rat 2303629 Vencon3 Ventilatory control QTL 3 7.25 respiration trait (VT:0001943) respiration rate (CMO:0000289) 7 41109692 56793354 Rat 2293644 Bmd29 Bone mineral density QTL 29 5.4 0.0001 femur size trait (VT:1000369) femoral neck cross-sectional area (CMO:0001697) 7 47651439 92651439 Rat 70190 Mcs6 Mammary carcinoma susceptibility QTL 6 2.29 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 7 26737401 63902784 Rat 2300178 Bmd54 Bone mineral density QTL 54 5.3 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 7 47651439 92651439 Rat 61428 Scl3 Serum cholesterol level QTL 3 3.2 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 7 44867533 89867533 Rat 1300132 Bp182 Blood pressure QTL 182 3.49 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 7 19654317 84928080 Rat 1300138 Hrtrt9 Heart rate QTL 9 4.72 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 7 29409683 53612950 Rat 10402855 Bp379 Blood pressure QTL 379 0.21 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 29409683 74409683 Rat 738033 Anxrr6 Anxiety related response QTL 6 4.1 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 7 15573889 60573889 Rat
RH144030
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 52,138,261 - 52,138,425 (+) MAPPER mRatBN7.2 Rnor_6.0 7 59,533,922 - 59,534,085 NCBI Rnor6.0 Rnor_5.0 7 59,545,396 - 59,545,559 UniSTS Rnor5.0 RGSC_v3.4 7 55,827,349 - 55,827,512 UniSTS RGSC3.4 Celera 7 48,918,034 - 48,918,197 UniSTS RH 3.4 Map 7 481.5 UniSTS Cytogenetic Map 7 q22 UniSTS
RH140338
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 52,149,611 - 52,149,762 (+) MAPPER mRatBN7.2 Rnor_6.0 7 59,545,272 - 59,545,422 NCBI Rnor6.0 Rnor_5.0 7 59,556,746 - 59,556,896 UniSTS Rnor5.0 RGSC_v3.4 7 55,838,699 - 55,838,849 UniSTS RGSC3.4 Celera 7 48,929,384 - 48,929,534 UniSTS RH 3.4 Map 7 503.6 UniSTS Cytogenetic Map 7 q22 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000066396 ⟹ ENSRNOP00000061277
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 52,134,908 - 52,191,729 (-) Ensembl Rnor_6.0 Ensembl 7 59,530,568 - 59,587,385 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000085836 ⟹ ENSRNOP00000075690
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 52,131,074 - 52,221,608 (-) Ensembl Rnor_6.0 Ensembl 7 59,532,641 - 59,547,174 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000091427 ⟹ ENSRNOP00000074023
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 52,136,860 - 52,221,617 (-) Ensembl Rnor_6.0 Ensembl 7 59,527,124 - 59,587,382 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000100132 ⟹ ENSRNOP00000078367
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 52,130,594 - 52,221,611 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000104908 ⟹ ENSRNOP00000084380
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 52,130,441 - 52,221,617 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000114739 ⟹ ENSRNOP00000077944
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 52,130,443 - 52,221,617 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000118688 ⟹ ENSRNOP00000095291
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 52,130,594 - 52,223,575 (-) Ensembl
RefSeq Acc Id:
NM_001399553 ⟹ NP_001386482
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 54,016,447 - 54,107,960 (-) NCBI mRatBN7.2 7 52,130,445 - 52,221,966 (-) NCBI
RefSeq Acc Id:
NM_001399554 ⟹ NP_001386483
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 54,016,447 - 54,107,960 (-) NCBI mRatBN7.2 7 52,130,445 - 52,221,966 (-) NCBI
