Symbol:
Mthfr
Name:
methylenetetrahydrofolate reductase
RGD ID:
1309952
Description:
Enables NADP binding activity; flavin adenine dinucleotide binding activity; and methylenetetrahydrofolate reductase (NAD(P)H) activity. Involved in several processes, including homocysteine metabolic process; response to interleukin-1; and response to vitamin B2. Predicted to be active in cytosol. Biomarker of hyperthyroidism; hypothyroidism; and liver benign neoplasm. Human ortholog(s) of this gene implicated in several diseases, including carcinoma (multiple); cardiovascular system disease (multiple); hematologic cancer (multiple); kidney failure (multiple); and liver disease (multiple). Orthologous to human MTHFR (methylenetetrahydrofolate reductase); PARTICIPATES IN altered folate cycle metabolic pathway; altered folate mediated one-carbon metabolic pathway; folate cycle metabolic pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2-acetamidofluorene; 3,3',4,4',5-pentachlorobiphenyl.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
5,10-methylenetetrahydrofolate reductase; 5,10-methylenetetrahydrofolate reductase (NADPH); LOC362657; methylenetetrahydrofolate reductase (NAD(P)H); methylenetetrahydrofolate reductase (NADPH)
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Allele / Splice:
Mthfrem1Mcwi
Genetic Models:
SS-Mthfrem1Mcwi
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 163,748,346 - 163,768,141 (+) NCBI GRCr8 mRatBN7.2 5 158,465,248 - 158,484,999 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 158,465,296 - 158,483,797 (+) Ensembl mRatBN7.2 Ensembl Rnor_6.0 5 164,844,642 - 164,864,360 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 164,845,925 - 164,860,910 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 168,502,556 - 168,522,350 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 165,112,850 - 165,126,885 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 165,123,406 - 165,137,073 (+) NCBI Celera 5 156,747,024 - 156,766,742 (+) NCBI Celera Cytogenetic Map 5 q36 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Mthfr Rat abdominal aortic aneurysm ISO RGD:733483 6893584 DNA:transition:cds:g.677C>T (human) RGD Mthfr Rat acute lymphoblastic leukemia disease_progression ISO RGD:733483 10449398 DNA:missense mutation:cds:677C>T (p.A222V) (rs1801133) (human) RGD Mthfr Rat acute lymphoblastic leukemia treatment ISO RGD:733483 10449407 DNA:missense mutation:cds:677C>T (human) RGD Mthfr Rat acute myeloid leukemia ISO RGD:733483 10449408 DNA:SNPs: :677C>T, 1298A>C(human) RGD Mthfr Rat Albuminuria susceptibility ISO RGD:733483 6893631 associated with Diabetes Mellitus, Type 2; DNA:transition, transversion:cds:g.677C>T, g.1298A>C (human) RGD Mthfr Rat alcoholic liver cirrhosis susceptibility ISO RGD:733483 14696749 DNA:SNP: :677C>T(human) RGD Mthfr Rat amyotrophic lateral sclerosis susceptibility ISO RGD:733483 11565111 DNA:polymorphism: :c.677C>T(human) RGD Mthfr Rat amyotrophic lateral sclerosis no_association ISO RGD:733483 11565173 DNA:polymorphism: :c.677C>T(human) RGD Mthfr Rat anemia susceptibility ISO RGD:733483 11080979 associated with Precursor Cell Lymphoblastic Leukemia-Lymphoma; DNA:SNP:: rs1801133(human) RGD Mthfr Rat angle-closure glaucoma susceptibility ISO RGD:733483 7387250 DNA:SNPs: :677C>T,1298A>C(human) RGD Mthfr Rat ankylosing spondylitis susceptibility ISO RGD:733483 42722610 DNA:SNP:cds:677C>T (human) RGD Mthfr Rat Aortic Coarctation ISO RGD:733483 4891157 DNA:transition:cds:g.677C>T (human) RGD Mthfr Rat aphthous stomatitis severity ISO RGD:733483 10449402 DNA:missense mutation:cds:677C>T (rs1801133) (human) RGD Mthfr Rat Arterial Occlusive Diseases ISO RGD:733483 10449401 DNA:SNP: :677C>T (human) RGD Mthfr Rat asthma ISO RGD:733483 4891145 DNA:transition:cds:g.677C>T (human) RGD Mthfr Rat atherosclerosis severity ISO RGD:733483 6893579 associated with Kidney Failure, Chronic; DNA:transversion:cds:g.1298A>C (human) RGD Mthfr Rat attention deficit hyperactivity disorder susceptibility ISO RGD:733483 11565107 DNA:polymorphism: :1298A>C(human) RGD Mthfr Rat attention deficit hyperactivity disorder no_association ISO RGD:733483 11565109 DNA:SNP: :1298A>C,677C>T(human) RGD Mthfr Rat Banti's Syndrome susceptibility ISO RGD:733483 10755472 DNA:SNPs: :DNA:SNPs: :677C>T, 1298A>C(human) RGD Mthfr Rat Budd-Chiari syndrome ISO RGD:733483 10449395 DNA:transition: :677C>T (human) RGD Mthfr Rat Budd-Chiari syndrome susceptibility ISO RGD:733483 11537993 DNA:SNPs: :DNA:SNPs: :677C>T, 1298A>C(human) RGD Mthfr Rat cardia cancer no_association ISO RGD:733483 38501052 associated with stomach cancer;DNA:missense mutation:cds:g.677C>T (human) RGD Mthfr Rat cardiovascular system disease ISO RGD:733483 1580585 DNA:transition, transversion:cds:g.677C>T, g.1298A>C (human) RGD Mthfr Rat carotid stenosis ISO RGD:733483 5509914 DNA:SNP:CDS:rs1801133, c.677C>T, p.A222V, in men only (human) RGD Mthfr Rat cataract susceptibility ISO RGD:733483 7387253 DNA:SNPs, haplotype: : 677C>T, 1298A>C (human) RGD Mthfr Rat cerebral infarction ISO RGD:733483 1580590 DNA:transition:cds:g.677C>T (human) RGD Mthfr Rat cervical cancer susceptibility ISO RGD:733483 9068941 DNA:missense mutation:cds:g.1298A>C (human) RGD PMID:27771518|REF_RGD_ID:38501051 Mthfr Rat Chemical and Drug Induced Liver Injury treatment ISO RGD:733483 14696733 associated with precursor lymphoblastic lymphoma/leukemia; DNA:SNP: :677C>T(human) RGD Mthfr Rat cholangiocarcinoma susceptibility ISO RGD:733483 2317119 DNA:polymorphism (human) RGD Mthfr Rat chronic kidney disease susceptibility ISO RGD:733483 7244284 DNA:polymorphism:cds:g.677C>T (human) RGD Mthfr Rat chronic myeloid leukemia ISO RGD:733483 10449408 DNA:SNPs: :677C>T, 1298A>C(human) RGD Mthfr Rat clear cell renal cell carcinoma susceptibility ISO RGD:733483 6893474 DNA:transition, transversion:cds:g.677C>T, g.1298A>C (human) RGD Mthfr Rat clear cell renal cell carcinoma severity ISO RGD:733483 6893632 DNA:transition, transversion:cds:g.677C>T, g.1298A>C (human) RGD Mthfr Rat cleft lip susceptibility ISO RGD:733483 11565179 DNA:polymorphism: :c.677C>T(human) RGD Mthfr Rat Conotruncal Cardiac Defects no_association ISO RGD:733483 11565174 DNA:SNPs:cds:c.677C>T,c.1298A>C (human) RGD Mthfr Rat coronary artery disease susceptibility ISO RGD:733483 6893453 DNA:transition:cds:g.677C>T (human) RGD Mthfr Rat coronary artery disease susceptibility ISO RGD:733483 401850782 DNA:SNPs: (rs1801133, rs4846049) (Human) RGD Mthfr Rat coronary artery disease no_association ISO RGD:733483 1580579 DNA:transition:cds:g.677C>T (human) RGD Mthfr Rat Cytomegalovirus Infections ameliorates ISO RGD:1551392 42722609 RGD Mthfr Rat Cytomegalovirus Infections ISO RGD:733483 42722609 RGD Mthfr Rat dextro-looped transposition of the great arteries susceptibility ISO RGD:733483 11565105 DNA:SNP: : rs1801133(human) RGD Mthfr Rat diabetes mellitus no_association ISO RGD:733483 38501049 DNA:transition:cds:g.677C>T (human) RGD Mthfr Rat Diabetic Nephropathies no_association ISO RGD:733483 6893576 associated with Diabetes Mellitus, Type 2; DNA:transition:cds:g.677C>T (human) RGD Mthfr Rat Diabetic Nephropathies susceptibility ISO RGD:733483 6893524 associated with Diabetes Mellitus, Type 2; DNA:transition:cds:g.677C>T (human) RGD Mthfr Rat diabetic retinopathy susceptibility ISO RGD:733483 6893525 associated with Diabetes Mellitus, Type 2; DNA:transition:cds:g.677C>T (human) RGD Mthfr Rat diffuse large B-cell lymphoma susceptibility ISO RGD:733483 6893517 DNA:transition, transversion, haplotype:cds:g.677C>T, g.1298A>C (human) RGD Mthfr Rat Down syndrome susceptibility ISO RGD:733483 11565177 DNA:SNPs:cds:c.677C>T,c.1298A>C (human) RGD Mthfr Rat end stage renal disease susceptibility ISO RGD:733483 6893522 DNA:transition, transversion:cds:g.677C>T, g.1298A>C (human) RGD Mthfr Rat end stage renal disease ISO RGD:733483 14696732 DNA:SNP: :677C>T(human) RGD Mthfr Rat end stage renal disease severity ISO RGD:733483 6893524 associated with Diabetes Mellitus, Type 2; DNA:transition:cds:g.677C>T (human) RGD Mthfr Rat end stage renal disease no_association ISO RGD:733483 6893523 DNA:transition:cds:g.677C>T (human) RGD Mthfr Rat end stage renal disease susceptibility ISO RGD:733483 6893579 DNA:transitions, transversion, haplotype:cds:g.677C>T, g.1298A>C, g.1793G>A (human) RGD Mthfr Rat Experimental Diabetes Mellitus IEP 6893689 protein:decreased activity:kidney (rat) RGD Mthfr Rat eye disease susceptibility ISO RGD:733483 7387241 associated with Behcet Syndrome;DNA:SNP:cds:677C>T(human) RGD Mthfr Rat factor VIII deficiency severity ISO RGD:733483 10449409 DNA:SNP: :677C>T (human) RGD Mthfr Rat factor VIII deficiency no_association ISO RGD:733483 10449409 DNA:SNP: :1298A>C (human) RGD Mthfr Rat familial Mediterranean fever susceptibility ISO RGD:733483 38501050 DNA:missense mutations:cds:g.677C>T (rs1801133), g.1298A>C (rs1801131) (human) RGD Mthfr Rat glomerulonephritis ISO RGD:733483 6893468 DNA:transition:cds:g.677C>T (human) RGD Mthfr Rat graft-versus-host disease treatment ISO RGD:733483 6893635 DNA:transition:cds:g.677C>T (human) RGD Mthfr Rat Graves' disease susceptibility ISO RGD:733483 7387246 DNA:SNP:cds:677C>T(human) RGD Mthfr Rat Habitual Abortions no_association ISO RGD:733483 10449411 DNA:SNP: :1298A>C (human) RGD Mthfr Rat Habitual Abortions ISO RGD:733483 10449415 DNA:SNPs: :677C>T, 1298A>C (human) RGD Mthfr Rat Habitual Abortions ISO RGD:733483 10449404 DNA:SNPs: :677C>T, 1298A>C (human) RGD Mthfr Rat Hearing Loss susceptibility ISO RGD:733483 7387225 DNA:SNP:cds:677C>T(human) RGD Mthfr Rat Helicobacter Infections susceptibility ISO RGD:733483 38501056 associated with stomach cancer;DNA:missense mutation:cds:g.677C>T (human) RGD Mthfr Rat Helicobacter Infections susceptibility ISO RGD:733483 38501057 associated with stomach cancer;DNA:missense mutation:cds:g.677C>T (human) RGD Mthfr Rat Hematologic Neoplasms treatment ISO RGD:733483 10449413 DNA:SNP: :1298A>C (human) RGD Mthfr Rat Hematologic Neoplasms no_association ISO RGD:733483 10449413 DNA:SNP: :677C>T (human) RGD Mthfr Rat hepatic veno-occlusive disease susceptibility ISO RGD:733483 14696752 DNA:SNPs: :DNA:SNPs: :677C>T, 1298A>C(human) RGD Mthfr Rat hepatitis B no_association ISO RGD:733483 38508898 DNA:missense mutations:cds:g.1298A>C, g.2756A>G RGD Mthfr Rat hepatitis B susceptibility ISO RGD:733483 38508898 DNA:transition:cds:g.677C>T (human) RGD Mthfr Rat hepatocellular carcinoma susceptibility ISO RGD:733483 14696708 DNA:SNPs: :677C>T, 1298A>C(human) RGD Mthfr Rat hepatocellular carcinoma onset ISO RGD:733483 14696707 DNA:SNP: :1298A>C(human) RGD Mthfr Rat hepatocellular carcinoma disease_progression ISO RGD:733483 14696704 DNA:SNP: :677C>T(human) RGD Mthfr Rat hepatocellular carcinoma susceptibility ISO RGD:733483 14696703 DNA:SNP,haplotype: :677C>T, 1298A>C(human) RGD Mthfr Rat hyperhomocysteinemia ISO RGD:733483 1601421 DNA:missense mutations, nonsense mutations:CDS:multiple (human) RGD Mthfr Rat hyperhomocysteinemia treatment ISO RGD:733483 10449400 associated with Ovarian Neoplasms; DNA:SNP: :677C>T (human) RGD Mthfr Rat hyperthyroidism IEP 6893690 protein:increased activity:liver (rat) RGD Mthfr Rat hypopituitarism ISO RGD:733483 10449406 DNA:SNPs: :677C>T, 1298A>C(human) RGD Mthfr Rat hypothyroidism IEP 6893690 protein:decreased activity:liver (rat) RGD Mthfr Rat inflammatory bowel disease ISO RGD:733483 10449410 DNA:SNP: :1298A>C (human) RGD Mthfr Rat ischemia susceptibility ISO RGD:733483 7387251 associated with Retinal Vein Occlusion;DNA:SNP:cds:677C>T(human) RGD Mthfr Rat kidney failure ISO RGD:733483 6893515 DNA:transition:cds:g.677C>T (human) RGD Mthfr Rat Kuhnt-Junius degeneration susceptibility ISO RGD:733483 7387224 DNA:SNP:cds:rs1801133(human) RGD Mthfr Rat Left Ventricular Hypertrophy susceptibility ISO RGD:733483 14696732 DNA:SNPs: :677C>T, 1298A>C(human) RGD Mthfr Rat liver benign neoplasm onset IEP 6893663 mRNA:decreased expression:liver (rat) RGD Mthfr Rat liver cirrhosis susceptibility ISO RGD:733483 14696749 DNA:SNP: :677C>T(human) RGD Mthfr Rat lung small cell carcinoma severity ISO RGD:733483 4891158 protein:missense mutation:cds:p.A222V (human) RGD Mthfr Rat male infertility susceptibility ISO RGD:733483 11565106 :DNA:polymorphism: :677C>T(human) RGD Mthfr Rat Meniere's disease susceptibility ISO RGD:733483 7387223 DNA:SNPs: :677C>T(rs1801133),1298A>C(1801131)(human) RGD Mthfr Rat metabolic dysfunction-associated steatotic liver disease susceptibility ISO RGD:733483 14696748 DNA:SNPs: :DNA:SNPs: :677C>T, 1298A>C(human) RGD Mthfr Rat metabolic dysfunction-associated steatotic liver disease severity ISO RGD:733483 14696706 DNA:SNP: :1298A > C (human) RGD Mthfr Rat Microvascular Angina ISO RGD:733483 4891159 DNA:transition:cds:g.677C>T (human) RGD Mthfr Rat migraine susceptibility ISO RGD:733483 7387244 DNA:SNP:cds:677C>T(human) RGD Mthfr Rat migraine with aura susceptibility ISO RGD:733483 7387244 DNA:SNP:cds:677C>T(human) RGD Mthfr Rat mitral valve disease susceptibility ISO RGD:733483 11537145 associated with rheumatic heart disease;DNA:SNP:cds:677C>T (human) RGD Mthfr Rat multiple myeloma ISO RGD:733483 10449397 DNA:missense mutations:cds:677C>T, 1298A>C (human) RGD Mthfr Rat myeloid neoplasm ISO RGD:733483 10449419 DNA:SNPs: :677C>T, 1298A>C (human) RGD Mthfr Rat myocardial infarction susceptibility ISO RGD:733483 6893548 associated with Kidney Failure, Chronic; DNA:transition:cds:g.677C>T rs1801133 (human) RGD Mthfr Rat myocardial infarction ISO RGD:733483 10449412 DNA:SNP: :677C>T (human) RGD Mthfr Rat nephroblastoma susceptibility ISO RGD:733483 6893546 DNA:transition:cds:g.677C>T (human) RGD Mthfr Rat nephrosclerosis ISO RGD:733483 6893469 DNA:transition, transversion:cds:g.677C>T, g.1298A>C (human) RGD Mthfr Rat neural tube defect susceptibility ISO RGD:733483 11565102 DNA:polymorphism: :677C>T(human) RGD Mthfr Rat non-arteritic anterior ischemic optic neuropathy susceptibility ISO RGD:733483 8693343 DNA:polymorphism: :677C>T(human) RGD Mthfr Rat open-angle glaucoma no_association ISO RGD:733483 7387254 DNA:SNPs: : 677C>T, 1298A>C (human) RGD Mthfr Rat open-angle glaucoma susceptibility ISO RGD:733483 7387252 DNA:SNP: :677C>T(human) RGD Mthfr Rat oral squamous cell carcinoma susceptibility ISO RGD:733483 10449416 DNA:missense mutation:cds:677C>T (human) RGD Mthfr Rat osteonecrosis no_association ISO RGD:733483 10449417 associated with Anemia, Sickle Cell;DNA:SNP: :677C>T (human) RGD Mthfr Rat osteosarcoma treatment ISO RGD:733483 6893634 DNA:transition:cds:g.677C>T (human) RGD Mthfr Rat pancreatic cancer susceptibility ISO RGD:733483 2317120 DNA:polymorphism: :677C>T (human) RGD Mthfr Rat papillomavirus infectious disease no_association ISO RGD:733483 38501058 DNA:transition, transversion:cds:g.677C>T, g.1298A>C (human) RGD Mthfr Rat peripheral artery disease susceptibility ISO RGD:733483 6893659 associated with Diabetes Mellitus, Type 2;DNA:transition:cds:g.677C>T (human) RGD Mthfr Rat portal vein thrombosis susceptibility ISO RGD:733483 14696705 DNA:SNP: :677C>T(human) RGD Mthfr Rat portal vein thrombosis susceptibility ISO RGD:733483 14696749 DNA:SNP: :677C>T(human) RGD Mthfr Rat Prenatal Exposure Delayed Effects sexual_dimorphism IEP 