Symbol:
Nsf
Name:
N-ethylmaleimide sensitive factor, vesicle fusing ATPase
RGD ID:
621594
Description:
Enables several functions, including ATP hydrolysis activity; enzyme binding activity; and signaling receptor binding activity. Involved in protein-containing complex disassembly; regulation of vesicle-mediated transport; and vesicle-mediated transport. Located in Golgi stack and dendritic shaft. Is active in GABA-ergic synapse and postsynaptic specialization, intracellular component. Biomarker of temporal lobe epilepsy. Human ortholog(s) of this gene implicated in developmental and epileptic encephalopathy 96. Orthologous to human NSF (N-ethylmaleimide sensitive factor, vesicle fusing ATPase); PARTICIPATES IN vasopressin signaling pathway via receptor type 2; INTERACTS WITH 2,2',5,5'-tetrachlorobiphenyl; 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dibromophenyl 2,4,5-tribromophenyl ether.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
N-ethylmaleimide sensitive factor; N-ethylmaleimide sensitive fusion protein; N-ethylmaleimide-sensitive factor; N-ethylmaleimide-sensitive fusion protein; NEM-sensitive fusion protein; vesicle-fusing ATPase; vesicular-fusion protein NSF
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
NSF (N-ethylmaleimide sensitive factor, vesicle fusing ATPase) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Nsf (N-ethylmaleimide sensitive fusion protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Nsf (N-ethylmaleimide sensitive factor, vesicle fusing ATPase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
NSF (N-ethylmaleimide sensitive factor, vesicle fusing ATPase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
NSF (N-ethylmaleimide sensitive factor, vesicle fusing ATPase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Nsf (N-ethylmaleimide sensitive factor, vesicle fusing ATPase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
NSF (N-ethylmaleimide sensitive factor, vesicle fusing ATPase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
NSF (N-ethylmaleimide sensitive factor, vesicle fusing ATPase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Nsf (N-ethylmaleimide sensitive factor, vesicle fusing ATPase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
NSF (N-ethylmaleimide sensitive factor, vesicle fusing ATPase)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Nsf (N-ethylmaleimide sensitive fusion protein)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
nsfb (N-ethylmaleimide-sensitive factor b)
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER)
Danio rerio (zebrafish):
nsfa (N-ethylmaleimide-sensitive factor a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG31495
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):
SEC18
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
nsf-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Nsf2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
comt
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
nsf
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 89,227,937 - 89,357,383 (-) NCBI GRCr8 mRatBN7.2 10 88,727,912 - 88,857,375 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 88,727,912 - 88,857,386 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 93,766,004 - 93,896,184 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 93,231,131 - 93,359,684 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 88,624,517 - 88,754,710 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 91,879,608 - 91,986,242 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 91,878,633 - 92,008,082 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 91,645,985 - 91,751,551 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 92,974,385 - 93,082,222 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 92,988,754 - 93,118,400 (-) NCBI Celera 10 87,428,233 - 87,533,296 (-) NCBI Celera Cytogenetic Map 10 q32.1 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Nsf Rat (-)-epigallocatechin 3-gallate multiple interactions ISO RGD:733160 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of NSF mRNA CTD PMID:22079256 Nsf Rat (S)-nicotine multiple interactions ISO RGD:733161 6480464 [Nicotine co-treated with 1-Methyl-4-phenyl-1,2,3,6-tetrahydropyridine] results in decreased expression of NSF mRNA; Nicotine inhibits the reaction more ... CTD PMID:20230807 Nsf Rat 1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene multiple interactions