RefSeq Acc Id:
NM_001399555 ⟹ NP_001386484
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 54,016,447 - 54,107,960 (-) NCBI mRatBN7.2 7 52,130,445 - 52,221,966 (-) NCBI
RefSeq Acc Id:
NM_001399556 ⟹ NP_001386485
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 54,016,447 - 54,107,960 (-) NCBI mRatBN7.2 7 52,130,445 - 52,221,966 (-) NCBI
RefSeq Acc Id:
XM_006241369 ⟹ XP_006241431
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 54,016,447 - 54,117,511 (-) NCBI mRatBN7.2 7 52,130,453 - 52,222,327 (-) NCBI Rnor_6.0 7 59,526,105 - 59,617,297 (-) NCBI Rnor_5.0 7 59,537,579 - 59,628,786 (-) NCBI
Sequence:
AGGTCTTGCTCCCAGCAGCCTCCGCGGTGGATACGTCGCCATCTTGGATCCGCGGGACAAGAAAATTCATGCGTACTGTGAGGAAAGGACACGACTCTATGGTGAGGACTGATGGACATACATTATCT
hide sequence
RefSeq Acc Id:
XM_017594741 ⟹ XP_017450230
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 54,016,447 - 54,117,511 (-) NCBI mRatBN7.2 7 52,130,448 - 52,222,327 (-) NCBI Rnor_6.0 7 59,526,105 - 59,617,307 (-) NCBI
Sequence:
CAGAGGGTAAAGGTCTTGCTCCCAGCAGCCTCCGCGGTGGATACGTCGCCATCTTGGATCCGCGGGACAAGAAAATTCATGCGAGGGAGAACTGGTGGGCGGTCCTTCCTGTGACACGACCCTTGAGT
hide sequence
RefSeq Acc Id:
XM_039078717 ⟹ XP_038934645
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 54,016,447 - 54,107,312 (-) NCBI mRatBN7.2 7 52,130,453 - 52,221,318 (-) NCBI
RefSeq Acc Id:
XM_039078720 ⟹ XP_038934648
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 54,016,447 - 54,117,511 (-) NCBI mRatBN7.2 7 52,130,453 - 52,222,326 (-) NCBI
RefSeq Acc Id:
XM_039078728 ⟹ XP_038934656
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 54,016,447 - 54,117,511 (-) NCBI mRatBN7.2 7 52,131,062 - 52,222,328 (-) NCBI
RefSeq Acc Id:
XM_039078730 ⟹ XP_038934658
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 54,016,447 - 54,117,511 (-) NCBI mRatBN7.2 7 52,131,062 - 52,222,327 (-) NCBI
RefSeq Acc Id:
XM_039078732 ⟹ XP_038934660
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 54,016,447 - 54,117,511 (-) NCBI mRatBN7.2 7 52,131,062 - 52,222,328 (-) NCBI
RefSeq Acc Id:
XM_039078735 ⟹ XP_038934663
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 54,016,447 - 54,030,719 (-) NCBI mRatBN7.2 7 52,131,062 - 52,145,999 (-) NCBI
RefSeq Acc Id:
XM_063263224 ⟹ XP_063119294
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 54,016,447 - 54,057,225 (-) NCBI
RefSeq Acc Id:
XM_063263225 ⟹ XP_063119295
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 54,030,621 - 54,117,511 (-) NCBI
RefSeq Acc Id:
XM_063263226 ⟹ XP_063119296
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 54,030,621 - 54,117,511 (-) NCBI
RefSeq Acc Id:
XP_006241431 ⟸ XM_006241369
- Peptide Label:
isoform X3
- UniProtKB:
A0A8I6AJD1 (UniProtKB/TrEMBL)
- Sequence:
MRTVRKGHDSMVRTDGHTLSEKRNYQMLASPSTSGQLSQFGASLYGQQSALGLPMRGMSNNTPQLNRSLSQGTQLPSHVTPTTGVPTMSLHTPPSPSRGILPMNPRNMMNHSQVGQGIGIPSRTNSMS
hide sequence
RefSeq Acc Id:
XP_017450230 ⟸ XM_017594741
- Peptide Label:
isoform X4
- UniProtKB:
A0A8I5ZXR1 (UniProtKB/TrEMBL), A6IGN2 (UniProtKB/TrEMBL)
- Sequence:
MVRTDGHTLSEKRNYQMLASPSTSGQLSQFGASLYGQQSALGLPMRGMSNNTPQLNRSLSQGTQLPSHVTPTTGVPTMSLHTPPSPSRGILPMNPRNMMNHSQVGQGIGIPSRTNSMSSSGLGSPNRS
hide sequence
Ensembl Acc Id:
ENSRNOP00000074023 ⟸ ENSRNOT00000091427
Ensembl Acc Id:
ENSRNOP00000061277 ⟸ ENSRNOT00000066396
Ensembl Acc Id:
ENSRNOP00000075690 ⟸ ENSRNOT00000085836
RefSeq Acc Id:
XP_038934648 ⟸ XM_039078720
- Peptide Label:
isoform X2
- UniProtKB:
A0A0G2KB82 (UniProtKB/TrEMBL), A0A8I6AJD1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038934645 ⟸ XM_039078717