11074449 mRNA:altered expression:hippocampus|hypothalamus (rat) RGD Mthfr Rat rectal benign neoplasm severity ISO RGD:733483 6893664 DNA:transition:cds:g.677C>T (human) RGD Mthfr Rat renal artery disease ISO RGD:733483 2313876 DNA:transition:cds:g.677C>T (human) RGD Mthfr Rat renal cell carcinoma susceptibility ISO RGD:733483 6893654 DNA:missense mutation:cds:p.A222V (rs1801133) (human) RGD Mthfr Rat retinal disease ISO RGD:1551392 7387239 RGD Mthfr Rat retinal vein occlusion susceptibility ISO RGD:733483 7387256 DNA:SNP: :677C>T(human) RGD Mthfr Rat retinal vein occlusion no_association ISO RGD:733483 10449421 DNA:missense mutation:cds:677C>T (human) RGD Mthfr Rat retinal vein occlusion no_association ISO RGD:733483 10449405 DNA:SNP: :1298A>C(human) RGD Mthfr Rat rheumatoid arthritis ISO RGD:733483 7387222 DNA:SNP: :677C>T(human) RGD Mthfr Rat schizophrenia susceptibility ISO RGD:733483 6893466 DNA:transition:cds:g.677C>T (human) RGD Mthfr Rat sickle cell anemia no_association ISO RGD:733483 10449403 DNA:SNP: :1298A>C (human) RGD Mthfr Rat sickle cell anemia severity ISO RGD:733483 10449403 DNA:SNP: :677C>T (human) RGD Mthfr Rat sickle cell anemia no_association ISO RGD:733483 10449420 DNA:SNP: :677C>T (human) RGD Mthfr Rat smallpox treatment ISO RGD:733483 42722608 DNA:SNP:exon:rs1801133(human) RGD Mthfr Rat spina bifida susceptibility ISO RGD:733483 6893455 DNA:transition:cds:g.677C>T (human) RGD Mthfr Rat spina bifida no_association ISO RGD:733483 11565178 DNA:polymorphism: :677C>T(human) RGD Mthfr Rat spina bifida severity ISO RGD:733483 11565104 DNA:polymorphism: :677C>T(human) RGD Mthfr Rat sporadic breast cancer no_association ISO RGD:733483 38501055 DNA:missense mutations:cds:g.677C>T, g.1298A>T (human) RGD Mthfr Rat squamous cell carcinoma susceptibility ISO RGD:733483 6893580 DNA:transition:cds:g.677C>T (human) RGD Mthfr Rat steatotic liver disease ISO RGD:733483 1580580 associated with Hepatitis C, Chronic; DNA:transition:cds:g.677C>T (human) RGD Mthfr Rat stomach cancer no_association ISO RGD:733483 38501052 DNA:missense mutation:cds:g.677C>T (human) RGD Mthfr Rat stomach cancer no_association ISO RGD:733483 38501056 DNA:missense mutation:cds:g.677C>T (human) RGD Mthfr Rat Stroke no_association ISO RGD:733483 10449417 associated with Anemia, Sickle Cell;DNA:missense mutation:cds:677C>T (human) RGD Mthfr Rat Stroke ISO RGD:733483 6893467 DNA:transition:cds:g.677C>T (human) RGD Mthfr Rat Sudden Hearing Loss no_association ISO RGD:733483 7387240 DNA:SNP:cds:677C>T(human) RGD Mthfr Rat Sudden Hearing Loss ISO RGD:733483 7387236 DNA:SNP: :677C>T(human) RGD Mthfr Rat Sudden Hearing Loss susceptibility ISO RGD:733483 7387243 DNA:SNPs:cds:677C>T,1298A>C(human) RGD Mthfr Rat tetralogy of Fallot susceptibility ISO RGD:733483 11565105 DNA:SNP: : rs1801133(human) RGD Mthfr Rat thrombocytopenia no_association ISO RGD:733483 10449418 associated with Precursor Cell Lymphoblastic Leukemia-Lymphoma;DNA:SNP: :677C>T, 1793G>A (human) RGD Mthfr Rat thrombocytopenia ISO RGD:733483 10449418 associated with Precursor Cell Lymphoblastic Leukemia-Lymphoma;DNA:SNP: :1298A>C (human) RGD Mthfr Rat thrombophilia ISO RGD:733483 10449396 associated with Liver Cirrhosis, Biliary;DNA:SNP: :677C>T (human) RGD Mthfr Rat thrombosis no_association ISO RGD:733483 10449414 DNA:SNP: :677C>T (human) RGD Mthfr Rat Thrombotic Microangiopathies susceptibility ISO RGD:733483 6893633 DNA:transition:cds:g.677C>T (human) RGD Mthfr Rat transitional cell carcinoma susceptibility ISO RGD:733483 6893477 DNA:transversion:cds:g.1298A>C (human) RGD Mthfr Rat type 1 diabetes mellitus severity ISO RGD:733483 6893652 DNA:transversion:cds:g.1298A>C (human) RGD Mthfr Rat type 2 diabetes mellitus susceptibility ISO RGD:733483 6893657 DNA:transition, transversion:cds:g.677C>T, g.1298A>C (human) RGD Mthfr Rat type 2 diabetes mellitus no_association ISO RGD:733483 6893653 DNA:transition:cds:g.677C>T (human) RGD Mthfr Rat type 2 diabetes mellitus susceptibility ISO RGD:733483 6893476 DNA:transition:cds:g.677C>T (human) RGD Mthfr Rat urinary bladder cancer susceptibility ISO RGD:733483 6893521 DNA:transversion:cds:g.1298A>C (human) RGD Mthfr Rat urinary bladder cancer susceptibility ISO RGD:733483 6893516 DNA:transition, transversion, haplotype:cds:g.677C>T, g.1298A>C (human) RGD Mthfr Rat urinary bladder cancer no_association ISO RGD:733483 6893597 protein:missense mutation:cds:p.A222V (human) RGD Mthfr Rat urinary bladder cancer susceptibility ISO RGD:733483 6893457 DNA:transition:cds:g.677C>T (human) RGD Mthfr Rat Vascular Calcification severity ISO RGD:733483 6893475 DNA:transition:cds:g.677C>T (human) RGD Mthfr Rat Venous Thromboembolism no_association ISO RGD:733483 10449399 DNA:SNP: :677C>T, 1298A>C (human) RGD Mthfr Rat Venous Thromboembolism ISO RGD:733483 10449399 DNA:SNP: :677C>T (human) RGD Mthfr Rat Venous Thrombosis susceptibility ISO RGD:733483 6893602 associated with Lupus Erythematosus, Systemic; DNA:transition, transversion:cds:g.677C>T rs1801133, g.1298A>C rs1801131 (human) RGD Mthfr Rat Venous Thrombosis no_association ISO RGD:733483 6893655 DNA:transition:cds:g.677C>T (human) RGD Mthfr Rat Venous Thrombosis ISO RGD:733483 1580590 DNA:transition:cds:g.677C>T (human) RGD Mthfr Rat Venous Thrombosis no_association ISO RGD:733483 10449394 DNA:transition: :677C>T (human) RGD
Mthfr Rat autistic disorder ISO RGD:733483 8554872 ClinVar Annotator: match by term: Autistic disorder of childhood onset ClinVar PMID:28492532 Mthfr Rat Charcot-Marie-Tooth disease type 2 ISO RGD:733483 8554872 ClinVar Annotator: match by term: Charcot-Marie-Tooth disease type 2 ClinVar PMID:28492532 Mthfr Rat chromosome 1p36 deletion syndrome ISO RGD:733483 8554872 ClinVar Annotator: match by term: Chromosome 1p36 deletion syndrome ClinVar Mthfr Rat Cognitive Dysfunction ISO RGD:733483 8554872 ClinVar Annotator: match by term: Mental deterioration ClinVar PMID:25741868 Mthfr Rat Developmental Disabilities ISO RGD:733483 8554872 ClinVar Annotator: match by term: Global developmental delay ClinVar PMID:25741868 Mthfr Rat Ehlers-Danlos syndrome kyphoscoliotic type 1 ISO RGD:733483 8554872 ClinVar Annotator: match by term: Ehlers-Danlos syndrome, kyphoscoliotic type 1 ClinVar PMID:28492532 Mthfr Rat epilepsy with generalized tonic-clonic seizures ISO RGD:733483 8554872 ClinVar Annotator: match by term: Generalized tonic-clonic seizures ClinVar PMID:25741868 Mthfr Rat Familial Atrial Fibrillation 6 ISO RGD:733483 8554872 ClinVar Annotator: match by term: Atrial fibrillation, familial, 6 ClinVar PMID:28492532 Mthfr Rat Folate-Sensitive Neural Tube Defects ISO RGD:733483 8554872 ClinVar Annotator: match by term: Neural tube defects, folate-sensitive ClinVar PMID:10196703|PMID:10323741|PMID:10440833|PMID:10551815|PMID:10677336|PMID:10679944|PMID:10732818|PMID:10767000|PMID:10869114|PMID:10923034|PMID:10930360|PMID:10958762|PMID:11121176|PMID:11140843|PMID:11395038|PMID:11418485|PMID:11590551|PMID:11710708|PMID:11742092|PMID:11752418|PMID:11781870|PMID:11807890|PMID:11863127|PMID:11888585|PMID:11916316|PMID:11929966|PMID:11938441|PMID:12080391|PMID:12095808|PMID:12154064|PMID:12165282|PMID:12196644|PMID:12221667|PMID:12356947|PMID:12383688|PMID:12384649|PMID:12387655|PMID:12400059|PMID:12406076|PMID:12428084|PMID:12453860|PMID:12529699|PMID:12560871|PMID:12673793|PMID:12733064|PMID:12796225|PMID:12915598|PMID:15048559|PMID:15054400|PMID:15103709|PMID:15154859|PMID:15173232|PMID:1522835|PMID:15534175|PMID:15543147|PMID:15565101|PMID:15704130|PMID:15729744|PMID:15806605|PMID:15808177|PMID:15951337|PMID:16172608|PMID:16199547|PMID:16244782|PMID:16365871|PMID:16402130|PMID:16432849|PMID:16470725|PMID:16501586|PMID:16712703|PMID:16800002|PMID:16870553|PMID:17284634|PMID:17350979|PMID:17409006|PMID:17436239|PMID:17488658|PMID:17512587|PMID:17543893|PMID:17576681|PMID:17726486|PMID:17898028|PMID:18381794|PMID:18458567|PMID:18523009|PMID:18583979|PMID:18854913|PMID:19031955|PMID:19648163|PMID:19810817|PMID:20154341|PMID:20236116|PMID:20356773|PMID:20472929|PMID:20490923|PMID:20514079|PMID:20595278|PMID:20863444|PMID:21131308|PMID:21480888|PMID:21534867|PMID:21644011|PMID:21778025|PMID:21931346|PMID:22074251|PMID:22143415|PMID:22887477|PMID:22947400|PMID:22992668|PMID:23089671|PMID:23095111|PMID:23488607|PMID:23526309|PMID:23648444|PMID:24241962|PMID:24797679|PMID:24997712|PMID:25007187|PMID:25024447|PMID:25079578|PMID:25110820|PMID:25162892|PMID:25177243|PMID:25227144|PMID:25736335|PMID:25741868|PMID:25778468|PMID:25856670|PMID:26025547|PMID:26872964|PMID:26898294|PMID:27104192|PMID:27118298|PMID:27217051|PMID:27399166|PMID:27743313|PMID:27781293|PMID:27992285|PMID:28241805|PMID:28468868|PMID:28492532|PMID:28514598|PMID:28696419|PMID:29246599|PMID:29284203|PMID:29391032|PMID:29589488|PMID:29911750|PMID:30684021|PMID:31068897|PMID:31069529|PMID:32161077|PMID:32451826|PMID:32612964|PMID:32695297|PMID:32939339|PMID:33089527|PMID:33125268|PMID:3347350|PMID:34015165|PMID:34214447|PMID:34347262|PMID:34845156|PMID:35008593|PMID:35322348|PMID:35499206|PMID:35578252|PMID:36901693|PMID:37489029|PMID:37972026|PMID:39825153|PMID:7564788|PMID:7647779|PMID:7726158|PMID:7741859|PMID:7920641|PMID:8542260|PMID:8554053|PMID:8554066|PMID:8616944|PMID:8771990|PMID:8826441|PMID:8837319|PMID:8892013|PMID:8903338|PMID:8940272|PMID:8981967|PMID:8994411|PMID:9133512|PMID:9192280|PMID:9244205|PMID:9341863|PMID:9372726|PMID:9453374|PMID:9536098|PMID:9545395|PMID:9545406|PMID:9737770|PMID:9781030|PMID:9789068|PMID:9798595|PMID:9843036|PMID:9863598 Mthfr Rat gastrointestinal stromal tumor ISO RGD:733483 8554872 ClinVar Annotator: match by term: Gastrointestinal Stromal Sarcoma | ClinVar Annotator: match by term: Gastrointestinal more ... ClinVar PMID:10196703|PMID:10323741|PMID:10440833|PMID:10677336|PMID:10732818|PMID:10869114|PMID:10930360|PMID:10958762|PMID:11121176|PMID:11140843|PMID:11418485|PMID:11590551|PMID:11710708|PMID:11742092|PMID:11752418|PMID:11781870|PMID:11807890|PMID:11863127|PMID:11888585|PMID:11929966|PMID:11938441|PMID:12080391|PMID:12095808|PMID:12154064|PMID:12165282|PMID:12196644|PMID:12221667|PMID:12356947|PMID:12383688|PMID:12384649|PMID:12387655|PMID:12400059|PMID:12406076|PMID:12428084|PMID:12453860|PMID:12529699|PMID:12560871|PMID:12796225|PMID:12915598|PMID:15054400|PMID:15103709|PMID:15154859|PMID:15173232|PMID:1522835|PMID:15534175|PMID:15543147|PMID:15565101|PMID:15704130|PMID:15729744|PMID:15806605|PMID:15808177|PMID:15951337|PMID:16172608|PMID:16244782|PMID:16365871|PMID:16402130|PMID:16432849|PMID:16470725|PMID:16501586|PMID:16712703|PMID:16800002|PMID:16870553|PMID:17180579|PMID:17284634|PMID:17350979|PMID:17436239|PMID:17488658|PMID:17512587|PMID:17543893|PMID:17726486|PMID:17898028|PMID:18381794|PMID:18458567|PMID:18583979|PMID:18704422|PMID:19031955|PMID:19648163|PMID:20154341|PMID:20472929|PMID:20514079|PMID:20595278|PMID:20863444|PMID:21387541|PMID:21534867|PMID:21644011|PMID:21931346|PMID:22074251|PMID:22143415|PMID:22992668|PMID:23089671|PMID:23095111|PMID:23488607|PMID:23648444|PMID:24241962|PMID:24908438|PMID:25007187|PMID:25110820|PMID:25177243|PMID:25227144|PMID:25303299|PMID:25741868|PMID:25778468|PMID:27104192|PMID:27217051|PMID:27399166|PMID:27781293|PMID:27992285|PMID:28492532|PMID:28514598|PMID:28696419|PMID:29589488|PMID:29911750|PMID:30684021|PMID:31870219|PMID:32612964|PMID:32695297|PMID:7564788|PMID:7647779|PMID:7741859|PMID:8542260|PMID:8554053|PMID:8554066|PMID:8616944|PMID:8771990|PMID:8826441|PMID:8837319|PMID:8892013|PMID:8903338|PMID:8981967|PMID:8994411|PMID:9133512|PMID:9192280|PMID:9244205|PMID:9341863|PMID:9372726|PMID:9453374|PMID:9545395|PMID:9545406|PMID:9737770|PMID:9789068|PMID:9798595|PMID:9843036|PMID:9863598 Mthfr Rat gastrointestinal stromal tumor ISO RGD:733483 8554872 ClinVar Annotator: match by term: Gastrointestinal Stromal Sarcoma ClinVar PMID:10196703|PMID:10323741|PMID:10440833|PMID:10677336|PMID:10732818|PMID:10869114|PMID:10930360|PMID:10958762|PMID:11121176|PMID:11140843|PMID:11395038|PMID:11418485|PMID:11590551|PMID:11710708|PMID:11742092|PMID:11752418|PMID:11781870|PMID:11807890|PMID:11863127|PMID:11888585|PMID:11929966|PMID:11938441|PMID:12080391|PMID:12095808|PMID:12154064|PMID:12165282|PMID:12196644|PMID:12221667|PMID:12356947|PMID:12383688|PMID:12384649|PMID:12387655|PMID:12400059|PMID:12406076|PMID:12428084|PMID:12453860|PMID:12529699|PMID:12560871|PMID:12796225|PMID:12915598|PMID:15054400|PMID:15103709|PMID:15154859|PMID:15173232|PMID:1522835|PMID:15534175|PMID:15543147|PMID:15565101|PMID:15704130|PMID:15729744|PMID:15806605|PMID:15808177|PMID:15951337|PMID:16172608|PMID:16244782|PMID:16365871|PMID:16402130|PMID:16432849|PMID:16470725|PMID:16501586|PMID:16712703|PMID:16800002|PMID:16870553|PMID:17284634|PMID:17350979|PMID:17436239|PMID:17488658|PMID:17512587|PMID:17543893|PMID:17726486|PMID:17898028|PMID:18381794|PMID:18458567|PMID:18583979|PMID:19031955|PMID:19648163|PMID:20154341|PMID:20472929|PMID:20514079|PMID:20595278|PMID:20863444|PMID:21534867|PMID:21644011|PMID:21931346|PMID:22074251|PMID:22143415|PMID:22992668|PMID:23089671|PMID:23095111|PMID:23488607|PMID:23648444|PMID:24241962|PMID:25007187|PMID:25110820|PMID:25177243|PMID:25227144|PMID:25741868|PMID:25778468|PMID:27104192|PMID:27217051|PMID:27399166|PMID:27781293|PMID:27992285|PMID:28492532|PMID:28514598|PMID:28696419|PMID:29589488|PMID:29911750|PMID:30684021|PMID:32612964|PMID:32695297|PMID:7564788|PMID:7647779|PMID:7741859|PMID:8542260|PMID:8554053|PMID:8554066|PMID:8616944|PMID:8771990|PMID:8826441|PMID:8837319|PMID:8892013|PMID:8903338|PMID:8981967|PMID:8994411|PMID:9133512|PMID:9192280|PMID:9244205|PMID:9341863|PMID:9372726|PMID:9453374|PMID:9545395|PMID:9545406|PMID:9737770|PMID:9789068|PMID:9798595|PMID:9843036|PMID:9863598 Mthfr Rat gastrointestinal stromal tumor ISO RGD:733483 8554872 ClinVar Annotator: match by term: Gastrointestinal stromal tumor ClinVar PMID:10196703|PMID:10323741|PMID:10440833|PMID:10677336|PMID:10732818|PMID:10869114|PMID:10930360|PMID:10958762|PMID:11121176|PMID:11140843|PMID:11395038|PMID:11418485|PMID:11590551|PMID:11710708|PMID:11742092|PMID:11752418|PMID:11781870|PMID:11807890|PMID:11863127|PMID:11888585|PMID:11929966|PMID:11938441|PMID:12080391|PMID:12095808|PMID:12154064|PMID:12165282|PMID:12196644|PMID:12221667|PMID:12356947|PMID:12383688|PMID:12384649|PMID:12387655|PMID:12400059|PMID:12406076|PMID:12428084|PMID:12453860|PMID:12529699|PMID:12560871|PMID:12796225|PMID:12915598|PMID:15054400|PMID:15103709|PMID:15154859|PMID:15173232|PMID:1522835|PMID:15534175|PMID:15543147|PMID:15565101|PMID:15704130|PMID:15729744|PMID:15806605|PMID:15808177|PMID:15951337|PMID:16172608|PMID:16244782|PMID:16365871|PMID:16402130|PMID:16432849|PMID:16470725|PMID:16501586|PMID:16712703|PMID:16800002|PMID:16870553|PMID:17284634|PMID:17350979|PMID:17436239|PMID:17488658|PMID:17512587|PMID:17543893|PMID:17726486|PMID:17898028|PMID:18381794|PMID:18458567|PMID:18583979|PMID:18704422|PMID:19031955|PMID:19648163|PMID:20154341|PMID:20472929|PMID:20514079|PMID:20595278|PMID:20863444|PMID:21534867|PMID:21644011|PMID:21931346|PMID:22074251|PMID:22143415|PMID:22992668|PMID:23089671|PMID:23095111|PMID:23488607|PMID:23648444|PMID:24241962|PMID:25007187|PMID:25110820|PMID:25177243|PMID:25227144|PMID:25741868|PMID:25741905|PMID:25778468|PMID:27104192|PMID:27217051|PMID:27399166|PMID:27781293|PMID:27992285|PMID:28492532|PMID:28514598|PMID:28696419|PMID:29589488|PMID:29911750|PMID:30684021|PMID:32612964|PMID:32695297|PMID:7564788|PMID:7647779|PMID:7741859|PMID:8542260|PMID:8554053|PMID:8554066|PMID:8616944|PMID:8771990|PMID:8826441|PMID:8837319|PMID:8892013|PMID:8903338|PMID:8981967|PMID:8994411|PMID:9133512|PMID:9192280|PMID:9244205|PMID:9341863|PMID:9372726|PMID:9453374|PMID:9545395|PMID:9545406|PMID:9737770|PMID:9789068|PMID:9798595|PMID:9843036|PMID:9863598 