ISO RGD:733161 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Nsf Rat 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine increases expression ISO RGD:733161 6480464 1-Methyl-4-phenyl-1,2,3,6-tetrahydropyridine results in increased expression of NSF mRNA CTD PMID:20230807 Nsf Rat 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine decreases expression ISO RGD:733161 6480464 1-Methyl-4-phenyl-1,2,3,6-tetrahydropyridine results in decreased expression of NSF mRNA CTD PMID:15329391 Nsf Rat 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine multiple interactions ISO RGD:733161 6480464 [Caffeine co-treated with 1-Methyl-4-phenyl-1,2,3,6-tetrahydropyridine] results in increased expression of NSF mRNA; [Nicotine co-treated with 1-Methyl-4-phenyl-1,2,3,6-tetrahydropyridine] more ... CTD PMID:20230807 Nsf Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO RGD:733161 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Nsf Rat 2,2',5,5'-tetrachlorobiphenyl decreases expression EXP 6480464 2,5,2',5'-tetrachlorobiphenyl results in decreased expression of NSF mRNA CTD PMID:23829299 Nsf Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO RGD:733161 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Nsf Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of NSF protein CTD PMID:19492234 Nsf Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:733161 6480464 Tetrachlorodibenzodioxin affects the expression of NSF mRNA; Tetrachlorodibenzodioxin affects the expression of NSF protein CTD PMID:21570461|PMID:24680724|PMID:26377647 Nsf Rat 2,4,4'-trichlorobiphenyl multiple interactions ISO RGD:733161 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Nsf Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether decreases expression EXP 6480464 2,2',4,4',5-brominated diphenyl ether results in decreased expression of NSF protein CTD PMID:19954255 Nsf Rat 2,5-hexanedione decreases expression EXP 6480464 2,5-hexanedione results in decreased expression of NSF protein CTD PMID:19033394 Nsf Rat 2,6-dimethoxyphenol multiple interactions ISO RGD:733160 6480464 [Sodium Chloride co-treated with pyrogallol 1,3-dimethyl ether] results in decreased expression of and affects the more ... CTD PMID:38598786 Nsf Rat 2-hydroxypropanoic acid decreases expression ISO RGD:733160 6480464 Lactic Acid results in decreased expression of NSF mRNA CTD PMID:30851411 Nsf Rat 2-methylcholine affects expression ISO RGD:733160 6480464 beta-methylcholine affects the expression of NSF mRNA CTD PMID:21179406 Nsf Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:733161 6480464 bisphenol S results in increased expression of NSF mRNA CTD PMID:39298647 Nsf Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:733160 6480464 bisphenol S results in increased expression of NSF protein CTD PMID:34186270 Nsf Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of NSF mRNA CTD PMID:30047161 Nsf Rat acrylamide multiple interactions ISO RGD:733161 6480464 Acrylamide binds to and affects the metabolism of NSF protein CTD PMID:17698512 Nsf Rat acrylamide increases expression ISO RGD:733161 6480464 Acrylamide results in increased expression of NSF mRNA CTD PMID:30807115 Nsf Rat aflatoxin B1 decreases methylation ISO RGD:733160 6480464 Aflatoxin B1 results in decreased methylation of NSF gene CTD PMID:27153756 Nsf Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of NSF mRNA CTD PMID:16483693 Nsf Rat antirheumatic drug decreases expression ISO RGD:733160 6480464 Antirheumatic Agents results in decreased expression of NSF mRNA CTD PMID:24449571 Nsf Rat aristolochic acid A increases expression ISO RGD:733160 6480464 aristolochic acid I results in increased expression of NSF protein CTD PMID:33212167 Nsf Rat arsenite(3-) multiple interactions ISO RGD:733160 6480464 arsenite inhibits the reaction [G3BP1 protein binds to NSF mRNA] CTD PMID:32406909 Nsf Rat benzatropine decreases expression ISO RGD:733160 6480464 Benztropine results in decreased expression of NSF protein CTD PMID:34122009 Nsf Rat benzo[a]pyrene multiple interactions ISO RGD:733161 6480464 Benzo(a)pyrene promotes the reaction [AHR protein binds to NSF promoter] CTD PMID:19654925 Nsf Rat beta-lapachone decreases expression ISO RGD:733160 6480464 beta-lapachone results in decreased expression of NSF mRNA CTD PMID:38218311 Nsf Rat beta-lapachone increases expression ISO RGD:733160 6480464 beta-lapachone results in increased expression of NSF mRNA CTD PMID:38218311 