Predicted to have ATPase binding activity. Involved in brain development and positive regulation of intrinsic apoptotic signaling pathway. Localizes to the mitochondrion. Predicted to colocalize with the lysosome. Biomarker of intermittent claudication and transient cerebral ischemia. Orthologous to human BBC3 (BCL2 binding component 3); PARTICIPATES IN intrinsic apoptotic pathway; Huntington's disease pathway; measles pathway; INTERACTS WITH (S)-10-[(DIMETHYLAMINO)METHYL]-4-ETHYL-4,9-DIHYDROXY-1H-PYRANO[3',4':6,7]INOLIZINO[1,2-B]-QUINOLINE-3,14(4H,12H)-DIONE; 1,3-dinitrobenzene; 4-hydroxynon-2-enal.
fostriecin inhibits the reaction [Tetrachlorodibenzodioxin inhibits the reaction [Benzo(a)pyrene results in increased expression of BBC3 protein]] more ...
[3, 3'-diindolylmethane results in increased phosphorylation of and results in increased activity of TP53 protein] which results in increased expression of BBC3
4-phenylbutylamine inhibits the reaction [4-hydroxy-2-nonenal results in increased expression of BBC3 mRNA], Acetylcysteine inhibits the reaction [4-hydroxy-2-nonenal results in increased expression of BBC3 mRNA]
[Palmitic Acid co-treated with Glucose] results in increased expression of BBC3 mRNA, SIRT1 protein mutant form inhibits the reaction [[Palmitic Acid co-treated with Glucose] results in increased expression of BBC3 mRNA]
[Oxygen deficiency co-treated with Glucose deficiency] results in increased expression of BBC3 protein modified form, SIRT7 protein inhibits the reaction [[Oxygen deficiency co-treated with Glucose deficiency] results in increased expression of BBC3 protein]
BBC3 mutant form inhibits the reaction [Celecoxib results in increased activity of and results in increased localization of BAX protein], TP53 protein promotes the reaction [Celecoxib results in increased expression of BBC3 protein]
[tungsten carbide co-treated with Cobalt] results in increased expression of BBC3 mRNA, TP53 protein affects the reaction [Cobalt results in increased expression of BBC3 mRNA]
[cobaltous chloride co-treated with TP53 gene mutant form] results in decreased expression of BBC3 protein, cobaltous chloride inhibits the reaction [[Doxorubicin results in increased phosphorylation of and results in increased activity of TP53 protein] which results in increased expression of BBC3 mRNA]
[tungsten carbide co-treated with Cobalt] results in increased expression of BBC3 mRNA, TP53 protein affects the reaction [Cobalt results in increased expression of BBC3 mRNA]
[Palmitic Acid co-treated with Glucose] results in increased expression of BBC3 mRNA, SIRT1 protein mutant form inhibits the reaction [[Palmitic Acid co-treated with Glucose] results in increased expression of BBC3 mRNA]
[Oxygen deficiency co-treated with Glucose deficiency] results in increased expression of BBC3 protein modified form, SIRT7 protein inhibits the reaction [[Oxygen deficiency co-treated with Glucose deficiency] results in increased expression of BBC3 protein]
[Oxygen deficiency co-treated with Glucose deficiency] results in increased expression of BBC3 protein modified form, SIRT7 protein inhibits the reaction [[Oxygen deficiency co-treated with Glucose deficiency] results in increased expression of BBC3 protein]
[Dopamine results in increased expression of HIF1A protein] which results in increased expression of BBC3 mRNA, [Dopamine results in increased expression of HIF1A protein] which results in increased expression of BBC3 protein
entinostat promotes the reaction [Etoposide results in increased expression of BBC3 protein], Etoposide promotes the reaction [entinostat results in increased expression of BBC3 protein]
[Palmitic Acid co-treated with Glucose] results in increased expression of BBC3 mRNA, SIRT1 protein mutant form inhibits the reaction [[Palmitic Acid co-treated with Glucose] results in increased expression of BBC3 mRNA]
[Oxygen deficiency co-treated with Glucose deficiency] results in increased expression of BBC3 protein modified form, SIRT7 protein inhibits the reaction [[Oxygen deficiency co-treated with Glucose deficiency] results in increased expression of BBC3 protein]
[Palmitic Acid co-treated with Glucose] results in increased expression of BBC3 mRNA, SIRT1 protein mutant form inhibits the reaction [[Palmitic Acid co-treated with Glucose] results in increased expression of BBC3 mRNA]