Mthfr Rat gastrointestinal stromal tumor ISO RGD:733483 8554872 ClinVar Annotator: match by term: Gastrointestinal stroma tumor | ClinVar Annotator: match by term: Gastrointestinal more ... ClinVar PMID:10196703|PMID:10323741|PMID:10440833|PMID:10677336|PMID:10732818|PMID:10869114|PMID:10930360|PMID:10958762|PMID:11121176|PMID:11140843|PMID:11418485|PMID:11590551|PMID:11710708|PMID:11742092|PMID:11752418|PMID:11781870|PMID:11807890|PMID:11863127|PMID:11888585|PMID:11929966|PMID:11938441|PMID:12080391|PMID:12095808|PMID:12154064|PMID:12165282|PMID:12196644|PMID:12221667|PMID:12356947|PMID:12383688|PMID:12384649|PMID:12387655|PMID:12400059|PMID:12406076|PMID:12428084|PMID:12453860|PMID:12529699|PMID:12560871|PMID:12796225|PMID:12915598|PMID:15054400|PMID:15103709|PMID:15154859|PMID:15173232|PMID:1522835|PMID:15534175|PMID:15543147|PMID:15565101|PMID:15704130|PMID:15729744|PMID:15806605|PMID:15808177|PMID:15951337|PMID:16172608|PMID:16244782|PMID:16365871|PMID:16402130|PMID:16432849|PMID:16470725|PMID:16501586|PMID:16712703|PMID:16800002|PMID:16870553|PMID:17180579|PMID:17284634|PMID:17350979|PMID:17436239|PMID:17488658|PMID:17512587|PMID:17543893|PMID:17726486|PMID:17898028|PMID:18381794|PMID:18458567|PMID:18583979|PMID:18704422|PMID:19031955|PMID:19648163|PMID:20154341|PMID:20472929|PMID:20514079|PMID:20595278|PMID:20863444|PMID:21387541|PMID:21534867|PMID:21644011|PMID:21931346|PMID:22074251|PMID:22143415|PMID:22992668|PMID:23089671|PMID:23095111|PMID:23488607|PMID:23648444|PMID:24241962|PMID:24908438|PMID:25007187|PMID:25110820|PMID:25177243|PMID:25227144|PMID:25303299|PMID:25741868|PMID:25778468|PMID:27104192|PMID:27217051|PMID:27399166|PMID:27781293|PMID:27992285|PMID:28492532|PMID:28696419|PMID:29589488|PMID:29911750|PMID:30684021|PMID:31870219|PMID:32612964|PMID:32695297|PMID:7564788|PMID:7647779|PMID:7741859|PMID:8542260|PMID:8554053|PMID:8554066|PMID:8616944|PMID:8771990|PMID:8826441|PMID:8837319|PMID:8892013|PMID:8903338|PMID:8981967|PMID:8994411|PMID:9133512|PMID:9192280|PMID:9244205|PMID:9341863|PMID:9372726|PMID:9453374|PMID:9545395|PMID:9545406|PMID:9737770|PMID:9789068|PMID:9798595|PMID:9843036|PMID:9863598 Mthfr Rat genetic disease ISO RGD:733483 8554872 ClinVar Annotator: match by term: Inborn genetic diseases ClinVar PMID:25741868|PMID:28492532 Mthfr Rat intellectual disability ISO RGD:733483 8554872 ClinVar Annotator: match by term: Intellectual disability | ClinVar Annotator: match by term: intellectual disabilities ClinVar PMID:12733064|PMID:25736335|PMID:25741868|PMID:26025547|PMID:28492532|PMID:39825153|PMID:7726158 Mthfr Rat Methylenetetrahydrofolate Reductase Deficiency ISO RGD:733483 8554872 ClinVar Annotator: match by term: Generalized cerebral atrophy/hypoplasia | ClinVar Annotator: match by term: HOMOCYSTINURIA more ... ClinVar PMID:10196703|PMID:10323741|PMID:10440833|PMID:10551815|PMID:10677336|PMID:10679944|PMID:10732818|PMID:10767000|PMID:10869114|PMID:10923034|PMID:10930360|PMID:10958762|PMID:11121176|PMID:11140843|PMID:11418485|PMID:11590551|PMID:11710708|PMID:11742092|PMID:11752418|PMID:11781870|PMID:11807890|PMID:11863127|PMID:11888585|PMID:11929966|PMID:11938441|PMID:12080391|PMID:12095808|PMID:12154064|PMID:12165282|PMID:12196644|PMID:12221667|PMID:12356947|PMID:12383688|PMID:12384649|PMID:12387655|PMID:12400059|PMID:12406076|PMID:12428084|PMID:12453860|PMID:12529699|PMID:12560871|PMID:12673793|PMID:12733064|PMID:12796225|PMID:12840091|PMID:12915598|PMID:15048559|PMID:15054400|PMID:15103709|PMID:15154859|PMID:15173232|PMID:1522835|PMID:15534175|PMID:15543147|PMID:15565101|PMID:15704130|PMID:15729744|PMID:15806605|PMID:15808177|PMID:15951337|PMID:16172608|PMID:16199547|PMID:16244782|PMID:16365871|PMID:16402130|PMID:16432849|PMID:16470725|PMID:16501586|PMID:16712703|PMID:16800002|PMID:16870553|PMID:17180579|PMID:17284634|PMID:17350979|PMID:17409006|PMID:17436239|PMID:17488658|PMID:17512587|PMID:17543893|PMID:17576681|PMID:17726486|PMID:17898028|PMID:18381794|PMID:18458567|PMID:18523009|PMID:18583979|PMID:18704422|PMID:19031955|PMID:19648163|PMID:19810817|PMID:20154341|PMID:20356773|PMID:20472929|PMID:20490923|PMID:20514079|PMID:20595278|PMID:20863444|PMID:21387541|PMID:21480888|PMID:21534867|PMID:21644011|PMID:21778025|PMID:21931346|PMID:22074251|PMID:22143415|PMID:22887477|PMID:22992668|PMID:23089671|PMID:23095111|PMID:23488607|PMID:23648444|PMID:24033266|PMID:24241962|PMID:24797679|PMID:24908438|PMID:24997712|PMID:25007187|PMID:25079578|PMID:25110820|PMID:25177243|PMID:25227144|PMID:25303299|PMID:25736335|PMID:25741868|PMID:25778468|PMID:25856670|PMID:26025547|PMID:26872964|PMID:26898294|PMID:27104192|PMID:27118298|PMID:27217051|PMID:27399166|PMID:27743313|PMID:27768236|PMID:27781293|PMID:27992285|PMID:28492532|PMID:28514598|PMID:28696419|PMID:29246599|PMID:29391032|PMID:29589488|PMID:29911750|PMID:30684021|PMID:31068897|PMID:31870219|PMID:32230794|PMID:32451826|PMID:32612964|PMID:32695297|PMID:33089527|PMID:3347350|PMID:34015165|PMID:3580562|PMID:6381059|PMID:7564788|PMID:7647779|PMID:7726158|PMID:7741859|PMID:7920641|PMID:8542260|PMID:8554053|PMID:8554066|PMID:8616944|PMID:8771990|PMID:8826441|PMID:8837319|PMID:8892013|PMID:8903338|PMID:8940272|PMID:8981967|PMID:8994411|PMID:9133512|PMID:9192280|PMID:9244205|PMID:9341863|PMID:9372726|PMID:9453374|PMID:9536098|PMID:9545395|PMID:9545406|PMID:9737770|PMID:9781030|PMID:9789068|PMID:9798595|PMID:9843036|PMID:9863598 Mthfr Rat Methylenetetrahydrofolate Reductase Deficiency ISO RGD:733483 8554872 ClinVar Annotator: match by term: Generalized cerebral atrophy/hypoplasia | ClinVar Annotator: match by term: HOMOCYSTINURIA more ... ClinVar PMID:10196703|PMID:10323741|PMID:10440833|PMID:10551815|PMID:10677336|PMID:10679944|PMID:10732818|PMID:10767000|PMID:10869114|PMID:10923034|PMID:10930360|PMID:10958762|PMID:11121176|PMID:11140843|PMID:11395038|PMID:11418485|PMID:11590551|PMID:11710708|PMID:11742092|PMID:11752418|PMID:11781870|PMID:11807890|PMID:11863127|PMID:11888585|PMID:11916316|PMID:11929966|PMID:11938441|PMID:12080391|PMID:12095808|PMID:12154064|PMID:12165282|PMID:12196644|PMID:12221667|PMID:12356947|PMID:12383688|PMID:12384649|PMID:12387655|PMID:12400059|PMID:12406076|PMID:12428084|PMID:12453860|PMID:12529699|PMID:12560871|PMID:12673793|PMID:12733064|PMID:12796225|PMID:12840091|PMID:12915598|PMID:15048559|PMID:15054400|PMID:15103709|PMID:15154859|PMID:15173232|PMID:1522835|PMID:15534175|PMID:15543147|PMID:15565101|PMID:15704130|PMID:15729744|PMID:15806605|PMID:15808177|PMID:15951337|PMID:16172608|PMID:16199547|PMID:16244782|PMID:16365871|PMID:16402130|PMID:16432849|PMID:16470725|PMID:16501586|PMID:16712703|PMID:16800002|PMID:16870553|PMID:17284634|PMID:17350979|PMID:17409006|PMID:17436239|PMID:17457696|PMID:17488658|PMID:17512587|PMID:17543893|PMID:17576681|PMID:17726486|PMID:17898028|PMID:18381794|PMID:18458567|PMID:18523009|PMID:18583979|PMID:18854913|PMID:19031955|PMID:19648163|PMID:19810817|PMID:20154341|PMID:20236116|PMID:20356773|PMID:20472929|PMID:20490923|PMID:20514079|PMID:20595278|PMID:20863444|PMID:21131308|PMID:21480888|PMID:21534867|PMID:21644011|PMID:21778025|PMID:21931346|PMID:22074251|PMID:22143415|PMID:22887477|PMID:22947400|PMID:22992668|PMID:23089671|PMID:23095111|PMID:23488607|PMID:23526309|PMID:23648444|PMID:24033266|PMID:24241962|PMID:24726568|PMID:24797679|PMID:24997712|PMID:25007187|PMID:25024447|PMID:25079578|PMID:25110820|PMID:25162892|PMID:25177243|PMID:25227144|PMID:25736335|PMID:25741868|PMID:25758715|PMID:25778468|PMID:25856670|PMID:26025547|PMID:26872964|PMID:26898294|PMID:27104192|PMID:27118298|PMID:27217051|PMID:27399166|PMID:27527345|PMID:27743313|PMID:27768236|PMID:27781293|PMID:27992285|PMID:28241805|PMID:28468868|PMID:28492532|PMID:28514598|PMID:28696419|PMID:29246599|PMID:29284203|PMID:29391032|PMID:29589488|PMID:29911750|PMID:30684021|PMID:31068897|PMID:31069529|PMID:31462756|PMID:31589614|PMID:32161077|PMID:32230794|PMID:32451826|PMID:32612964|PMID:32695297|PMID:32939339|PMID:33089527|PMID:33125268|PMID:3347350|PMID:34015165|PMID:34214447|PMID:34347262|PMID:34845156|PMID:35008593|PMID:35322348|PMID:35499206|PMID:35578252|PMID:3580562|PMID:36901693|PMID:37239340|PMID:37489029|PMID:37972026|PMID:39825153|PMID:6381059|PMID:7564788|PMID:7647779|PMID:7726158|PMID:7741859|PMID:7920641|PMID:8542260|PMID:8554053|PMID:8554066|PMID:8616944|PMID:8771990|PMID:8826441|PMID:8837319|PMID:8892013|PMID:8903338|PMID:8940272|PMID:8981967|PMID:8994411|PMID:9133512|PMID:9192280|PMID:9244205|PMID:9341863|PMID:9372726|PMID:9453374|PMID:9536098|PMID:9545395|PMID:9545406|PMID:9737770|PMID:9781030|PMID:9789068|PMID:9798595|PMID:9843036|PMID:9863598 Mthfr Rat Mthfr Deficiency, Thermolabile Type ISO RGD:733483 8554872 ClinVar Annotator: match by term: MTHFR deficiency, thermolabile type ClinVar PMID:10196703|PMID:10323741|PMID:10440833|PMID:10677336|PMID:10732818|PMID:10869114|PMID:10930360|PMID:10958762|PMID:11121176|PMID:11140843|PMID:11395038|PMID:11418485|PMID:11590551|PMID:11710708|PMID:11742092|PMID:11752418|PMID:11781870|PMID:11807890|PMID:11863127|PMID:11888585|PMID:11929966|PMID:11938441|PMID:12080391|PMID:12095808|PMID:12154064|PMID:12165282|PMID:12196644|PMID:12221667|PMID:12356947|PMID:12383688|PMID:12384649|PMID:12387655|PMID:12400059|PMID:12406076|PMID:12428084|PMID:12453860|PMID:12529699|PMID:12560871|PMID:12796225|PMID:12915598|PMID:15054400|PMID:15103709|PMID:15154859|PMID:15173232|PMID:1522835|PMID:15534175|PMID:15543147|PMID:15565101|PMID:15704130|PMID:15729744|PMID:15806605|PMID:15808177|PMID:15951337|PMID:16172608|PMID:16244782|PMID:16365871|PMID:16402130|PMID:16432849|PMID:16470725|PMID:16501586|PMID:16712703|PMID:16800002|PMID:16870553|PMID:17284634|PMID:17350979|PMID:17436239|PMID:17488658|PMID:17512587|PMID:17543893|PMID:17726486|PMID:17898028|PMID:18381794|PMID:18458567|PMID:18583979|PMID:19031955|PMID:19648163|PMID:20154341|PMID:20472929|PMID:20514079|PMID:20595278|PMID:20863444|PMID:21534867|PMID:21644011|PMID:21931346|PMID:22074251|PMID:22143415|PMID:22992668|PMID:23089671|PMID:23095111|PMID:23488607|PMID:23648444|PMID:24241962|PMID:25007187|PMID:25110820|PMID:25177243|PMID:25227144|PMID:25741868|PMID:25778468|PMID:27104192|PMID:27217051|PMID:27399166|PMID:27781293|PMID:27992285|PMID:28492532|PMID:28514598|PMID:28696419|PMID:29589488|PMID:29911750|PMID:30684021|PMID:32612964|PMID:32695297|PMID:7564788|PMID:7647779|PMID:7741859|PMID:8542260|PMID:8554053|PMID:8554066|PMID:8616944|PMID:8771990|PMID:8826441|PMID:8837319|PMID:8892013|PMID:8903338|PMID:8981967|PMID:8994411|PMID:9133512|PMID:9192280|PMID:9244205|PMID:9341863|PMID:9372726|PMID:9453374|PMID:9545395|PMID:9545406|PMID:9737770|PMID:9789068|PMID:9798595|PMID:9843036|PMID:9863598 Mthfr Rat neural tube defect ISO RGD:733483 8554872 ClinVar Annotator: match by term: Neural tube defect ClinVar PMID:25736335|PMID:25741868 Mthfr Rat prostate cancer ISO RGD:733483 8554872 ClinVar Annotator: match by term: Malignant tumor of prostate ClinVar PMID:23265383 Mthfr Rat schizophrenia ISO RGD:733483 8554872 ClinVar Annotator: match by term: Schizophrenia | ClinVar Annotator: match by term: Schizophrenia, susceptibility to ClinVar PMID:10551815|PMID:10677336|PMID:10679944|PMID:10923034|PMID:10958762|PMID:11395038|PMID:11590551|PMID:11742092|PMID:11752418|PMID:11938441|PMID:12560871|PMID:12673793|PMID:12733064|PMID:15048559|PMID:15103709|PMID:15543147|PMID:15951337|PMID:16199547|PMID:16244782|PMID:18523009|PMID:18583979|PMID:19810817|PMID:21778025|PMID:24797679|PMID:25079578|PMID:25162892|PMID:25227144|PMID:25736335|PMID:25741868|PMID:25856670|PMID:26025547|PMID:26872964|PMID:27118298|PMID:27743313|PMID:28241805|PMID:28492532|PMID:28514598|PMID:29246599|PMID:32451826|PMID:32939339|PMID:33089527|PMID:34214447|PMID:35322348|PMID:35499206|PMID:37972026|PMID:39825153|PMID:7726158|PMID:7920641|PMID:8940272|PMID:9545395|PMID:9781030 Mthfr Rat thrombophilia due to thrombin defect ISO RGD:733483 8554872 ClinVar Annotator: match by term: THROMBOPHILIA DUE TO FACTOR 2 DEFECT | ClinVar Annotator: match more ... ClinVar PMID:10196703|PMID:10323741|PMID:10440833|PMID:10551815|PMID:10679944|PMID:10732818|PMID:10869114|PMID:10923034|PMID:10930360|PMID:11121176|PMID:11140843|PMID:11418485|PMID:11710708|PMID:11781870|PMID:11807890|PMID:11863127|PMID:11888585|PMID:11929966|PMID:12080391|PMID:12095808|PMID:12154064|PMID:12165282|PMID:12196644|PMID:12221667|PMID:12356947|PMID:12383688|PMID:12384649|PMID:12387655|PMID:12400059|PMID:12406076|PMID:12428084|PMID:12453860|PMID:12529699|PMID:12560871|PMID:12673793|PMID:12733064|PMID:12796225|PMID:12915598|PMID:15048559|PMID:15054400|PMID:15103709|PMID:15154859|PMID:15173232|PMID:1522835|PMID:15534175|PMID:15565101|PMID:15704130|PMID:15729744|PMID:15806605|PMID:15808177|PMID:16172608|PMID:16199547|PMID:16365871|PMID:16402130|PMID:16432849|PMID:16470725|PMID:16501586|PMID:16712703|PMID:16800002|PMID:16870553|PMID:17284634|PMID:17350979|PMID:17436239|PMID:17488658|PMID:17512587|PMID:17543893|PMID:17726486|PMID:17898028|PMID:18381794|PMID:18458567|PMID:18523009|PMID:18583979|PMID:19031955|PMID:19648163|PMID:19810817|PMID:20154341|PMID:20472929|PMID:20514079|PMID:20595278|PMID:20863444|PMID:21534867|PMID:21644011|PMID:21778025|PMID:21931346|PMID:22074251|PMID:22143415|PMID:22992668|PMID:23089671|PMID:23095111|PMID:23488607|PMID:23648444|PMID:24241962|PMID:24797679|PMID:25007187|PMID:25079578|PMID:25110820|PMID:25162892|PMID:25177243|PMID:25227144|PMID:25736335|PMID:25741868|PMID:25778468|PMID:25856670|PMID:26025547|PMID:26872964|PMID:27104192|PMID:27118298|PMID:27217051|PMID:27399166|PMID:27743313|PMID:27781293|PMID:27992285|PMID:28241805|PMID:28492532|PMID:28696419|PMID:29246599|PMID:29589488|PMID:29911750|PMID:30684021|PMID:32451826|PMID:32612964|PMID:32695297|PMID:32939339|PMID:33089527|PMID:34214447|PMID:35322348|PMID:35499206|PMID:37972026|PMID:39825153|PMID:7564788|PMID:7647779|PMID:7726158|PMID:7741859|PMID:7920641|PMID:8542260|PMID:8554053|PMID:8554066|PMID:8616944|PMID:8771990|PMID:8826441|PMID:8837319|PMID:8892013|PMID:8903338|PMID:8940272|PMID:8981967|PMID:8994411|PMID:9133512|PMID:9192280|PMID:9244205|PMID:9341863|PMID:9372726|PMID:9453374|PMID:9545395|PMID:9545406|PMID:9737770|PMID:9781030|PMID:9789068|PMID:9798595|PMID:9843036|PMID:9863598 Mthfr Rat vascular dementia ISO RGD:733483 8554872 ClinVar Annotator: match by term: Vascular dementia ClinVar PMID:35307828
Only show annotations with direct experimental evidence (0 objects hidden)