Nsf Rat bis(2-ethylhexyl) phthalate multiple interactions EXP 6480464 [Genistein co-treated with Diethylhexyl Phthalate] results in increased expression of NSF mRNA CTD PMID:36674726 Nsf Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of NSF mRNA CTD PMID:25181051|PMID:30816183 Nsf Rat bisphenol AF increases expression ISO RGD:733160 6480464 bisphenol AF results in increased expression of NSF protein CTD PMID:34186270 Nsf Rat Bisphenol B increases expression ISO RGD:733160 6480464 bisphenol B results in increased expression of NSF protein CTD PMID:34186270 Nsf Rat bisphenol F increases expression ISO RGD:733161 6480464 bisphenol F results in increased expression of NSF mRNA CTD PMID:38685157 Nsf Rat Brodifacoum increases expression EXP 6480464 bromfenacoum results in increased expression of NSF protein CTD PMID:28903499 Nsf Rat butanal decreases expression ISO RGD:733160 6480464 butyraldehyde results in decreased expression of NSF mRNA CTD PMID:26079696 Nsf Rat caffeine multiple interactions ISO RGD:733161 6480464 [Caffeine co-treated with 1-Methyl-4-phenyl-1,2,3,6-tetrahydropyridine] results in increased expression of NSF mRNA; Caffeine promotes the reaction more ... CTD PMID:20230807 Nsf Rat calcidiol decreases expression EXP 6480464 Calcifediol deficiency results in decreased expression of NSF mRNA CTD PMID:17293106 Nsf Rat carbon nanotube increases expression ISO RGD:733161 6480464 Nanotubes, Carbon results in increased expression of NSF mRNA CTD PMID:25554681 Nsf Rat carbonyl sulfide increases expression EXP 6480464 carbonyl sulfide results in increased expression of NSF mRNA CTD PMID:19395590 Nsf Rat CGP 52608 multiple interactions ISO RGD:733160 6480464 CGP 52608 promotes the reaction [RORA protein binds to NSF gene] CTD PMID:28238834 Nsf Rat chlordecone decreases expression ISO RGD:733161 6480464 Chlordecone results in decreased expression of NSF mRNA CTD PMID:29980752 Nsf Rat chlorpyrifos decreases expression ISO RGD:733161 6480464 Chlorpyrifos results in decreased expression of NSF mRNA CTD PMID:29156651 Nsf Rat chlorpyrifos increases expression ISO RGD:733161 6480464 Chlorpyrifos results in increased expression of NSF mRNA CTD PMID:37019170 Nsf Rat clozapine decreases expression ISO RGD:733160 6480464 Clozapine results in decreased expression of NSF protein CTD PMID:34122009 Nsf Rat cocaine decreases expression ISO RGD:733160 6480464 Cocaine results in decreased expression of NSF mRNA CTD PMID:12629581 Nsf Rat copper(II) sulfate decreases expression ISO RGD:733160 6480464 Copper Sulfate results in decreased expression of NSF mRNA CTD PMID:19549813 Nsf Rat cyclosporin A increases expression ISO RGD:733160 6480464 Cyclosporine results in increased expression of NSF mRNA CTD PMID:21163907 Nsf Rat cyclosporin A decreases expression ISO RGD:733160 6480464 Cyclosporine results in decreased expression of NSF mRNA CTD PMID:20106945|PMID:25562108 Nsf Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of NSF mRNA CTD PMID:21266533 Nsf Rat dimethylarsinous acid decreases expression ISO RGD:733160 6480464 dimethylarsinous acid results in decreased expression of NSF mRNA CTD PMID:16507463 Nsf Rat dizocilpine maleate increases expression EXP 6480464 Dizocilpine Maleate results in increased expression of NSF protein CTD PMID:21297352 Nsf Rat epoxiconazole decreases expression ISO RGD:733161 6480464 epoxiconazole results in decreased expression of NSF mRNA CTD PMID:35436446 Nsf Rat ethanol multiple interactions ISO RGD:733161 6480464 Ethanol affects the expression of and affects the splicing of NSF mRNA CTD PMID:30319688 Nsf Rat flavonoids increases expression EXP 6480464 Flavonoids results in increased expression of NSF mRNA CTD PMID:18035473 Nsf Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of NSF mRNA CTD PMID:24136188 Nsf Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of NSF mRNA CTD PMID:24793618 Nsf Rat folic acid decreases expression ISO RGD:733161 6480464 Folic Acid results in decreased expression of NSF mRNA CTD PMID:25629700 Nsf Rat FR900359 increases phosphorylation ISO RGD:733160 6480464 FR900359 results in increased phosphorylation of NSF protein CTD PMID:37730182 Nsf Rat furfural multiple interactions ISO RGD:733160 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of NSF protein; [Sodium Chloride co-treated more ... CTD PMID:38598786 Nsf Rat gamma-aminobutyric acid decreases expression EXP 6480464 gamma-Aminobutyric Acid results in decreased