[Ascorbic Acid co-treated with Zinc Acetate co-treated with motexafin gadolinium] results in decreased expression of BBC3 protein, benzyloxycarbonylleucyl-leucyl-leucine aldehyde inhibits the reaction [[Ascorbic Acid co-treated with Zinc Acetate co-treated with motexafin gadolinium] results in decreased expression of BBC3 protein]
[Doxorubicin co-treated with 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one] results in increased expression of BBC3 protein, TP53 protein promotes the reaction [[Doxorubicin co-treated with 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one] results in increased expression of BBC3 protein]
[Ascorbic Acid co-treated with Zinc Acetate co-treated with motexafin gadolinium] results in decreased expression of BBC3 protein, benzyloxycarbonylleucyl-leucyl-leucine aldehyde inhibits the reaction [[Ascorbic Acid co-treated with Zinc Acetate co-treated with motexafin gadolinium] results in decreased expression of BBC3 protein]
benzyloxycarbonylleucyl-leucyl-leucine aldehyde inhibits the reaction [[Ascorbic Acid co-treated with Zinc Acetate co-treated with motexafin gadolinium] results in decreased expression of BBC3 protein]
nutlin 3 promotes the reaction [Cisplatin results in increased expression of BBC3 mRNA], TP53 protein affects the reaction [nutlin 3 results in increased expression of BBC3 protein]
Erlotinib Hydrochloride promotes the reaction [resveratrol results in increased expression of BBC3 protein], resveratrol promotes the reaction [Erlotinib Hydrochloride results in increased expression of BBC3 protein]
[[Sirolimus co-treated with Cisplatin] results in increased expression of TP73 protein] which results in increased expression of BBC3 protein, Sirolimus promotes the reaction [TP53 protein results in increased expression of BBC3 protein]
Etoposide promotes the reaction [trichostatin A results in increased expression of BBC3 protein], trichostatin A promotes the reaction [Etoposide results in increased expression of BBC3 protein]
[BRAF protein mutant form results in increased susceptibility to vemurafenib] which results in increased expression of BBC3 protein, [MET protein affects the susceptibility to HGF protein] affects the reaction [[BRAF protein mutant form results in increased susceptibility to vemurafenib] which results in increased expression of BBC3 protein]
TNFSF10 protein promotes the reaction [vorinostat results in increased expression of BBC3 mRNA], TNFSF10 protein promotes the reaction [vorinostat results in increased expression of BBC3 protein]
[Ascorbic Acid co-treated with Zinc Acetate co-treated with motexafin gadolinium] results in decreased expression of BBC3 protein, benzyloxycarbonylleucyl-leucyl-leucine aldehyde inhibits the reaction [[Ascorbic Acid co-treated with Zinc Acetate co-treated with motexafin gadolinium] results in decreased expression of BBC3 protein]
MARARQEGSSPEPVEGLARDSPRPFPLGRLMPSAVSCGLCEPGLPAAPAAPALLPAAYLCAPTA PPAVTAALGGPRWPGGHRSRPRGPRPDGPQPSLSPAQQHLESPVPSAPEALAGGPTQAAPGVRV EEEEWAREIGAQLRRMADDLNAQYERRRQEEQHRHRPSPWRVMYNLFMGLLPLPRDPGAPEMEP N
Target capture sequencing of exons and conserved non-coding sequences. Provided by: Dr. Mikita Suyama (Kyushu University) and Dr. Takashi Kuramoto (Kyoto University)
Publications:
Yoshihara M, etal., Genom Data. 2016 Nov 14;10:155-157. eCollection 2016 Dec.
Target capture sequencing of exons and conserved non-coding sequences. Provided by: Dr. Mikita Suyama (Kyushu University) and Dr. Takashi Kuramoto (Kyoto University)
Publications:
Yoshihara M, etal., Genom Data. 2016 Nov 14;10:155-157. eCollection 2016 Dec.
Target capture sequencing of exons and conserved non-coding sequences. Provided by: Dr. Mikita Suyama (Kyushu University) and Dr. Takashi Kuramoto (Kyoto University)
Publications:
Yoshihara M, etal., Genom Data. 2016 Nov 14;10:155-157. eCollection 2016 Dec.
Target capture sequencing of exons and conserved non-coding sequences. Provided by: Dr. Mikita Suyama (Kyushu University) and Dr. Takashi Kuramoto (Kyoto University)
Publications:
Yoshihara M, etal., Genom Data. 2016 Nov 14;10:155-157. eCollection 2016 Dec.
Target capture sequencing of exons and conserved non-coding sequences. Provided by: Dr. Mikita Suyama (Kyushu University) and Dr. Takashi Kuramoto (Kyoto University)
Publications:
Yoshihara M, etal., Genom Data. 2016 Nov 14;10:155-157. eCollection 2016 Dec.