Mthfr Rat (1->4)-beta-D-glucan multiple interactions ISO RGD:1551392 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of MTHFR mRNA CTD PMID:36331819 Mthfr Rat 1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene multiple interactions ISO RGD:1551392 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Mthfr Rat 1,2-dichloroethane increases expression ISO RGD:1551392 6480464 ethylene dichloride results in increased expression of MTHFR mRNA CTD PMID:28960355 Mthfr Rat 17beta-estradiol increases expression ISO RGD:1551392 6480464 Estradiol results in increased expression of MTHFR mRNA CTD PMID:39298647 Mthfr Rat 17beta-estradiol decreases expression ISO RGD:733483 6480464 Estradiol results in decreased expression of MTHFR mRNA CTD PMID:31614463 Mthfr Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO RGD:1551392 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Mthfr Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO RGD:1551392 6480464 2,2',4,4'-tetrabromodiphenyl ether affects the expression of MTHFR mRNA CTD PMID:30294300 Mthfr Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO RGD:1551392 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Mthfr Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1551392 6480464 Tetrachlorodibenzodioxin affects the expression of MTHFR mRNA CTD PMID:28922406 Mthfr Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of MTHFR mRNA CTD PMID:33387578 Mthfr Rat 2,4,4'-trichlorobiphenyl multiple interactions ISO RGD:1551392 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Mthfr Rat 2-acetamidofluorene decreases methylation EXP 6480464 2-Acetylaminofluorene results in decreased methylation of MTHFR promoter CTD PMID:22213190 Mthfr Rat 2-acetamidofluorene decreases expression EXP 6480464 2-Acetylaminofluorene results in decreased expression of MTHFR mRNA CTD PMID:22213190 Mthfr Rat 2-butoxyethanol increases expression ISO RGD:1551392 6480464 n-butoxyethanol results in increased expression of MTHFR mRNA CTD PMID:19812364 Mthfr Rat 3,3',4,4',5-pentachlorobiphenyl multiple interactions EXP 6480464 AHR gene mutant form inhibits the reaction [3,4,5,3',4'-pentachlorobiphenyl results in increased expression of MTHFR mRNA] CTD PMID:34256052 Mthfr Rat 3,3',4,4',5-pentachlorobiphenyl increases expression EXP 6480464 3,4,5,3',4'-pentachlorobiphenyl results in increased expression of MTHFR mRNA CTD PMID:34256052 Mthfr Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of MTHFR mRNA CTD PMID:28522335 Mthfr Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:1551392 6480464 bisphenol S results in increased expression of MTHFR mRNA CTD PMID:39298647 Mthfr Rat 4,4'-sulfonyldiphenol decreases methylation ISO RGD:733483 6480464 bisphenol S results in decreased methylation of MTHFR gene CTD PMID:31601247 Mthfr Rat 5,10-methylenetetrahydrofolic acid increases metabolic processing ISO RGD:733483 6480464 MTHFR protein results in increased metabolism of 5,10-methylenetetrahydrofolic acid CTD PMID:16187112 Mthfr Rat 5,10-methylenetetrahydrofolic acid increases reduction ISO RGD:733483 6480464 MTHFR protein results in increased reduction of 5,10-methylenetetrahydrofolic acid CTD PMID:7647779 Mthfr Rat 5-fluorouracil multiple interactions ISO RGD:733483 6480464 MTHFR gene polymorphism results in increased susceptibility to [Fluorouracil co-treated with Leucovorin] CTD PMID:18633250 Mthfr Rat 5-fluorouracil increases response to substance ISO RGD:733483 6480464 MTHFR gene polymorphism results in increased susceptibility to Fluorouracil CTD PMID:15735113|PMID:18034621 Mthfr Rat 5-fluorouracil increases metabolic processing ISO RGD:733483 6480464 MTHFR protein results in increased metabolism of Fluorouracil CTD PMID:18034621 Mthfr Rat 5-fluorouracil affects response to substance ISO RGD:733483 6480464 MTHFR gene polymorphism affects the susceptibility to Fluorouracil; MTHFR protein affects the susceptibility to Fluorouracil; more ... CTD PMID:15608557|PMID:15735113|PMID:16399440|PMID:16785472|PMID:17047490|PMID:18034621|PMID:19203896 Mthfr Rat 5-formyltetrahydrofolic acid multiple interactions ISO RGD:733483 6480464 MTHFR gene polymorphism results in increased susceptibility to [Fluorouracil co-treated with Leucovorin] CTD PMID:18633250 Mthfr Rat 5-methyltetrahydrofolic acid increases chemical synthesis ISO RGD:733483 6480464 MTHFR protein results in increased chemical synthesis of 5-methyltetrahydrofolate CTD PMID:7647779|PMID:9719624 Mthfr Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of MTHFR mRNA CTD PMID:30047161 Mthfr Rat 7-Hydroxymethotrexate decreases response to substance ISO RGD:733483 6480464 MTHFR mRNA results in decreased susceptibility to 7-hydroxymethotrexate CTD PMID:19426680 Mthfr Rat aflatoxin B1 increases expression ISO RGD:1551392 6480464 Aflatoxin B1 results in increased expression of MTHFR mRNA CTD PMID:19770486 Mthfr Rat aflatoxin B1 decreases expression EXP 6480464 Aflatoxin B1 results in decreased expression of MTHFR mRNA CTD PMID:33354967 Mthfr Rat aflatoxin B1 increases methylation ISO RGD:733483 6480464 Aflatoxin B1 results in increased methylation of MTHFR gene CTD PMID:27153756 Mthfr Rat all-trans-retinoic acid decreases expression ISO RGD:733483 6480464 Tretinoin results in decreased expression of MTHFR mRNA CTD PMID:23724009 Mthfr Rat all-trans-retinoic acid increases expression ISO RGD:733483 6480464 Tretinoin results in increased expression of MTHFR mRNA CTD PMID:23830798 Mthfr Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of MTHFR mRNA CTD PMID:30047161 Mthfr Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of MTHFR mRNA CTD PMID:16483693 Mthfr Rat ancitabine affects response to substance ISO RGD:733483 6480464 MTHFR protein affects the susceptibility to Ancitabine CTD PMID:18202788 Mthfr Rat antirheumatic drug decreases expression ISO RGD:733483 6480464 Antirheumatic Agents results in decreased expression of MTHFR mRNA CTD PMID:24449571 Mthfr Rat aristolochic acid A increases expression ISO RGD:733483 6480464 aristolochic acid I results in increased expression of MTHFR mRNA CTD PMID:33212167 Mthfr Rat arsane multiple interactions ISO RGD:733483 6480464 MTHFR gene polymorphism affects the metabolism of and affects the susceptibility to Arsenic CTD PMID:17365577|PMID:17548696 Mthfr Rat arsane affects response to substance ISO RGD:733483 6480464 MTHFR gene SNP affects the susceptibility to Arsenic CTD PMID:31864032 Mthfr Rat arsane increases response to substance ISO RGD:733483 6480464 MTHFR gene SNP results in increased susceptibility to Arsenic CTD PMID:22747749 Mthfr Rat arsane affects methylation ISO RGD:733483 6480464 MTHFR polymorphism affects the methylation of Arsenic CTD PMID:17440589 Mthfr Rat arsane affects metabolic processing ISO RGD:733483 6480464 MTHFR gene polymorphism affects the metabolism of Arsenic; MTHFR polymorphism affects the metabolism of Arsenic CTD PMID:17365577|PMID:17637926 Mthfr Rat arsenic atom multiple interactions ISO RGD:733483 6480464 MTHFR gene polymorphism affects the metabolism of and affects the susceptibility to Arsenic CTD PMID:17365577|PMID:17548696 Mthfr Rat arsenic atom affects response to substance ISO RGD:733483 6480464 MTHFR gene SNP affects the susceptibility to Arsenic CTD PMID:31864032 Mthfr Rat arsenic atom increases response to substance ISO RGD:733483 6480464 MTHFR gene SNP results in increased susceptibility to Arsenic CTD PMID:22747749 Mthfr Rat arsenic atom affects methylation ISO RGD:733483 6480464 MTHFR polymorphism affects the methylation of Arsenic CTD PMID:17440589 Mthfr Rat arsenic atom affects metabolic processing ISO RGD:733483 6480464 MTHFR gene polymorphism affects the metabolism of Arsenic; MTHFR polymorphism affects the metabolism of Arsenic CTD PMID:17365577|PMID:17637926 Mthfr Rat benazepril affects response to substance ISO RGD:733483 6480464 MTHFR gene polymorphism affects the susceptibility to benazepril; MTHFR gene SNP affects the susceptibility to more ... CTD PMID:16081343|PMID:20445573 Mthfr Rat benzo[a]pyrene decreases methylation ISO RGD:733483 6480464 Benzo(a)pyrene results in decreased methylation of MTHFR 5' UTR CTD PMID:27901495 Mthfr Rat benzo[b]fluoranthene decreases expression ISO RGD:1551392 6480464 benzo(b)fluoranthene results in decreased expression of MTHFR mRNA CTD PMID:26377693 Mthfr Rat beta-lapachone decreases expression ISO RGD:733483 6480464 beta-lapachone results in decreased expression of MTHFR mRNA CTD PMID:38218311 Mthfr Rat bifenthrin increases expression ISO RGD:1551392 6480464 bifenthrin results in increased expression of MTHFR mRNA CTD PMID:26071804 Mthfr Rat bis(2-ethylhexyl) phthalate increases expression ISO RGD:1551392 6480464 Diethylhexyl Phthalate results in increased expression of MTHFR mRNA CTD PMID:34319233 Mthfr Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of MTHFR mRNA CTD PMID:25181051 Mthfr Rat bisphenol A increases expression ISO RGD:733483 6480464 bisphenol A results in increased expression of MTHFR mRNA CTD PMID:29275510 Mthfr Rat bisphenol F decreases expression ISO RGD:1551392 6480464 bisphenol F results in decreased expression of MTHFR mRNA CTD PMID:38685157 Mthfr Rat bromobenzene decreases expression EXP 6480464 bromobenzene results in decreased expression of MTHFR mRNA CTD PMID:32479839 Mthfr Rat butanal decreases expression ISO RGD:733483 6480464 butyraldehyde results in decreased expression of MTHFR mRNA CTD PMID:26079696 Mthfr Rat calcitriol increases expression ISO RGD:733483 6480464 Calcitriol results in increased expression of MTHFR mRNA CTD PMID:21592394 Mthfr Rat calcitriol multiple interactions ISO RGD:733483 6480464 [Testosterone co-treated with Calcitriol] results in increased expression of MTHFR mRNA CTD PMID:21592394 Mthfr Rat carbon nanotube increases expression ISO RGD:1551392 6480464 Nanotubes, Carbon analog results in increased expression of MTHFR mRNA; Nanotubes, Carbon results in increased more ... CTD PMID:25554681|PMID:25620056 Mthfr Rat choline multiple interactions ISO RGD:1551392 6480464 [Choline deficiency co-treated with Folic Acid deficiency co-treated with Methionine deficiency] results in increased expression more ... CTD PMID:20938992|PMID:23439872|PMID:29127188 Mthfr Rat clozapine affects response to substance ISO RGD:733483 6480464 MTHFR gene polymorphism affects the susceptibility to Clozapine; MTHFR protein affects the susceptibility to Clozapine CTD PMID:20547447 Mthfr Rat copper atom affects abundance ISO RGD:733483 6480464 MTHFR protein polymorphism affects the abundance of Copper CTD PMID:24583748 Mthfr Rat copper(0) affects abundance ISO RGD:733483 6480464 MTHFR protein polymorphism affects the abundance of Copper CTD PMID:24583748 Mthfr Rat corosolic acid decreases expression ISO RGD:733483 6480464 corosolic acid results in decreased expression of MTHFR mRNA CTD PMID:37939859 Mthfr Rat crocidolite asbestos decreases expression ISO RGD:733483 6480464 Asbestos, Crocidolite results in decreased expression of MTHFR mRNA CTD PMID:29523930 Mthfr Rat crocidolite asbestos increases expression ISO RGD:1551392 6480464 Asbestos, Crocidolite results in increased expression of MTHFR mRNA CTD PMID:29279043 Mthfr Rat cyanocob(III)alamin decreases expression EXP 6480464 Vitamin B 12 deficiency results in decreased expression of MTHFR mRNA CTD PMID:25003120 Mthfr Rat cyanocob(III)alamin multiple interactions EXP 6480464 [Folic Acid co-treated with Vitamin B 12 deficiency] results in decreased expression of MTHFR mRNA; more ... CTD PMID:25003120 Mthfr Rat cyproconazole increases expression EXP 6480464 cyproconazole results in increased expression of MTHFR mRNA CTD PMID:25182419 Mthfr Rat cytarabine affects response to substance ISO RGD:733483 6480464 MTHFR protein affects the susceptibility to Cytarabine CTD PMID:18202788 Mthfr Rat dibenz[a,h]anthracene decreases expression ISO RGD:1551392 6480464 1,2,5,6-dibenzanthracene results in decreased expression of MTHFR mRNA CTD PMID:26377693 Mthfr Rat Dibutyl phosphate affects expression ISO RGD:733483 6480464 di-n-butylphosphoric acid affects the expression of MTHFR mRNA CTD PMID:37042841 Mthfr Rat epoxiconazole increases expression EXP 6480464 epoxiconazole results in increased expression of MTHFR mRNA CTD PMID:25182419 Mthfr Rat fentin chloride decreases expression EXP 6480464 triphenyltin chloride results in decreased expression of MTHFR mRNA CTD PMID:37156404 Mthfr Rat floxuridine affects response to substance ISO RGD:733483 6480464 MTHFR protein affects the susceptibility to Floxuridine CTD PMID:18202788 Mthfr Rat folic acid affects expression ISO RGD:733483 6480464 Folic Acid affects the expression of MTHFR mRNA CTD PMID:17311948 Mthfr Rat folic acid decreases methylation ISO RGD:733483 6480464 Folic Acid results in decreased methylation of MTHFR promoter CTD PMID:29644877 Mthfr Rat folic acid affects response to substance ISO RGD:1551392 6480464 MTHFR protein affects the susceptibility to Folic Acid CTD PMID:25733650 Mthfr Rat folic acid multiple interactions EXP 6480464 [Folic Acid co-treated with Vitamin B 12 deficiency] results in decreased expression of MTHFR mRNA; more ... CTD PMID:25003120|PMID:33788065 Mthfr Rat folic acid decreases activity ISO RGD:1551392 6480464 Folic Acid results in decreased activity of MTHFR protein CTD PMID:25733650 Mthfr Rat folic acid multiple interactions ISO RGD:1551392 6480464 [Choline deficiency co-treated with Folic Acid deficiency co-treated with Methionine deficiency] results in increased expression more ... CTD PMID:20938992|PMID:23439872|PMID:24386282|PMID:29127188|PMID:30502384 Mthfr Rat folic acid affects metabolic processing ISO RGD:733483 6480464 MTHFR gene polymorphism affects the metabolism of Folic Acid; MTHFR protein affects the metabolism of more ... CTD PMID:20532609|PMID:20547447 Mthfr Rat folic acid affects abundance ISO RGD:733483 6480464 MTHFR gene polymorphism affects the abundance of Folic Acid; MTHFR gene SNP affects the abundance more ... CTD PMID:16621645|PMID:16690736|PMID:21869730 Mthfr Rat folic acid decreases abundance ISO RGD:733483 6480464 MTHFR gene mutant form results in decreased abundance of Folic Acid CTD PMID:17115185 Mthfr Rat folic acid multiple interactions ISO RGD:733483 6480464 [Folic Acid co-treated with MTHFR gene SNP] affects the methylation of MGMT promoter; Folic Acid more ... CTD PMID:16375580|PMID:16646054|PMID:17301267 Mthfr Rat gallic acid decreases expression ISO RGD:733483 6480464 Gallic Acid results in decreased expression of MTHFR mRNA CTD PMID:34408198 Mthfr Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of MTHFR mRNA CTD PMID:33387578 Mthfr Rat gold atom multiple interactions ISO RGD:1551392 6480464 [Gold co-treated with Polyethylene Glycols] results in decreased expression of MTHFR mRNA CTD PMID:19695318 Mthfr Rat gold(0) multiple interactions ISO RGD:1551392 6480464 [Gold co-treated with Polyethylene Glycols] results in decreased expression of MTHFR mRNA CTD PMID:19695318 Mthfr Rat GSK-J4 decreases expression ISO RGD:733483 6480464 GSK-J4 results in decreased expression of MTHFR mRNA CTD PMID:29301935 Mthfr Rat GW 4064 multiple interactions ISO RGD:1551392 6480464 NR0B2 protein promotes the reaction [GW 4064 results in decreased expression of MTHFR mRNA] CTD PMID:29416063 Mthfr Rat GW 4064 decreases expression ISO RGD:1551392 6480464 GW 4064 results in decreased expression of MTHFR mRNA CTD PMID:29416063 Mthfr Rat homocysteine affects abundance ISO RGD:1551392 6480464 MTHFR protein affects the abundance