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6AJD1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038934660 ⟸ XM_039078732
- Peptide Label:
isoform X8
- UniProtKB:
A6IGN0 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038934656 ⟸ XM_039078728
- Peptide Label:
isoform X6
- UniProtKB:
A6IGN1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038934658 ⟸ XM_039078730
- Peptide Label:
isoform X7
- UniProtKB:
A0A8I5ZKS1 (UniProtKB/TrEMBL), A6IGN1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038934663 ⟸ XM_039078735
- Peptide Label:
isoform X11
- UniProtKB:
A6IGP2 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000084380 ⟸ ENSRNOT00000104908
Ensembl Acc Id:
ENSRNOP00000095291 ⟸ ENSRNOT00000118688
Ensembl Acc Id:
ENSRNOP00000077944 ⟸ ENSRNOT00000114739
Ensembl Acc Id:
ENSRNOP00000078367 ⟸ ENSRNOT00000100132
RefSeq Acc Id:
NP_001386485 ⟸ NM_001399556
- Peptide Label:
isoform 4
- UniProtKB:
A6IGP1 (UniProtKB/TrEMBL), A6IGN5 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001386482 ⟸ NM_001399553
- Peptide Label:
Isoform 1
- UniProtKB:
A0A8I5Y9U2 (UniProtKB/TrEMBL), A0A8I6AJD1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001386483 ⟸ NM_001399554
- Peptide Label:
isoform 2
- UniProtKB:
A0A8I6AJD1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001386484 ⟸ NM_001399555
- Peptide Label:
isoform 3
- UniProtKB:
A0A0G2KB82 (UniProtKB/TrEMBL), A0A8I6AJD1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063119294 ⟸ XM_063263224
- Peptide Label:
isoform X5
- UniProtKB:
A6IGP0 (UniProtKB/TrEMBL), A6IGN2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063119295 ⟸ XM_063263225
- Peptide Label:
isoform X9
RefSeq Acc Id:
XP_063119296 ⟸ XM_063263226
- Peptide Label:
isoform X10
BioCyc Gene G2FUF-34033 BioCyc
Ensembl Genes ENSRNOG00000004909 Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript ENSRNOT00000066396 ENTREZGENE
ENSRNOT00000066396.3 UniProtKB/TrEMBL
ENSRNOT00000085836.2 UniProtKB/TrEMBL
ENSRNOT00000091427.2 UniProtKB/TrEMBL
ENSRNOT00000100132 ENTREZGENE
ENSRNOT00000100132.1 UniProtKB/TrEMBL
ENSRNOT00000104908 ENTREZGENE
ENSRNOT00000104908.1 UniProtKB/TrEMBL
ENSRNOT00000114739 ENTREZGENE
ENSRNOT00000114739.1 UniProtKB/TrEMBL
ENSRNOT00000118688.1 UniProtKB/TrEMBL
Gene3D-CATH 2.30.30.1020 UniProtKB/TrEMBL
IMAGE_CLONE IMAGE:7313082 IMAGE-MGC_LOAD
InterPro CCR4-NOT_su2/3/5_N_sf UniProtKB/TrEMBL
NOT UniProtKB/TrEMBL
Not2/3/5 UniProtKB/TrEMBL
MGC_CLONE MGC:105588 IMAGE-MGC_LOAD
NCBI Gene 299805 ENTREZGENE
PANTHER PTHR23326 UniProtKB/TrEMBL
Pfam NOT2_3_5 UniProtKB/TrEMBL
PhenoGen Cnot2 PhenoGen
RatGTEx ENSRNOG00000004909 RatGTEx
UniProt A0A0G2K717_RAT UniProtKB/TrEMBL
A0A0G2KB82 ENTREZGENE, UniProtKB/TrEMBL
A0A8I5Y9U2 ENTREZGENE, UniProtKB/TrEMBL
A0A8I5ZKS1 ENTREZGENE, UniProtKB/TrEMBL
A0A8I5ZXR1 ENTREZGENE, UniProtKB/TrEMBL
A0A8I6AJD1 ENTREZGENE, UniProtKB/TrEMBL
A6IGN0 ENTREZGENE, UniProtKB/TrEMBL
A6IGN1 ENTREZGENE, UniProtKB/TrEMBL
A6IGN2 ENTREZGENE, UniProtKB/TrEMBL
A6IGN5 ENTREZGENE, UniProtKB/TrEMBL
A6IGP0 ENTREZGENE, UniProtKB/TrEMBL
A6IGP1 ENTREZGENE, UniProtKB/TrEMBL
A6IGP2 ENTREZGENE, UniProtKB/TrEMBL
Q5PPJ8_RAT UniProtKB/TrEMBL
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2005-12-06
Cnot2
CCR4-NOT transcription complex, subunit 2
Cnot2_predicted
CCR4-NOT transcription complex, subunit 2 (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-12
Cnot2_predicted
CCR4-NOT transcription complex, subunit 2 (predicted)
Symbol and Name status set to approved
70820 APPROVED