Target capture sequencing of exons and conserved non-coding sequences. Provided by: Dr. Mikita Suyama (Kyushu University) and Dr. Takashi Kuramoto (Kyoto University)
Publications:
Yoshihara M, etal., Genom Data. 2016 Nov 14;10:155-157. eCollection 2016 Dec.
Target capture sequencing of exons and conserved non-coding sequences. Provided by: Dr. Mikita Suyama (Kyushu University) and Dr. Takashi Kuramoto (Kyoto University)
Publications:
Yoshihara M, etal., Genom Data. 2016 Nov 14;10:155-157. eCollection 2016 Dec.
Target capture sequencing of exons and conserved non-coding sequences. Provided by: Dr. Mikita Suyama (Kyushu University) and Dr. Takashi Kuramoto (Kyoto University)
Publications:
Yoshihara M, etal., Genom Data. 2016 Nov 14;10:155-157. eCollection 2016 Dec.
Target capture sequencing of exons and conserved non-coding sequences. Provided by: Dr. Mikita Suyama (Kyushu University) and Dr. Takashi Kuramoto (Kyoto University)
Publications:
Yoshihara M, etal., Genom Data. 2016 Nov 14;10:155-157. eCollection 2016 Dec.
Target capture sequencing of exons and conserved non-coding sequences. Provided by: Dr. Mikita Suyama (Kyushu University) and Dr. Takashi Kuramoto (Kyoto University)
Publications:
Yoshihara M, etal., Genom Data. 2016 Nov 14;10:155-157. eCollection 2016 Dec.
Target capture sequencing of exons and conserved non-coding sequences. Provided by: Dr. Mikita Suyama (Kyushu University) and Dr. Takashi Kuramoto (Kyoto University)
Publications:
Yoshihara M, etal., Genom Data. 2016 Nov 14;10:155-157. eCollection 2016 Dec.
Target capture sequencing of exons and conserved non-coding sequences. Provided by: Dr. Mikita Suyama (Kyushu University) and Dr. Takashi Kuramoto (Kyoto University)
Publications:
Yoshihara M, etal., Genom Data. 2016 Nov 14;10:155-157. eCollection 2016 Dec.
Target capture sequencing of exons and conserved non-coding sequences. Provided by: Dr. Mikita Suyama (Kyushu University) and Dr. Takashi Kuramoto (Kyoto University)
Publications:
Yoshihara M, etal., Genom Data. 2016 Nov 14;10:155-157. eCollection 2016 Dec.
Target capture sequencing of exons and conserved non-coding sequences. Provided by: Dr. Mikita Suyama (Kyushu University) and Dr. Takashi Kuramoto (Kyoto University)
Publications:
Yoshihara M, etal., Genom Data. 2016 Nov 14;10:155-157. eCollection 2016 Dec.
Target capture sequencing of exons and conserved non-coding sequences. Provided by: Dr. Mikita Suyama (Kyushu University) and Dr. Takashi Kuramoto (Kyoto University)
Publications:
Yoshihara M, etal., Genom Data. 2016 Nov 14;10:155-157. eCollection 2016 Dec.
Target capture sequencing of exons and conserved non-coding sequences. Provided by: Dr. Mikita Suyama (Kyushu University) and Dr. Takashi Kuramoto (Kyoto University)
Publications:
Yoshihara M, etal., Genom Data. 2016 Nov 14;10:155-157. eCollection 2016 Dec.
Target capture sequencing of exons and conserved non-coding sequences. Provided by: Dr. Mikita Suyama (Kyushu University) and Dr. Takashi Kuramoto (Kyoto University)
Publications:
Yoshihara M, etal., Genom Data. 2016 Nov 14;10:155-157. eCollection 2016 Dec.
Target capture sequencing of exons and conserved non-coding sequences. Provided by: Dr. Mikita Suyama (Kyushu University) and Dr. Takashi Kuramoto (Kyoto University)
Publications:
Yoshihara M, etal., Genom Data. 2016 Nov 14;10:155-157. eCollection 2016 Dec.
Target capture sequencing of exons and conserved non-coding sequences. Provided by: Dr. Mikita Suyama (Kyushu University) and Dr. Takashi Kuramoto (Kyoto University)
Publications:
Yoshihara M, etal., Genom Data. 2016 Nov 14;10:155-157. eCollection 2016 Dec.
Target capture sequencing of exons and conserved non-coding sequences. Provided by: Dr. Mikita Suyama (Kyushu University) and Dr. Takashi Kuramoto (Kyoto University)
Publications:
Yoshihara M, etal., Genom Data. 2016 Nov 14;10:155-157. eCollection 2016 Dec.
Gene-Chemical Interaction Annotations