of Homocysteine metabolite CTD PMID:19204075 Mthfr Rat homocysteine increases expression ISO RGD:1551392 6480464 Homocysteine results in increased expression of MTHFR protein CTD PMID:18540024 Mthfr Rat homocysteine multiple interactions ISO RGD:733483 6480464 Homocysteine inhibits the reaction [Simvastatin results in increased expression of MTHFR protein modified form]; Simvastatin more ... CTD PMID:18540024 Mthfr Rat homocysteine decreases methylation ISO RGD:733483 6480464 MTHFR protein SNP results in decreased methylation of Homocysteine CTD PMID:17387702 Mthfr Rat homocysteine increases abundance ISO RGD:733483 6480464 MTHFR gene polymorphism results in increased abundance of Homocysteine; MTHFR protein mutant form results in more ... CTD PMID:19646848|PMID:7647779 Mthfr Rat homocysteine affects metabolic processing ISO RGD:733483 6480464 MTHFR protein affects the metabolism of Homocysteine CTD PMID:20547447 Mthfr Rat homocysteine increases expression ISO RGD:733483 6480464 Homocysteine results in increased expression of MTHFR protein CTD PMID:18540024 Mthfr Rat homocysteine multiple interactions ISO RGD:1551392 6480464 [MTHFR gene mutant form co-treated with Methotrexate] results in increased abundance of Homocysteine CTD PMID:19593106 Mthfr Rat indole-3-methanol multiple interactions EXP 6480464 [indole-3-carbinol co-treated with Diethylnitrosamine] results in increased expression of MTHFR mRNA CTD PMID:22129741 Mthfr Rat inulin multiple interactions ISO RGD:1551392 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of MTHFR mRNA CTD PMID:36331819 Mthfr Rat iron dichloride decreases expression ISO RGD:733483 6480464 ferrous chloride results in decreased expression of MTHFR mRNA CTD PMID:35984750 Mthfr Rat L-methionine multiple interactions ISO RGD:1551392 6480464 [Choline deficiency co-treated with Folic Acid deficiency co-treated with Methionine deficiency] results in increased expression more ... CTD PMID:20938992|PMID:29127188 Mthfr Rat maneb multiple interactions ISO RGD:1551392 6480464 [Paraquat co-treated with Maneb] results in decreased expression of MTHFR mRNA CTD PMID:18386188 Mthfr Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of MTHFR mRNA CTD PMID:30047161 Mthfr Rat methotrexate affects expression ISO RGD:1551392 6480464 Methotrexate affects the expression of MTHFR mRNA CTD PMID:18502557 Mthfr Rat methotrexate decreases expression EXP 6480464 Methotrexate results in decreased expression of MTHFR mRNA CTD PMID:30502384 Mthfr Rat methotrexate multiple interactions EXP 6480464 DHFR protein inhibits the reaction [Methotrexate results in decreased expression of MTHFR mRNA] CTD PMID:30502384 Mthfr Rat methotrexate decreases expression ISO RGD:1551392 6480464 Methotrexate results in decreased expression of MTHFR mRNA CTD PMID:30502384 Mthfr Rat methotrexate multiple interactions ISO RGD:1551392 6480464 [MTHFR gene mutant form co-treated with Methotrexate] results in increased abundance of Homocysteine; Folic Acid more ... CTD PMID:19593106|PMID:30502384 Mthfr Rat methotrexate increases response to substance ISO RGD:1551392 6480464 MTHFR gene mutant form results in increased susceptibility to Methotrexate CTD PMID:19593106 Mthfr Rat methotrexate affects abundance ISO RGD:733483 6480464 MTHFR gene polymorphism affects the abundance of Methotrexate CTD PMID:24241962 Mthfr Rat methotrexate increases expression ISO RGD:733483 6480464 Methotrexate results in increased expression of MTHFR mRNA CTD PMID:23838799 Mthfr Rat methotrexate decreases expression ISO RGD:733483 6480464 Methotrexate results in decreased expression of MTHFR mRNA CTD PMID:24449571 Mthfr Rat methotrexate decreases response to substance ISO RGD:733483 6480464 MTHFR mRNA results in decreased susceptibility to Methotrexate CTD PMID:19426680 Mthfr Rat methotrexate affects response to substance ISO RGD:733483 6480464 MTHFR gene polymorphism affects the susceptibility to Methotrexate; MTHFR gene SNP affects the susceptibility to more ... CTD PMID:17488658|PMID:17502830|PMID:18381794|PMID:19821069|PMID:21064136|PMID:22104130|PMID:25007187 Mthfr Rat methotrexate increases response to substance ISO RGD:733483 6480464 MTHFR polymorphism results in increased susceptibility to Methotrexate CTD PMID:21887680 Mthfr Rat methotrexate decreases metabolic processing ISO RGD:733483 6480464 MTHFR gene SNP results in decreased metabolism of Methotrexate CTD PMID:19391036 Mthfr Rat methotrexate affects metabolic processing ISO RGD:733483 6480464 MTHFR gene polymorphism affects the metabolism of Methotrexate CTD PMID:15753437 Mthfr Rat methotrexate affects response to substance ISO RGD:1551392 6480464 MTHFR protein affects the susceptibility to Methotrexate CTD PMID:18551038 Mthfr Rat N-methyl-4-phenylpyridinium increases expression ISO RGD:1551392 6480464 1-Methyl-4-phenylpyridinium results in increased expression of MTHFR mRNA CTD PMID:22776087 Mthfr Rat N-methyl-N'-nitro-N-nitrosoguanidine increases methylation ISO RGD:733483 6480464 Methylnitronitrosoguanidine results in increased methylation of MTHFR promoter CTD PMID:29644877 Mthfr Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [indole-3-carbinol co-treated with Diethylnitrosamine] results in increased expression of MTHFR mRNA CTD PMID:22129741 Mthfr Rat N-nitrosodiethylamine multiple interactions ISO RGD:1551392 6480464 [Diethylnitrosamine co-treated with Carbon Tetrachloride] results in increased expression of MTHFR mRNA CTD PMID:29127188 Mthfr Rat nickel atom increases expression ISO RGD:733483 6480464 Nickel results in increased expression of MTHFR mRNA CTD PMID:24768652|PMID:25583101 Mthfr Rat olanzapine affects response to substance ISO RGD:733483 6480464 MTHFR gene polymorphism affects the susceptibility to olanzapine; MTHFR protein affects the susceptibility to olanzapine CTD PMID:20547447 Mthfr Rat paracetamol decreases expression ISO RGD:733483 6480464 Acetaminophen results in decreased expression of MTHFR mRNA CTD PMID:21420995 Mthfr Rat paracetamol increases expression ISO RGD:733483 6480464 Acetaminophen results in increased expression of MTHFR mRNA CTD PMID:26690555 Mthfr Rat paraquat multiple interactions ISO RGD:1551392 6480464 [MTHFR gene polymorphism affects the susceptibility to Paraquat] which results in increased expression of AIF1 more ... CTD PMID:18386188|PMID:30726997 Mthfr Rat paraquat affects response to substance ISO RGD:1551392 6480464 MTHFR gene polymorphism affects the susceptibility to Paraquat CTD PMID:30726997 Mthfr Rat parathion decreases expression ISO RGD:1551392 6480464 Parathion results in decreased expression of MTHFR mRNA CTD PMID:34813904 Mthfr Rat PCB138 multiple interactions ISO RGD:1551392 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Mthfr Rat pentanal decreases expression ISO RGD:733483 6480464 pentanal results in decreased expression of MTHFR mRNA CTD PMID:26079696 Mthfr Rat perfluorooctane-1-sulfonic acid multiple interactions ISO RGD:1551392 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of MTHFR mRNA; [perfluorooctane sulfonic more ... CTD PMID:36331819 Mthfr Rat phenylhydrazine multiple interactions EXP 6480464 Folic Acid inhibits the reaction [phenylhydrazine results in decreased activity of MTHFR protein] CTD PMID:33788065 Mthfr Rat phenylhydrazine decreases activity EXP 6480464 phenylhydrazine results in decreased activity of MTHFR protein CTD PMID:33788065 Mthfr Rat pirinixic acid increases expression ISO RGD:1551392 6480464 pirinixic acid results in increased expression of MTHFR mRNA CTD PMID:18301758|PMID:20813756|PMID:23811191 Mthfr Rat propiconazole decreases expression EXP 6480464 propiconazole results in decreased expression of MTHFR mRNA CTD PMID:30047161 Mthfr Rat raloxifene decreases expression ISO RGD:733483 6480464 Raloxifene Hydrochloride results in decreased expression of MTHFR mRNA CTD PMID:15849065 Mthfr Rat riboflavin affects response to substance ISO RGD:733483 6480464 MTHFR gene polymorphism affects the susceptibility to Riboflavin CTD PMID:17303386 Mthfr Rat ritodrine decreases expression ISO RGD:1551392 6480464 Ritodrine results in decreased expression of MTHFR mRNA CTD PMID:23370008 Mthfr Rat silver atom decreases expression ISO RGD:1551392 6480464 Silver results in decreased expression of MTHFR mRNA CTD PMID:27131904 Mthfr Rat silver(0) decreases expression ISO RGD:1551392 6480464 Silver results in decreased expression of MTHFR mRNA CTD PMID:27131904 Mthfr Rat simvastatin multiple interactions ISO RGD:733483 6480464 Homocysteine inhibits the reaction [Simvastatin results in increased expression of MTHFR protein modified form]; Simvastatin more ... CTD PMID:18540024 Mthfr Rat simvastatin increases expression ISO RGD:1551392 6480464 Simvastatin results in increased expression of MTHFR protein modified form CTD PMID:18540024 Mthfr Rat simvastatin multiple interactions ISO RGD:1551392 6480464 MTHFR gene mutant form inhibits the reaction [Simvastatin results in increased expression of APOA1 protein]; more ... CTD PMID:18540024 Mthfr Rat simvastatin affects response to substance ISO RGD:1551392 6480464 MTHFR affects the susceptibility to Simvastatin CTD PMID:18540024 Mthfr Rat simvastatin increases expression ISO RGD:733483 6480464 Simvastatin results in increased expression of MTHFR protein modified form CTD PMID:18540024 Mthfr Rat sodium arsenate increases response to substance ISO RGD:1551392 6480464 MTHFR gene mutant form results in increased susceptibility to sodium arsenate CTD PMID:24384392 Mthfr Rat sodium arsenite decreases expression ISO RGD:733483 6480464 sodium arsenite results in decreased expression of MTHFR mRNA; sodium arsenite results in decreased expression more ... CTD PMID:19766132|PMID:30664189 Mthfr Rat sodium arsenite increases expression ISO RGD:1551392 6480464 sodium arsenite results in increased expression of MTHFR mRNA CTD PMID:30357543 Mthfr Rat streptozocin multiple interactions ISO RGD:1551392 6480464 [Streptozocin co-treated with Dietary Fats] results in increased expression of MTHFR mRNA CTD PMID:29127188 Mthfr Rat sulfasalazine increases response to substance ISO RGD:733483 6480464 MTHFR gene polymorphism results in increased susceptibility to Sulfasalazine; MTHFR protein results in increased susceptibility more ... CTD PMID:19578646 Mthfr Rat sunitinib increases expression ISO RGD:733483 6480464 Sunitinib results in increased expression of MTHFR mRNA CTD PMID:31533062 Mthfr Rat tamoxifen increases expression ISO RGD:1551392 6480464 Tamoxifen results in increased expression of MTHFR mRNA CTD PMID:25123088 Mthfr Rat tamoxifen decreases expression ISO RGD:733483 6480464 Tamoxifen results in decreased expression of MTHFR mRNA CTD PMID:15849065 Mthfr Rat testosterone increases expression ISO RGD:733483 6480464 Testosterone results in increased expression of MTHFR mRNA CTD PMID:21592394 Mthfr Rat testosterone multiple interactions ISO RGD:733483 6480464 [Testosterone co-treated with Calcitriol] results in increased expression of MTHFR mRNA CTD PMID:21592394 Mthfr Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of MTHFR mRNA CTD PMID:31150632 Mthfr Rat tetrachloromethane multiple interactions ISO RGD:1551392 6480464 [Diethylnitrosamine co-treated with Carbon Tetrachloride] results in increased expression of MTHFR mRNA CTD PMID:29127188 Mthfr Rat tetrahydrocurcumin affects expression ISO RGD:1551392 41410880 Tetrahydrocurcumin affects expression of protein and mRNA in ischemia/reperfusion CBS+/- mice RGD Mthfr Rat titanium dioxide decreases methylation ISO RGD:1551392 6480464 titanium dioxide results in decreased methylation of MTHFR promoter alternative form CTD PMID:35295148 Mthfr Rat triadimefon decreases expression EXP 6480464 triadimefon results in decreased expression of MTHFR mRNA CTD PMID:30047161 Mthfr Rat tributylstannane decreases expression ISO RGD:1551392 6480464 tributyltin results in decreased expression of MTHFR mRNA CTD PMID:31939706 Mthfr Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of MTHFR mRNA CTD PMID:33387578 Mthfr Rat triphenyl phosphate affects expression ISO RGD:733483 6480464 triphenyl phosphate affects the expression of MTHFR mRNA CTD PMID:37042841 Mthfr Rat troglitazone increases expression ISO RGD:1551392 6480464 troglitazone results in increased expression of MTHFR mRNA CTD PMID:28973697 Mthfr Rat valproic acid affects expression ISO RGD:1551392 6480464 Valproic Acid affects the expression of MTHFR mRNA CTD PMID:9188671 Mthfr Rat valproic acid increases expression ISO RGD:733483 6480464 Valproic Acid results in increased expression of MTHFR mRNA CTD PMID:23179753 Mthfr Rat valproic acid increases methylation ISO RGD:733483 6480464 Valproic Acid results in increased methylation of MTHFR gene CTD PMID:29154799 Mthfr Rat vigabatrin increases response to substance ISO RGD:1551392 6480464 MTHFR results in increased susceptibility to Vigabatrin CTD PMID:21490592
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
(1->4)-beta-D-glucan (ISO) 1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO) 1,2-dichloroethane (ISO) 17beta-estradiol (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,4'-trichlorobiphenyl (ISO) 2-acetamidofluorene (EXP) 2-butoxyethanol (ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP) 3-chloropropane-1,2-diol (EXP) 4,4'-sulfonyldiphenol (ISO) 5,10-methylenetetrahydrofolic acid (ISO) 5-fluorouracil (ISO) 5-formyltetrahydrofolic acid (ISO) 5-methyltetrahydrofolic acid (ISO) 6-propyl-2-thiouracil (EXP) 7-Hydroxymethotrexate (ISO) aflatoxin B1 (EXP,ISO) all-trans-retinoic acid (ISO) amitrole (EXP) ammonium chloride (EXP) ancitabine (ISO) antirheumatic drug (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) benazepril (ISO) benzo[a]pyrene (ISO) benzo[b]fluoranthene (ISO) beta-lapachone (ISO) bifenthrin (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) bromobenzene (EXP) butanal (ISO) calcitriol (ISO) carbon nanotube (ISO) choline (ISO) clozapine (ISO) copper atom (ISO) copper(0) (ISO) corosolic acid (ISO) crocidolite asbestos (ISO) cyanocob(III)alamin (EXP) cyproconazole (EXP) cytarabine (ISO) dibenz[a,h]anthracene (ISO) Dibutyl phosphate (ISO) epoxiconazole (EXP) fentin chloride (EXP) floxuridine (ISO) folic acid (EXP,ISO) gallic acid (ISO) gentamycin (EXP) gold atom (ISO) gold(0) (ISO) GSK-J4 (ISO) GW 4064 (ISO) homocysteine (ISO) indole-3-methanol (EXP) inulin (ISO) iron dichloride (ISO) L-methionine (ISO) maneb (ISO) methimazole (EXP) methotrexate (EXP,ISO) N-methyl-4-phenylpyridinium (ISO) N-methyl-N'-nitro-N-nitrosoguanidine (ISO) N-nitrosodiethylamine (EXP,ISO) nickel atom (ISO) olanzapine (ISO) paracetamol (ISO) paraquat (ISO) parathion (ISO) PCB138 (ISO) pentanal (ISO) perfluorooctane-1-sulfonic acid (ISO) phenylhydrazine (EXP) pirinixic acid (ISO) propiconazole (EXP) raloxifene (ISO) riboflavin (ISO) ritodrine (ISO) silver atom (ISO) silver(0) (ISO) simvastatin (ISO) sodium arsenate (ISO) sodium arsenite (ISO) streptozocin (ISO) sulfasalazine (ISO) sunitinib (ISO) tamoxifen (ISO) testosterone (ISO) tetrachloromethane (EXP,ISO) tetrahydrocurcumin (ISO) titanium dioxide (ISO) triadimefon (EXP) tributylstannane (ISO) trichloroethene (EXP) triphenyl phosphate (ISO) troglitazone (ISO) valproic acid (ISO) vigabatrin (ISO)
1.