expression of NSF mRNA CTD PMID:26924987 Nsf Rat gamma-tocopherol increases expression ISO RGD:733161 6480464 Tocopherols results in increased expression of NSF mRNA CTD PMID:17654050 Nsf Rat genistein multiple interactions EXP 6480464 [Genistein co-treated with Diethylhexyl Phthalate] results in increased expression of NSF mRNA CTD PMID:36674726 Nsf Rat haloperidol decreases expression EXP 6480464 Haloperidol results in decreased expression of NSF mRNA CTD PMID:15860345 Nsf Rat haloperidol decreases expression ISO RGD:733160 6480464 Haloperidol results in decreased expression of NSF protein CTD PMID:34122009 Nsf Rat irinotecan decreases expression ISO RGD:733160 6480464 Irinotecan analog results in decreased expression of NSF mRNA CTD PMID:18927307 Nsf Rat ivermectin decreases expression ISO RGD:733160 6480464 Ivermectin results in decreased expression of NSF protein CTD PMID:32959892 Nsf Rat ketamine increases expression EXP 6480464 Ketamine results in increased expression of NSF mRNA CTD PMID:20080153 Nsf Rat manganese(II) chloride increases methylation ISO RGD:733160 6480464 manganese chloride results in increased methylation of NSF gene CTD PMID:27913844 Nsf Rat manganese(II) chloride decreases expression ISO RGD:733160 6480464 manganese chloride results in decreased expression of NSF mRNA CTD PMID:27913844 Nsf Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of NSF mRNA CTD PMID:30047161 Nsf Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of NSF gene CTD PMID:35440735 Nsf Rat N(4)-hydroxycytidine decreases expression ISO RGD:733161 6480464 N(4)-hydroxycytidine results in decreased expression of NSF mRNA CTD PMID:37748715 Nsf Rat N,N-diethyl-m-toluamide multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in decreased methylation of NSF gene CTD PMID:33148267 Nsf Rat N-methyl-4-phenylpyridinium increases expression ISO RGD:733161 6480464 1-Methyl-4-phenylpyridinium results in increased expression of NSF protein CTD PMID:26558463 Nsf Rat N-nitrosodiethylamine increases expression EXP 6480464 Diethylnitrosamine results in increased expression of NSF mRNA CTD PMID:19041683 Nsf Rat nickel atom decreases expression ISO RGD:733160 6480464 Nickel results in decreased expression of NSF mRNA CTD PMID:23195993 Nsf Rat nicotine multiple interactions ISO RGD:733161 6480464 [Nicotine co-treated with 1-Methyl-4-phenyl-1,2,3,6-tetrahydropyridine] results in decreased expression of NSF mRNA; Nicotine inhibits the reaction more ... CTD PMID:20230807 Nsf Rat nitrates multiple interactions ISO RGD:733161 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of NSF more ... CTD PMID:35964746 Nsf Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of NSF mRNA CTD PMID:25729387 Nsf Rat oxidopamine decreases expression EXP 6480464 Oxidopamine results in decreased expression of NSF mRNA CTD PMID:25129099 Nsf Rat oxidopamine multiple interactions EXP 6480464 isoquercitrin inhibits the reaction [Oxidopamine results in decreased expression of NSF mRNA]; Levodopa inhibits the more ... CTD PMID:25129099 Nsf Rat paracetamol increases expression ISO RGD:733160 6480464 Acetaminophen results in increased expression of NSF mRNA CTD PMID:22230336 Nsf Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of NSF mRNA CTD PMID:33387578 Nsf Rat PCB138 increases expression EXP 6480464 2,2',3',4,4',5-hexachlorobiphenyl results in increased expression of NSF mRNA CTD PMID:23829299 Nsf Rat PCB138 multiple interactions ISO RGD:733161 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Nsf Rat permethrin multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in decreased methylation of NSF gene CTD PMID:33148267 Nsf Rat phenobarbital increases expression EXP 6480464 Phenobarbital results in increased expression of NSF mRNA CTD PMID:30047161 Nsf Rat potassium chromate decreases expression ISO RGD:733160 6480464 potassium chromate(VI) results in decreased expression of NSF mRNA CTD PMID:22079256 Nsf Rat potassium chromate multiple interactions ISO RGD:733160 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of NSF mRNA CTD PMID:22079256 Nsf Rat Propiverine affects binding EXP 6480464 propiverine binds to NSF protein CTD PMID:29273565 Nsf Rat quercetin 3-O-beta-D-glucofuranoside multiple interactions EXP 6480464 isoquercitrin inhibits the reaction [Oxidopamine results in decreased expression of NSF mRNA] CTD PMID:25129099 Nsf Rat quercetin 3-O-beta-D-glucopyranoside multiple interactions EXP 6480464 isoquercitrin