Hyperhomocysteinemia and the MTHFR C677T polymorphism promote steatosis and fibrosis in chronic hepatitis C patients.
Adinolfi LE, etal., Hepatology. 2005 May;41(5):995-1003.
2.
Frequency of the MTHFR C677T polymorphism in Yemeni children with sickle cell disease.
Al-Saqladi AW, etal., Hemoglobin. 2010;34(1):67-77. doi: 10.3109/09687630903554111.
3.
Endothelial cell dysfunction in women with cardiac syndrome X and MTHFR C677T mutation.
Alroy S, etal., Isr Med Assoc J. 2007 Apr;9(4):321-5.
4.
Analysis of polymorphism in renin angiotensin system and other related genes in South Indian chronic kidney disease patients.
Anbazhagan K, etal., Clin Chim Acta. 2009 Aug;406(1-2):108-12. Epub 2009 Jun 9.
5.
The effect of riboflavin deficiency on methylenetetrahydrofolate reductase (NADPH) (EC 1.5.1.20) and folate metabolism in the rat.
Bates CJ and Fuller NJ, Br J Nutr. 1986 Mar;55(2):455-64.
6.
Analysis of inherited thrombophilic mutations and natural anticoagulant deficiency in patients with idiopathic portal hypertension.
Bayan K, etal., J Thromb Thrombolysis. 2009 Jul;28(1):57-62. doi: 10.1007/s11239-008-0244-8. Epub 2008 Aug 7.
7.
Hyperhomocysteinemia and hypercoagulability in primary biliary cirrhosis.
Biagini MR, etal., World J Gastroenterol. 2006 Mar 14;12(10):1607-12.
8.
Mild neonatal hypoxia exacerbates the effects of vitamin-deficient diet on homocysteine metabolism in rats.
Blaise S, etal., Pediatr Res 2005 Jun;57(6):777-82. Epub 2005 Apr 21.
9.
Overview of homocysteine and folate metabolism. With special references to cardiovascular disease and neural tube defects.
Blom HJ and Smulders Y, J Inherit Metab Dis. 2011 Feb;34(1):75-81. doi: 10.1007/s10545-010-9177-4. Epub 2010 Sep 4.
10.
Methylenetetrahydrofolate reductase (MTHFR) polymorphisms and promoter methylation in cervical oncogenic lesions and cancer.
Botezatu A, etal., J Cell Mol Med. 2013 Apr;17(4):543-9. doi: 10.1111/jcmm.12032. Epub 2013 Feb 28.
11.
5,10-Methylenetetrahydrofolate reductase gene variants and congenital anomalies: a HuGE review.
Botto LD and Yang Q, Am J Epidemiol. 2000 May 1;151(9):862-77.
12.
Methylenetetrahydrofolate reductase 677 T allele protects against persistent HBV infection in West Africa.
Bronowicki JP, etal., J Hepatol. 2008 Apr;48(4):532-9. doi: 10.1016/j.jhep.2007.11.017. Epub 2008 Jan 2.
13.
Methylenetetrahydrofolate reductase in the rat central nervous system: intracellular and regional distribution.
Burton EG and Sallach HJ, Arch Biochem Biophys. 1975 Feb;166(2):483-94.
14.
Lack of association between inherited thrombophilic risk factors and idiopathic sudden sensorineural hearing loss in Italian patients.
Cadoni G, etal., Ann Otol Rhinol Laryngol. 2006 Mar;115(3):195-200.
15.
Genetic polymorphisms of MTHFR and aberrant promoter hypermethylation of the RASSF1A gene in bladder cancer risk in a Chinese population.
Cai DW, etal., J Int Med Res. 2009 Nov-Dec;37(6):1882-9.
16.
Sudden hearing loss and MTHFR 677C>T/1298A>C gene polymorphisms.
Capaccio P, etal., Genet Med. 2005 Mar;7(3):206-8.
17.
Effect of chronic phenobarbital treatment on folates and one-carbon enzymes in the rat.
Carl GF and Smith DB, Biochem Pharmacol. 1984 Nov 1;33(21):3457-63.
18.
The effect of chronic phenytoin treatment on tissue folate concentrations and on the activities of the methyl synthetic enzymes in the rat.
Carl GF and Smith DB, J Nutr. 1983 Nov;113(11):2368-74.
19.
Effect of chronic valproate treatment on folate-dependent methyl biosynthesis in the rat.
Carl GF Neurochem Res. 1986 May;11(5):671-85.
20.
Effect of chronic primidone treatment on folate-dependent one-carbon metabolism in the rat.
Carl GF, etal., Biochem Pharmacol. 1987 Jul 1;36(13):2139-44.
21.
Effect of methionine-loading on methyl group synthesis and activation in rat brain and liver.
Carl GF, etal., Biol Psychiatry. 1978 Dec;13(6):661-9.
22.
The MTHFR C677T polymorphism is associated with mitral valve rheumatic heart disease.
Carlus SJ, etal., Eur Rev Med Pharmacol Sci. 2016;20(1):109-14.
23.
Homocysteine and stroke: evidence on a causal link from mendelian randomisation.
Casas JP, etal., Lancet. 2005 Jan 15-21;365(9455):224-32.
24.
Non-alcoholic fatty liver disease (NAFLD) and MTHFR 1298A > C gene polymorphism.
Catalano D, etal., Eur Rev Med Pharmacol Sci. 2014;18(2):151-9.
25.
Cloning and expression of 5, 10-Methylenetetrahydrofolate reductase (MTHFR) gene.
Chen G, etal., Sci China C Life Sci. 1998 Dec;41(6):636-43.
26.
Impact of methylenetetrahydrofolate reductase polymorphisms and folate intake on the risk of gastric cancer and their association with Helicobacter pylori infection and tumor site.
Chen J, etal., Genet Mol Res. 2014 Jan 24;13(4):9718-26. doi: 10.4238/2014.January.24.2.
27.
The anti-folate effect of methionine on bone marrow of normal and vitamin B12 deficient rats.
Cheng FW, etal., Br J Haematol. 1975 Nov;31(3):323-36.
28.
The role of MTHFR and RFC1 polymorphisms on toxicity and outcome of adult patients with hematological malignancies treated with high-dose methotrexate followed by leucovorin rescue.
Chiusolo P, etal., Cancer Chemother Pharmacol. 2012 Mar;69(3):691-6. doi: 10.1007/s00280-011-1751-4. Epub 2011 Oct 9.
29.
MTHFR Gene variants C677T, A1298C and association with Down syndrome: A Case-control study from South India.
Cyril C, etal., Indian J Hum Genet. 2009 May;15(2):60-4. doi: 10.4103/0971-6866.55217.
30.
Thrombophilic genetic factors PAI-1 4G-4G and MTHFR 677TT as risk factors of alcohol, cryptogenic liver cirrhosis and portal vein thrombosis, in a Caucasian population.
D'Amico M, etal., Gene. 2015 Aug 15;568(1):85-8. doi: 10.1016/j.gene.2015.05.034. Epub 2015 May 16.
31.
The role of vitamin B12 in fasting hyperhomocysteinemia and its interaction with the homozygous C677T mutation of the methylenetetrahydrofolate reductase (MTHFR) gene. A case-control study of patients with early-onset thrombotic events.
D'Angelo A, etal., Thromb Haemost. 2000 Apr;83(4):563-70.
32.
Cigarette smoke increases intimal hyperplasia and homocysteine in a rat carotid endarterectomy.
Davis JA, etal., J Surg Res. 2004 Sep;121(1):69-75.
33.
MTHFR C677T/A1298C genotype: a possible risk factor for liver sinusoidal obstruction syndrome.
Efrati E, etal., Bone Marrow Transplant. 2014 May;49(5):726-7. doi: 10.1038/bmt.2014.16. Epub 2014 Mar 3.
34.
Association of factor V Leiden, Janus kinase 2, prothrombin, and MTHFR mutations with primary Budd-Chiari syndrome in Egyptian patients.
El Sebay HM, etal., J Gastroenterol Hepatol. 2016 Jan;31(1):235-40. doi: 10.1111/jgh.13066.
35.
MTHFR C677T, A1298C and ACE I/D polymorphisms as risk factors for diabetic nephropathy among type 2 diabetic patients.
El-Baz R, etal., J Renin Angiotensin Aldosterone Syst. 2012 May 3.
36.
Study of the pharmacokinetic and pharmacogenetic contribution to the toxicity of high-dose methotrexate in children with acute lymphoblastic leukemia.
El-Khodary NM, etal., Med Oncol. 2012 Sep;29(3):2053-62. doi: 10.1007/s12032-011-9997-6. Epub 2011 Jun 5.
37.
Methylenetetrahydrofolate reductase gene polymorphisms in Turkish children with attention-deficit/hyperactivity disorder.
Ergul E, etal., Genet Test Mol Biomarkers. 2012 Jan;16(1):67-9. doi: 10.1089/gtmb.2011.0062. Epub 2011 Aug 5.
38.
Neural tube defects, vitamins and homocysteine.
Eskes TK Eur J Pediatr 1998 Apr;157 Suppl 2:S139-41.
39.
Thrombophilic risk factors in the pathogenesis of non-arteritic anterior ischemic optic neuropathy patients.
Felekis T, etal., Graefes Arch Clin Exp Ophthalmol. 2010 Jun;248(6):877-84. doi: 10.1007/s00417-010-1308-y. Epub 2010 Feb 17.
40.
Impact of the MTHFR C677T polymorphism on risk of Wilms tumor: case-control study.
Ferrara M, etal., J Pediatr Hematol Oncol. 2009 Apr;31(4):256-8.
41.
Identifying multiple causative genes at a single GWAS locus.
Flister MJ, etal., Genome Res. 2013 Dec;23(12):1996-2002. doi: 10.1101/gr.160283.113. Epub 2013 Sep 4.
42.
Methylenetetrahydrofolate reductase (MTHFR) deficiency enhances resistance against cytomegalovirus infection.
Fodil-Cornu N, etal., Genes Immun. 2009 Oct;10(7):662-6. doi: 10.1038/gene.2009.50. Epub 2009 Jul 16.
43.
Comprehensive analysis of Methylenetetrahydrofolate reductase C677T in younger acute lymphoblastic leukemia patients: A single-center experience.
Frikha R, etal., J Oncol Pharm Pract. 2019 Jul;25(5):1182-1186. doi: 10.1177/1078155218818244. Epub 2018 Dec 14.
44.
Methylenetetrahydrofolate reductase (MTHFR) polymorphism A1298C (Glu429Ala) predicts decline in renal function over time in the African-American Study of Kidney Disease and Hypertension (AASK) Trial and Veterans Affairs Hypertension Cohort (VAHC).
Fung MM, etal., Nephrol Dial Transplant. 2012 Jan;27(1):197-205. Epub 2011 May 25.
45.
Role of genetic and acquired prothrombotic risk factors in genesis of sudden sensorineural hearing loss.
Fusconi M, etal., Audiol Neurootol. 2011;16(3):185-90. doi: 10.1159/000319310. Epub 2010 Aug 25.
46.
The G1691 --> A mutation of factor V, but not the G20210 --> A mutation of factor II or the C677 --> T mutation of methylenetetrahydrofolate reductase genes, is associated with venous thrombosis in patients with lupus anticoagulants.
Galli M, etal., Br J Haematol. 2000 Mar;108(4):865-70.
47.
MTHFR C677T mutation in central retinal vein occlusion: a case-control study in Chinese population.
Gao W, etal., Thromb Res. 2008;121(5):699-703. Epub 2007 Aug 23.
48.
Identification of a biomarker profile associated with resistance to neoadjuvant chemoradiation therapy in rectal cancer.
Garcia-Aguilar J, etal., Ann Surg. 2011 Sep;254(3):486-92; discussion 492-3.
49.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
50.
C677T substitution in the methylenetetrahydrofolate reductase gene as a risk factor for venous thrombosis and arterial disease in selected patients.
Gemmati D, etal., Haematologica. 1999 Sep;84(9):824-8.
51.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
52.
Renal vascular sclerosis is associated with inherited thrombophilias.
Goforth RL, etal., Kidney Int. 2006 Aug;70(4):743-50. Epub 2006 Jun 7.
53.
Analysis of thrombophilic genetic mutations in patients with Sheehan's syndrome: is thrombophilia responsible for the pathogenesis of Sheehan's syndrome?
Gokalp D, etal., Pituitary. 2011 Jun;14(2):168-73. doi: 10.1007/s11102-010-0276-x.
54.
Methylenetetrahydrofolate reductase gene polymorphisms in children with attention deficit hyperactivity disorder.
Gokcen C, etal., Int J Med Sci. 2011;8(7):523-8. Epub 2011 Aug 30.
55.
Methylenetetrahydrofolate reductase C677T and reduced folate carrier 80 G>A polymorphisms are associated with an increased risk of conotruncal heart defects.
Gong D, etal., Clin Chem Lab Med. 2012 Feb 4;50(8):1455-61. doi: 10.1515/cclm-2011-0759.
56.
MTHFR polymorphic variant C677T is associated to vascular complications in sickle-cell disease.
Hatzlhofer BL, etal., Genet Test Mol Biomarkers. 2012 Sep;16(9):1038-43. doi: 10.1089/gtmb.2011.0361. Epub 2012 Aug 27.
57.
The common mutations C677T and A1298C in the human methylenetetrahydrofolate reductase gene are associated with hyperhomocysteinemia and cardiovascular disease in hemodialysis patients.
Haviv YS, etal., Nephron. 2002 Sep;92(1):120-6.
58.
MTHFR, MTR and MTRR polymorphisms and risk of chronic kidney disease in Japanese: cross-sectional data from the J-MICC Study.
Hishida A, etal., Int Urol Nephrol. 2013 Apr 18.
59.
The importance of homozygous polymorphisms of methylenetetrahydrofolate reductase gene in romanian patients with idiopathic venous thromboembolism.
Hotoleanu C, etal., Balkan Med J. 2013 Jun;30(2):197-203. doi: 10.5152/balkanmedj.2013.7159. Epub 2013 Jun 1.
60.
Assays of methylenetetrahydrofolate reductase and methionine synthase activities by monitoring 5-methyltetrahydrofolate and tetrahydrofolate using high-performance liquid chromatography with fluorescence detection.
Huang L, etal., Anal Biochem. 2001 Dec 15;299(2):253-9.
61.
Association between polymorphisms in genes encoding methylenetetrahydrofolate reductase and the risk of Meniere's disease.
Huang Y, etal., J Neurogenet. 2013 Jun;27(1-2):5-10. doi: 10.3109/01677063.2013.770510. Epub 2013 Mar 13.
62.
Plasminogen activator inhibitor 1 and methylenetetrahydrofolate reductase gene mutations in iranian women with polycystic ovary syndrome.
Idali F, etal., Am J Reprod Immunol. 2012 Nov;68(5):400-7. doi: 10.1111/aji.12002. Epub 2012 Aug 6.
63.
IL-4 and MTHFR gene polymorphism in rheumatoid arthritis and their effects.
Inanir A, etal., Immunol Lett. 2013 May;152(2):104-8. doi: 10.1016/j.imlet.2013.05.004. Epub 2013 May 15.
64.
Synergistic effects of prothrombotic polymorphisms and atherogenic factors on the risk of myocardial infarction in young males.
Inbal A, etal., Blood. 1999 Apr 1;93(7):2186-90.
65.
MTHFR gene polymorphisms in bladder cancer in the Turkish population.
Izmirli M, etal., Asian Pac J Cancer Prev. 2011;12(7):1833-5.
66.
Effects of streptozotocin-induced diabetes and of insulin treatment on homocysteine metabolism in the rat.
Jacobs RL, etal., Diabetes. 1998 Dec;47(12):1967-70.
67.
Effect of the MTHFR C677T and A1298C polymorphisms on survival in patients with advanced CKD and ESRD: a prospective study.
Jamison RL, etal., Am J Kidney Dis. 2009 May;53(5):779-89. Epub 2009 Mar 9.
68.
The relationship between methylenetetrahydrofolate reductase polymorphism and hematological malignancy.
Jiang N, etal., Clin Lab. 2014;60(5):767-74.
69.
C677T variant in the methylentetrahydrofolate reductase gene is a genetic risk factor for primary open-angle glaucoma.
Junemann AG, etal., Am J Ophthalmol. 2005 Apr;139(4):721-3.
70.
Genetic risk factors for thrombosis in systemic lupus erythematosus.
Kaiser R, etal., J Rheumatol. 2012 Aug;39(8):1603-10. Epub 2012 Jun 15.
71.
Association of MTHFR gene C677T mutation with recurrent aphthous stomatitis and number of oral ulcers.
Kalkan G, etal., Clin Oral Investig. 2014;18(2):437-41. doi: 10.1007/s00784-013-0997-0. Epub 2013 May 11.
72.
Possible Association Between the Methylenetetrahydrofolate Reductase Gene C677T Polymorphism and Preexisting Portal Vein Thrombosis in Liver Transplant Recipients.
Kamei H, etal., Exp Clin Transplant. 2016 Jun;14(3):313-6.
73.
Methylenetetrahydrofolate Reductase gene polymorphism in patients receiving hemodialysis.
Kiseljakovic E, etal., Bosn J Basic Med Sci. 2010 Apr;10 Suppl 1:S91-5.
74.
MTHFR 677C-->T polymorphism and risk of coronary heart disease: a meta-analysis.
Klerk M, etal., JAMA. 2002 Oct 23-30;288(16):2023-31.
75.
Polymorphisms of 5,10-methylenetetrahydrofolate reductase (MTHFR C677T) and thymidylate synthase enhancer region (TSER) as a risk factor of cholangiocarcinoma in a Korean population.
Ko KH, etal., Anticancer Res. 2006 Nov-Dec;26(6B):4229-33.
76.
Role of epigenetic and miR-22 and miR-29b alterations in the downregulation of Mat1a and Mthfr genes in early preneoplastic livers in rats induced by 2-acetylaminofluorene.
Koturbash I, etal., Mol Carcinog. 2011 Dec 27. doi: 10.1002/mc.21861.
77.
The C677T methylenetetrahydrofolate reductase gene mutation and nephropathy in type 2 diabetes mellitus.
Ksiazek P, etal., Med Sci Monit. 2004 Feb;10(2):BR47-51.
78.
Association of congenital cardiovascular malformations with 33 single nucleotide polymorphisms of selected cardiovascular disease-related genes.
Kuehl K, etal., Birth Defects Res A Clin Mol Teratol. 2010 Feb;88(2):101-10.
79.
The thermolabile variant of 5,10-methylenetetrahydrofolate reductase is a possible risk factor for amyotrophic lateral sclerosis.
Kuhnlein P, etal., Amyotroph Lateral Scler. 2011 Mar;12(2):136-9. doi: 10.3109/17482968.2010.536985. Epub 2010 Dec 6.
80.
Interrelationships among genetic C677T polymorphism of 5,10-methylenetetrahydrofolate reductase, biochemical folate status, and lymphocytic p53 oxidative damage in association with tumor malignancy and survivals of patients with hepatocellular carcinoma.
Kuo CS, etal., Mol Nutr Food Res. 2014 Feb;58(2):329-42. doi: 10.1002/mnfr.201200479. Epub 2013 Aug 29.
81.
Methylenetetrahydrofolate reductase (MTHFR) and methionine synthase reductase (MTRR) gene polymorphisms as risk factors for hepatocellular carcinoma in a Korean population.
Kwak SY, etal., Anticancer Res. 2008 Sep-Oct;28(5A):2807-11.
82.
Association of methylenetetrahydrofolate reductase polymorphism and the risk of squamous cell carcinoma in renal transplant patients.
Laing ME, etal., Transplantation. 2007 Jul 15;84(1):113-6.
83.
Complete deficiency of methylenetetrahydrofolate reductase in mice is associated with impaired retinal function and variable mortality, hematological profiles, and reproductive outcomes.
Lawrance AK, etal., J Inherit Metab Dis. 2011 Feb;34(1):147-57. doi: 10.1007/s10545-010-9127-1. Epub 2010 Jun 8.
84.
MTHFR C677T polymorphism as a risk factor for vascular calcification in chronic hemodialysis patients.
Lee SY, etal., J Korean Med Sci. 2011 Mar;26(3):461-5. Epub 2011 Feb 25.
85.
Hyperhomocysteinemia and the MTHFR C677T mutation in Budd-Chiari syndrome.
Li XM, etal., Am J Hematol. 2002 Sep;71(1):11-4.
86.
A common haplotype for the 677T thermolabile variant of the 5,10-methylenetetrahydrofolate reductase gene in thrombophilic patients and controls.
Linnebank M, etal., Hum Mutat. 2002 Dec;20(6):478.
87.
Retinal vein occlusion associated with methylenetetrahydrofolate reductase mutation.
Loewenstein A, etal., Ophthalmology. 1999 Sep;106(9):1817-20.
88.
MTHFR gene polymorphism is susceptible to diabetic retinopathy but not to diabetic nephropathy in Japanese type 2 diabetic patients.
Maeda M, etal., J Diabetes Complications. 2008 Mar-Apr;22(2):119-25.
89.
Association study between methylenetetrahydrofolate reductase gene polymorphisms and Graves' disease.
Mao R, etal., Cell Biochem Funct. 2010 Oct;28(7):585-90. doi: 10.1002/cbf.1694.
90.
Thrombophilic risk factors in patients with severe carotid atherosclerosis.
Marcucci R, etal., J Thromb Haemost. 2005 Mar;3(3):502-7.
91.
Prognostic significance of folate metabolism polymorphisms for lung cancer.
Matakidou A, etal., Br J Cancer. 2007 Jul 16;97(2):247-52. Epub 2007 May 29.
92.
Methylenetetrahydrofolate reductase: a common human polymorphism and its biochemical implications.
Matthews RG Chem Rec 2002;2(1):4-12.
93.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
94.
MTHFR gene C677T and A1298C polymorphisms and homocysteine levels in primary open angle and primary closed angle glaucoma.
Micheal S, etal., Mol Vis. 2009 Nov 9;15:2268-78.
95.
MTHFR 677CC/1298CC genotypes are highly associated with chronic myelogenous leukemia: a case-control study in Korea.
Moon HW, etal., Leuk Res. 2007 Sep;31(9):1213-7. Epub 2006 Dec 6.
96.
Polymorphisms in one-carbon metabolism and trans-sulfuration pathway genes and susceptibility to bladder cancer.
Moore LE, etal., Int J Cancer. 2007 Jun 1;120(11):2452-8.
97.
Folate metabolism genes, vegetable intake and renal cancer risk in central Europe.
Moore LE, etal., Int J Cancer. 2008 Apr 15;122(8):1710-5.
98.
Association of methylene tetrahydrofolate reductase C677T genotype with type 2 diabetes mellitus patients with and without renal complications.
Movva S, etal., Genet Test Mol Biomarkers. 2011 Apr;15(4):257-61. Epub 2010 Dec 27.
99.
MTHFR C677T and A1298C gene polymorphisms and hyperhomocysteinemia as risk factors of diabetic nephropathy in type 2 diabetes patients.
Mtiraoui N, etal., Diabetes Res Clin Pract. 2007 Jan;75(1):99-106. Epub 2006 Jul 7.
100.
Methylenetetrahydrofolate reductase (MTHFR) C677T and A1298C polymorphisms and the risk of primary hepatocellular carcinoma (HCC) in a Chinese population.
Mu LN, etal., Cancer Causes Control. 2007 Aug;18(6):665-75. doi: 10.1007/s10552-007-9012-x. Epub 2007 May 15.
101.
Homocysteine, methylenetetrahydrofolate reductase and risk of schizophrenia: a meta-analysis.
Muntjewerff JW, etal., Mol Psychiatry. 2006 Feb;11(2):143-9.
102.
Folate-mediated incorporation of ring-2-carbon of histidine into nucleic acids: influence of thyroid hormone.
Nair CP, etal., Metabolism. 1994 Dec;43(12):1575-8.
103.
Defective homocysteine metabolism as a risk factor for diabetic retinopathy.
Neugebauer S, etal., Lancet. 1997 Feb 15;349(9050):473-4.
104.
MTHFR C677T polymorphism and differential methylation status in gastric cancer: an association with Helicobacter pylori infection.
Neves Filho EH, etal., Virchows Arch. 2010 Dec;457(6):627-33. doi: 10.1007/s00428-010-0996-3. Epub 2010 Oct 19.
105.
Prenatal alcohol exposure alters methyl metabolism and programs serotonin transporter and glucocorticoid receptor expression in brain.
Ngai YF, etal., Am J Physiol Regul Integr Comp Physiol. 2015 Sep;309(5):R613-22. doi: 10.1152/ajpregu.00075.2015. Epub 2015 Jul 15.
106.
[Frequency of C677T polymorphism of 5, 10-methylenetetrahydrofolate reductase (MTHFR) in Chilean mothers of spina bifida cases and controls ].
Nitsche F, etal., Rev Med Chil. 2003 Dec;131(12):1399-404.
107.
MTHFR gene C677T and A1298C variants are associated with FMF risk in a Turkish cohort.
Nursal AF, etal., J Clin Lab Anal. 2018 Feb;32(2). doi: 10.1002/jcla.22259. Epub 2017 May 22.
108.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
109.
5,10 Methylenetetrahydrofolate reductase genetic polymorphism as a risk factor for neural tube defects.
Ou CY, etal., Am J Med Genet. 1996 Jun 28;63(4):610-4.
110.
Recurrent pregnancy loss and its relation to combined parental thrombophilic gene mutations.
Ozdemir O, etal., Genet Test Mol Biomarkers. 2012 Apr;16(4):279-86. doi: 10.1089/gtmb.2011.0191. Epub 2011 Nov 2.
111.
5,10-Methylenetetrahydrofolate reductase C677T gene polymorphism in Behcet's patients with or without ocular involvement.
Ozkul Y, etal., Br J Ophthalmol. 2005 Dec;89(12):1634-7.
112.
MTHFR C677T polymorphism associates with unexplained infertile male factors.
Park JH, etal., J Assist Reprod Genet. 2005 Oct;22(9-10):361-8.
113.
Methotrexate in pediatric osteosarcoma: response and toxicity in relation to genetic polymorphisms and dihydrofolate reductase and reduced folate carrier 1 expression.
Patino-Garcia A, etal., J Pediatr. 2009 May;154(5):688-93. Epub 2009 Jan 21.
114.
Low vitamin B6, and not plasma homocysteine concentration, as risk factor for abdominal aortic aneurysm: a retrospective case-control study.
Peeters AC, etal., J Vasc Surg. 2007 Apr;45(4):701-5.
115.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
116.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
117.
MTHFR A1298C polymorphism is associated with cardiovascular risk in end stage renal disease in North Indians.
Poduri A, etal., Mol Cell Biochem. 2008 Jan;308(1-2):43-50. Epub 2007 Sep 25.
118.
Methylenetetrahydrofolate reductase polymorphism 677C>T is associated with peripheral arterial disease in type 2 diabetes.
Pollex RL, etal., Cardiovasc Diabetol. 2005 Nov 7;4:17.
119.
MTHFR C677T and A1298C polymorphisms are risk factors for Down's syndrome in Indian mothers.
Rai AK, etal., J Hum Genet. 2006;51(4):278-83. Epub 2006 Feb 18.
120.
MTHFR c.677C>T is a risk factor for non-syndromic cleft lip with or without cleft palate in Chile.
Ramirez-Chau C, etal., Oral Dis. 2016 Oct;22(7):703-8. doi: 10.1111/odi.12533. Epub 2016 Aug 1.
121.
Genetic basis for adverse events after smallpox vaccination.
Reif DM, etal., J Infect Dis. 2008 Jul 1;198(1):16-22. doi: 10.1086/588670.
122.
Can MTHFR C677T and A1298C Polymorphisms Alter the Risk and Severity of Sporadic Breast Cancer in Brazilian Women?
Rezende LM, etal., Clin Breast Cancer. 2017 Jul;17(4):e199-e208. doi: 10.1016/j.clbc.2017.02.004. Epub 2017 Feb 16.
123.
GOA pipeline
RGD automated data pipeline
124.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
125.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
126.
No association of MTHFR c.677C>T variant with sporadic ALS in an Italian population.
Ricci C, etal., Neurobiol Aging. 2012 Jan;33(1):208.e7-8. doi: 10.1016/j.neurobiolaging.2011.07.010. Epub 2011 Aug 25.
127.
Association of drug metabolism gene polymorphisms with toxicities, graft-versus-host disease and survival after HLA-identical sibling hematopoietic stem cell transplantation for patients with leukemia.
Rocha V, etal., Leukemia. 2009 Mar;23(3):545-56. Epub 2008 Nov 13.
128.
Polymorphisms in one-carbon metabolism pathway genes and risk for bladder cancer in a Tunisian population.
Rouissi K, etal., Cancer Genet Cytogenet. 2009 Nov;195(1):43-53.
129.
Impact of methylenetetrahydrofolate reductase C677T polymorphism on the risk of gastric cancer and its interaction with Helicobacter pylori infection.
Saberi S, etal., Iran Biomed J. 2012;16(4):179-84. doi: 10.6091/ibj.1102.2012.
130.
Methylenetetrahydrofolate reductase (MTHFR) gene C677T, A1298C and G1793A polymorphisms: association with risk for clear cell renal cell carcinoma and tumour behaviour in men.
Safarinejad MR, etal., Clin Oncol (R Coll Radiol). 2012 May;24(4):269-81. doi: 10.1016/j.clon.2011.03.005. Epub 2011 Apr 13.
131.
Genetic susceptibility of methylenetetrahydrofolate reductase (MTHFR) gene C677T, A1298C, and G1793A polymorphisms with risk for bladder transitional cell carcinoma in men.
Safarinejad MR, etal., Med Oncol. 2011 Dec;28 Suppl 1:S398-412. Epub 2010 Oct 29.
132.
Gender-specific association of methylenetetrahydrofolate reductase genotype and haplotype with the aggressiveness and prognosis of clear cell renal cell carcinoma in Japanese patients.
Sakano S, etal., BJU Int. 2010 Aug;106(3):424-30. Epub 2009 Dec 22.
133.
Methylenetetrahydrofolate reductase gene variant (MTHFR C677T) and migraine: a case control study and meta-analysis.
Samaan Z, etal., BMC Neurol. 2011 Jun 2;11:66. doi: 10.1186/1471-2377-11-66.
134.
Methylenetetrahydrofolate reductase gene polymorphisms in patients with nonalcoholic steatohepatitis (NASH).
Sazci A, etal., Cell Biochem Funct. 2008 Apr;26(3):291-6. doi: 10.1002/cbf.1424.
135.
Characterization of six novel mutations in the methylenetetrahydrofolate reductase (MTHFR) gene in patients with homocystinuria.
Sibani S, etal., Hum Mutat. 2000;15(3):280-7.
136.
Genetic polymorphisms of methylenetetrahydrofolate reductase and promoter methylation of MGMT and FHIT genes in diffuse large B cell lymphoma risk in Middle East.
Siraj AK, etal., Ann Hematol. 2007 Dec;86(12):887-95. Epub 2007 Aug 22.
137.
Plasma total homocysteine levels and methylenetetrahydrofolate reductase gene polymorphism in patients with type 2 diabetes mellitus.
Soares AL, etal., Pathophysiol Haemost Thromb. 2008;36(5):275-81. Epub 2009 Dec 9.
138.
Methylenetetrahydrofolate reductase C677T mutation and risk of retinal vein thrombosis.
Soltanpour MS, etal., J Res Med Sci. 2013 Jun;18(6):487-91.
139.
Association between 5,10-methylenetetrahydrofolate reductase C677T and A1298C polymorphisms and conotruncal heart defects.
Storti S, etal., Clin Chem Lab Med. 2003 Mar;41(3):276-80.
140.
Trafficking of intracellular folates.
Stover PJ and Field MS, Adv Nutr. 2011 Jul;2(4):325-31. doi: 10.3945/¿an.111.000596. Epub 2011 Jun 28.
141.
Polymorphisms in 1-carbon metabolism, epigenetics and folate-related pathologies.
Stover PJ J Nutrigenet Nutrigenomics. 2011;4(5):293-305. doi: 10.1159/000334586. Epub 2012 Feb 22.
142.
The TT genotype of the C677T polymorphism in the methylentetrahydrofolate reductase as a risk factor in thrombotic microangiopathies: results from a pilot study.
Sucker C, etal., Clin Appl Thromb Hemost. 2009 May-Jun;15(3):283-8.
143.
Alcohol drinking and one-carbon metabolism-related gene polymorphisms on pancreatic cancer risk.
Suzuki T, etal., Cancer Epidemiol Biomarkers Prev. 2008 Oct;17(10):2742-7.
144.
Analysis of candidate genes for age-related macular degeneration subtypes in the Japanese population.
Tanaka K, etal., Mol Vis. 2011;17:2751-8. Epub 2011 Oct 22.
145.
Methylene tetrahydrofolate reductase gene polymorphism in Egyptian children with acute lymphoblastic leukemia.
Tantawy AA, etal., Blood Coagul Fibrinolysis. 2010 Jan;21(1):28-34. doi: 10.1097/MBC.0b013e32833135e9.
146.
Atopy, asthma, and lung function in relation to folate and vitamin B in adults.
Thuesen BH, etal., Allergy. 2010 Nov;65(11):1446-54. doi: 10.1111/j.1398-9995.2010.02378.x.
147.
Effect of methylenetetrahydrofolate reductase 677C-->T polymorphism on toxicity and homocysteine plasma level after chronic methotrexate treatment of ovarian cancer patients.
Toffoli G, etal., Int J Cancer. 2003 Jan 20;103(3):294-9.
148.
Analysis of the MTHFR (methylenetetrahydrofolate reductase) 677 C>T and 1298 A>C polymorphisms in BCR-ABL-negative myeloproliferative neoplasms.
Trifa AP, etal., Int J Lab Hematol. 2013 Feb;35(1):e9-12. doi: 10.1111/ijlh.12017. Epub 2012 Oct 29.
149.
Role of thrombotic risk factors in end-stage renal disease.
Tripathi G, etal., Clin Appl Thromb Hemost. 2010 Apr;16(2):132-40. Epub 2009 Jun 10.
150.
Relationship of MTHFR gene polymorphisms with renal and cardiac disease.
Trovato FM, etal., World J Nephrol. 2015 Feb 6;4(1):127-37. doi: 10.5527/wjn.v4.i1.127.
151.
Effect of prothrombotic mutations on factor consumption in children with hemophilia.
Tuten H, etal., Clin Appl Thromb Hemost. 2013 Jul-Aug;19(4):445-8. doi: 10.1177/1076029612438610. Epub 2012 Mar 12.
152.
Tetrahydrocurcumin ameliorates homocysteinylated cytochrome-c mediated autophagy in hyperhomocysteinemia mice after cerebral ischemia.
Tyagi N, etal., J Mol Neurosci. 2012 May;47(1):128-38. doi: 10.1007/s12031-011-9695-z. Epub 2012 Jan 3.
153.
Hearing impairment risk and interaction of folate metabolism related gene polymorphisms in an aging study.
Uchida Y, etal., BMC Med Genet. 2011 Mar 7;12:35. doi: 10.1186/1471-2350-12-35.
154.
Methylenetetrahydrofolate reductase polymorphism and minor increase of risk for oral cancer.
Vairaktaris E, etal., J Cancer Res Clin Oncol. 2006 Apr;132(4):219-22. Epub 2005 Dec 20.
155.
Evaluation of infant methylenetetrahydrofolate reductase genotype, maternal vitamin use, and risk of high versus low level spina bifida defects.
Volcik KA, etal., Birth Defects Res A Clin Mol Teratol. 2003 Mar;67(3):154-7.
156.
Major determinants of hyperhomocysteinemia in peritoneal dialysis patients.
Vychytil A, etal., Kidney Int. 1998 Jun;53(6):1775-82. doi: 10.1046/j.1523-1755.1998.00918.x.
157.
[Study on the relations between genetic polymorphisms in methylenetetrahydrofolate reductase, methionine synthase and the risk of pancreatic cancer]
Wang L, etal., Zhonghua Liu Xing Bing Xue Za Zhi. 2006 Jan;27(1):50-4.
158.
Update and new concepts in vitamin responsive disorders of folate transport and metabolism.
Watkins D and Rosenblatt DS, J Inherit Metab Dis. 2012 Jul;35(4):665-70. doi: 10.1007/s10545-011-9418-1. Epub 2011 Nov 23.
159.
Methylenetetrahydrofolate reductase and methionine synthase reductase gene polymorphisms and protection from microvascular complications in adolescents with type 1 diabetes.
Wiltshire EJ, etal., Pediatr Diabetes. 2008 Aug;9(4 Pt 2):348-53.
160.
A prospective case-control study analyzes 12 thrombophilic gene mutations in Turkish couples with recurrent pregnancy loss.
Yenicesu GI, etal., Am J Reprod Immunol. 2010 Feb;63(2):126-36. doi: 10.1111/j.1600-0897.2009.00770.x. Epub 2009 Nov 10.
161.
The effect of IL-4 and MTHFR gene variants in ankylosing spondylitis.
Yigit S, etal., Z Rheumatol. 2015 Feb;74(1):60-6. doi: 10.1007/s00393-014-1403-2.
162.
C677T mutation of methylenetetrahydrofolate reductase gene and serum homocysteine levels in Turkish patients with coronary artery disease.
Yilmaz H, etal., Cell Biochem Funct. 2006 Jan-Feb;24(1):87-90.
163.
A comprehensive analysis of 12 thrombophilic mutations and related parameters in patients with inflammatory bowel disease: data from Turkey.
Yilmaz S, etal., J Thromb Thrombolysis. 2006 Dec;22(3):205-12.
164.
Genetic polymorphisms associated with retinal vein occlusion: a Greek case-control study and meta-analysis.
Yioti GG, etal., Ophthalmic Genet. 2013 Sep;34(3):130-9. doi: 10.3109/13816810.2012.746376. Epub 2013 Jan 4.
165.
Synergistic association of DNA repair relevant gene polymorphisms with the risk of coronary artery disease in northeastern Han Chinese.
Yu X, etal., Thromb Res. 2014 Feb;133(2):229-34. doi: 10.1016/j.thromres.2013.11.017. Epub 2013 Nov 25.
166.
Genetic polymorphisms in the methylenetetrahydrofolate reductase and thymidylate synthase genes and risk of hepatocellular carcinoma.
Yuan JM, etal., Hepatology. 2007 Sep;46(3):749-58. doi: 10.1002/hep.21735.
167.
Methylenetetrahydrofolate reductase genetic polymorphisms in patients with cataract.
Zetterberg M, etal., Am J Ophthalmol. 2005 Nov;140(5):932-4.
168.
Methylenetetrahydrofolate reductase genetic polymorphisms in patients with primary open-angle glaucoma.
Zetterberg M, etal., Ophthalmic Genet. 2007 Jun;28(2):47-50.
169.
Genetic polymorphisms in candidate genes predict increased toxicity with methotrexate therapy in Lebanese children with acute lymphoblastic leukemia.
Zgheib NK, etal., Pharmacogenet Genomics. 2014 Aug;24(8):387-96. doi: 10.1097/FPC.0000000000000069.
170.
[Relationship between the methylenetetrahydrofolate reductase gene polymorphism and adverse reactions of high-dose methotrexate in children with acute lymphocytic leukemia].
Zheng MM, etal., Zhongguo Dang Dai Er Ke Za Zhi. 2013 Mar;15(3):201-6.
171.
Prevalence of methylenetetrahydrofolate reductase C677T and its association with arterial and venous thrombosis in the Chinese population.
Zheng YZ, etal., Br J Haematol. 2000 Jun;109(4):870-4.
172.
Inherited DNA mutations contributing to thrombotic complications in patients with sickle cell disease.
Zimmerman SA and Ware RE, Am J Hematol. 1998 Dec;59(4):267-72.
173.
Genetic polymorphisms and the risk of progressive renal failure in elderly Hungarian patients.
Zsom M, etal., Hemodial Int. 2011 Oct;15(4):501-8. doi: 10.1111/j.1542-4758.2011.00593.x. Epub 2011 Sep 13.
Mthfr Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 163,748,346 - 163,768,141 (+) NCBI GRCr8 mRatBN7.2 5 158,465,248 - 158,484,999 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 158,465,296 - 158,483,797 (+) Ensembl mRatBN7.2 Ensembl Rnor_6.0 5 164,844,642 - 164,864,360 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 164,845,925 - 164,860,910 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 168,502,556 - 168,522,350 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 165,112,850 - 165,126,885 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 165,123,406 - 165,137,073 (+) NCBI Celera 5 156,747,024 - 156,766,742 (+) NCBI Celera Cytogenetic Map 5 q36 NCBI
MTHFR Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 11,785,723 - 11,805,964 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 11,785,723 - 11,806,455 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 11,845,780 - 11,866,021 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 11,768,374 - 11,788,702 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 11,780,944 - 11,800,248 NCBI Celera 1 10,959,433 - 10,979,782 (-) NCBI Celera Cytogenetic Map 1 p36.22 NCBI HuRef 1 11,000,872 - 11,021,217 (-) NCBI HuRef CHM1_1 1 11,833,709 - 11,854,054 (-) NCBI CHM1_1 T2T-CHM13v2.0 1 11,329,802 - 11,350,048 (-) NCBI T2T-CHM13v2.0
Mthfr Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 148,123,534 - 148,144,019 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 148,123,534 - 148,144,008 (+) Ensembl GRCm39 Ensembl GRCm38 4 148,039,077 - 148,059,562 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 148,039,077 - 148,059,551 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 147,413,186 - 147,433,671 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 146,885,022 - 146,903,349 (+) NCBI MGSCv36 mm8 Celera 4 150,305,674 - 150,326,065 (+) NCBI Celera Cytogenetic Map 4 E1 NCBI cM Map 4 78.67 NCBI
Mthfr Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955486 2,096,379 - 2,112,240 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955486 2,096,379 - 2,112,240 (+) NCBI ChiLan1.0 ChiLan1.0
MTHFR Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 216,418,108 - 216,434,079 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 215,063,577 - 215,079,672 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 10,548,196 - 10,568,174 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 11,766,334 - 11,785,645 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 11,766,334 - 11,785,419 (-) Ensembl panpan1.1 panPan2
MTHFR Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 2 84,445,526 - 84,457,435 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 2 84,380,919 - 84,536,818 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 2 80,977,302 - 80,990,296 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 2 85,109,058 - 85,123,378 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 2 85,109,070 - 85,122,016 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 2 81,858,180 - 81,870,539 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 2 82,857,476 - 82,872,293 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 2 83,920,334 - 83,933,329 (+) NCBI UU_Cfam_GSD_1.0
Mthfr
MTHFR Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 71,863,637 - 71,881,820 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 71,863,637 - 71,882,118 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 65,776,804 - 65,791,405 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
MTHFR Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 119,987,667 - 120,003,611 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 119,990,133 - 120,002,950 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666054 23,855,633 - 23,871,475 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Mthfr
.
Predicted Target Of
Count of predictions: 106 Count of miRNA genes: 91 Interacting mature miRNAs: 97 Transcripts: ENSRNOT00000011384 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
10053720 Scort26 Serum corticosterone level QTL 26 2.06 0.0147 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 5 124965598 166875058 Rat 631272 Lanf1 Left ventricular atrial natriuretic factor QTL 1 12 heart left ventricle natriuretic peptide A amount (VT:0010596) heart left ventricle natriuretic peptide A level (CMO:0002165) 5 151113452 166875058 Rat 1576314 Eutr1 Estrogen induced uterine response QTL 1 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 2138965 166875058 Rat 2302369 Scl60 Serum cholesterol level QTL 60 3.13 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 143608201 161165651 Rat 631562 Apr2 Acute phase response QTL 2 3.7 blood murinoglobulin 1 amount (VT:0010597) plasma murinoglobulin 1 level (CMO:0001931) 5 135927956 166875058 Rat 634349 Bp139 Blood pressure QTL 139 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 128924607 166875058 Rat 61444 Strs2 Sensitivity to stroke QTL 2 4.7 cerebrum integrity trait (VT:0010549) post-insult time to onset of cerebrovascular lesion (CMO:0002343) 5 135929696 166875058 Rat 724525 Bp147 Blood pressure QTL 147 4.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 126424772 166875058 Rat 1549904 Neuinf1 Neuroinflammation QTL 1 3 0 nervous system integrity trait (VT:0010566) blood T lymphocyte count (CMO:0000110) 5 154828214 166875058 Rat 738018 Anxrr4 Anxiety related response QTL 4 5.1 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 5 130130159 166875058 Rat 2313096 Bmd78 Bone mineral density QTL 78 3.1 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 5 144377876 161317411 Rat 8552908 Pigfal4 Plasma insulin-like growth factor 1 level QTL 4 6.6 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 128506074 166875058 Rat 61393 Bp7 Blood pressure QTL 7 4.5 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 60293434 161481680 Rat 7794791 Mcs33 Mammary carcinoma susceptibility QTL 33 1.93 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 5 131345754 166875058 Rat 1354631 Swd2 Spike wave discharge measurement QTL 2 3.64 0.0002 brain electrophysiology trait (VT:0010557) brain total spike-and-wave discharge duration (CMO:0001740) 5 151113452 164465185 Rat 1302790 Scl20 Serum cholesterol level QTL 20 6.4 0.0001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 82394392 166664054 Rat 1598861 Cm64 Cardiac mass QTL 64 2.9 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 127798274 166875058 Rat 1578766 Tcas11 Tongue tumor susceptibility QTL 11 4.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 5 46711509 161317411 Rat 631505 Bp103 Blood pressure QTL 103 3.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 132717196 165560427 Rat 1641920 Colcs1 Colorectal carcinoma susceptibility QTL 1 2.99 0.0055 intestine integrity trait (VT:0010554) benign colorectal tumor surface area measurement (CMO:0001799) 5 121846814 166846814 Rat 1298090 Bp155 Blood pressure QTL 155 3.8 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 5 151006154 161165494 Rat 1598819 Bp292 Blood pressure QTL 292 4.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 127798274 166875058 Rat 8694169 Bw148 Body weight QTL 148 5 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 128506074 166875058 Rat 1331721 Bp210 Blood pressure QTL 210 3.413 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 5 143069996 166846814 Rat
This gene Mthfr is modified in the following models/strains:
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000011384 ⟹ ENSRNOP00000011384
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 158,465,296 - 158,483,797 (+) Ensembl Rnor_6.0 Ensembl 5 164,845,925 - 164,860,910 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000102508 ⟹ ENSRNOP00000085916
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 158,467,151 - 158,483,797 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000118752 ⟹ ENSRNOP00000086290
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 158,465,415 - 158,483,797 (+) Ensembl
RefSeq Acc Id:
NM_001427042 ⟹ NP_001413971
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 163,748,554 - 163,768,105 (+) NCBI
RefSeq Acc Id:
XM_006239413 ⟹ XP_006239475
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 163,748,919 - 163,768,141 (+) NCBI mRatBN7.2 5 158,465,774 - 158,484,999 (+) NCBI Rnor_6.0 5 164,845,192 - 164,864,360 (+) NCBI Rnor_5.0 5 168,502,556 - 168,522,350 (+) NCBI
Sequence:
AGGCCTCCGTTGCCTCCTGAGAGCTGGGGAACAATGGGTCATTAGCTTCAGTGCCCAGGTGCCCATAGCGTCCTGCTGTTCACATACATCTATCACAGTGCTTCTGGGAGTGGTGGGCACTCAGTGTT
hide sequence
RefSeq Acc Id:
XM_006239414 ⟹ XP_006239476
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 163,748,346 - 163,768,141 (+) NCBI mRatBN7.2 5 158,465,248 - 158,484,999 (+) NCBI Rnor_6.0 5 164,844,642 - 164,864,360 (+) NCBI Rnor_5.0 5 168,502,556 - 168,522,350 (+) NCBI
Sequence:
CGCCTCCCGCTCTTTCTGTTTCCCTTAGCAACCGACAGCTAAGCCCCGCCTTCTCCGCATGTGC
hide sequence
RefSeq Acc Id:
XM_006239417 ⟹ XP_006239479
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 163,748,531 - 163,768,141 (+) NCBI mRatBN7.2 5 158,465,392 - 158,484,999 (+) NCBI Rnor_6.0 5 164,844,754 - 164,864,360 (+) NCBI Rnor_5.0 5 168,502,556 - 168,522,350 (+) NCBI
Sequence:
CAAAAGGCTTGGGACGCCGCGGAGGGATTCGCGGAGTCGGGAACACCTCGCCGCAGGCTAAACC
hide sequence
RefSeq Acc Id:
XM_342975 ⟹ XP_342976
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 163,748,931 - 163,768,141 (+) NCBI mRatBN7.2 5 158,465,777 - 158,484,999 (+) NCBI Rnor_6.0 5 164,845,192 - 164,864,360 (+) NCBI Rnor_5.0 5 168,502,556 - 168,522,350 (+) NCBI RGSC_v3.4 5 165,112,850 - 165,126,885 (+) RGD
Sequence:
AGGCCTCCGTTGCCTCCTGAGAGCTGGGGAACAATGGGTCATTAGCTTCAGTGCCCAGGTGCCC
hide sequence
RefSeq Acc Id:
XP_342976 ⟸ XM_342975
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6A4C5 (UniProtKB/TrEMBL), A6IU41 (UniProtKB/TrEMBL), A6IU42 (UniProtKB/TrEMBL)
- Sequence:
MNHQKAGVLPDGHCYTSLGMWASEAGCVGLSVPPSISRNPAMSNEARRSGSPSPRSEGSSSGSESSKDSSRCSTPSLDPDRHERLREKMRRRMDSGDKWFSLEFFPPRTAEGAVNLISRFDRMAAGGP
hide sequence
RefSeq Acc Id:
XP_006239476 ⟸ XM_006239414
- Peptide Label:
isoform X3
- UniProtKB:
D4A7E8 (UniProtKB/TrEMBL), A6IU40 (UniProtKB/TrEMBL), A6IU42 (UniProtKB/TrEMBL)
- Sequence:
MSRNPAMSNEARRSGSPSPRSEGSSSGSESSKDSSRCSTPSLDPDRHERLREKMRRRMDSGDKW
hide sequence
RefSeq Acc Id:
XP_006239479 ⟸ XM_006239417
- Peptide Label:
isoform X4
- UniProtKB:
A0A8I6A5Q6 (UniProtKB/TrEMBL), A6IU43 (UniProtKB/TrEMBL), A6IU42 (UniProtKB/TrEMBL)
- Sequence:
MSNEARRSGSPSPRSEGSSSGSESSKDSSRCSTPSLDPDRHERLREKMRRRMDSGDKWFSLEFFPPRTAEGAVNLISRFDRMAAGGPLFVDVTWHPAGDPGSDKETSSMMIASTALNYCGLETILHMT
hide sequence
RefSeq Acc Id:
XP_006239475 ⟸ XM_006239413
- Peptide Label:
isoform X2
- UniProtKB:
A6IU42 (UniProtKB/TrEMBL)
- Sequence:
MNHQKAGVLPDGHCYTSLGMWASEAGCVGLSVPPSIRNPAMSNEARRSGSPSPRSEGSSSGSES
hide sequence
Ensembl Acc Id:
ENSRNOP00000011384 ⟸ ENSRNOT00000011384
Ensembl Acc Id:
ENSRNOP00000086290 ⟸ ENSRNOT00000118752
Ensembl Acc Id:
ENSRNOP00000085916 ⟸ ENSRNOT00000102508
RefSeq Acc Id:
NP_001413971 ⟸ NM_001427042
- UniProtKB:
A6IU42 (UniProtKB/TrEMBL), A0A8I6A5Q6 (UniProtKB/TrEMBL), A6IU43 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2010-12-16
Mthfr
methylenetetrahydrofolate reductase (NAD(P)H)
Mthfr
5,10-methylenetetrahydrofolate reductase (NADPH)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-08-29
Mthfr
5,10-methylenetetrahydrofolate reductase (NADPH)
Mthfr
5,10-methylenetetrahydrofolate reductase
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-03-17
Mthfr
5,10-methylenetetrahydrofolate reductase
Mthfr_predicted
5,10-methylenetetrahydrofolate reductase (NADPH) (predicted)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-01-12
Mthfr_predicted
5,10-methylenetetrahydrofolate reductase (NADPH) (predicted)
Symbol and Name status set to approved
70820 APPROVED