inhibits the reaction [Oxidopamine results in decreased expression of NSF mRNA] CTD PMID:25129099 Nsf Rat rac-lactic acid decreases expression ISO RGD:733160 6480464 Lactic Acid results in decreased expression of NSF mRNA CTD PMID:30851411 Nsf Rat rutin multiple interactions EXP 6480464 Rutin inhibits the reaction [Oxidopamine results in decreased expression of NSF mRNA] CTD PMID:25129099 Nsf Rat Salinomycin decreases expression ISO RGD:733160 6480464 salinomycin results in decreased expression of NSF mRNA CTD PMID:19682730 Nsf Rat SB 431542 multiple interactions ISO RGD:733160 6480464 [LDN 193189 co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in increased expression of NSF more ... CTD PMID:37664457 Nsf Rat sodium chloride multiple interactions ISO RGD:733160 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of NSF protein; [Sodium Chloride co-treated more ... CTD PMID:38598786 Nsf Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of NSF mRNA CTD PMID:30047161 Nsf Rat testosterone decreases expression ISO RGD:733160 6480464 Testosterone results in decreased expression of NSF mRNA CTD PMID:33359661 Nsf Rat thapsigargin increases expression EXP 6480464 Thapsigargin results in increased expression of NSF protein CTD PMID:35544339 Nsf Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of NSF mRNA CTD PMID:23411599 Nsf Rat tocopherol increases expression ISO RGD:733161 6480464 Tocopherols results in increased expression of NSF mRNA CTD PMID:17654050 Nsf Rat toluene affects expression EXP 6480464 Toluene affects the expression of NSF mRNA CTD PMID:21827849 Nsf Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of NSF mRNA CTD PMID:25729387 Nsf Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of NSF mRNA CTD PMID:33387578 Nsf Rat trimellitic anhydride increases expression ISO RGD:733161 6480464 trimellitic anhydride results in increased expression of NSF mRNA CTD PMID:19042947 Nsf Rat valproic acid affects expression ISO RGD:733160 6480464 Valproic Acid affects the expression of NSF mRNA CTD PMID:25979313 Nsf Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of NSF mRNA CTD PMID:19015723 Nsf Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of NSF mRNA CTD PMID:23034163
Molecular Function
Only show annotations with direct experimental evidence (0 objects hidden)
Nsf Rat ATP binding enables IEA UniProtKB-KW:KW-0067 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Nsf Rat ATP binding enables IEA InterPro:IPR003959|InterPro:IPR003960 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Nsf Rat ATP binding enables IEA UniRule:UR001350760 1600115 GO_REF:0000104 UniProt GO_REF:0000104 Nsf Rat ATP hydrolysis activity IDA 633463 RGD Nsf Rat ATP hydrolysis activity enables ISO RGD:733161 1624291 PMID:12832401 RGD PMID:12832401 Nsf Rat ATP hydrolysis activity enables IBA MGI:104560|PANTHER:PTN000554891|RGD:621594|SGD:S000000284|TAIR:locus:2135378 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Nsf Rat ATP hydrolysis activity enables IEA InterPro:IPR003593|InterPro:IPR003959|InterPro:IPR003960|InterPro:IPR039812 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Nsf Rat ATP hydrolysis activity enables IEA UniProtKB:P46460|ensembl:ENSMUSP00000099364 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Nsf Rat ATP hydrolysis activity enables IDA 633462 PMID:11931741 UniProt Nsf Rat ATP hydrolysis activity enables IEA RHEA:13065 1600115 GO_REF:0000116 RHEA GO_REF:0000116 Nsf Rat ATP-dependent protein binding IPI RGD:3528|RGD:3529|RGD:619737 633463 RGD Nsf Rat ATP-dependent protein disaggregase activity enables ISS UniProtKB:P18708 1600115 GO_REF:0000024 ParkinsonsUK-UCL GO_REF:0000024 Nsf Rat D1 dopamine receptor binding IPI RGD:2518 7248619 RGD Nsf Rat hydrolase activity enables IEA UniProtKB-KW:KW-0378 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Nsf Rat ionotropic glutamate receptor binding enables IEA UniProtKB:P46459|ensembl:ENSP00000381293 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Nsf Rat ionotropic glutamate receptor binding enables ISO RGD:733160 1624291 UniProtKB:P42262 PMID:12130635 RGD PMID:12130635 Nsf Rat ionotropic glutamate receptor binding IPI RGD:61862 152995511 RGD Nsf Rat ionotropic glutamate receptor binding enables IPI UniProtKB:P19491 11558005 PMID:12130635 ParkinsonsUK-UCL Nsf Rat metal ion binding enables IEA UniRule:UR001350760 1600115 GO_REF:0000104 UniProt GO_REF:0000104 Nsf Rat metal ion binding enables IEA UniProtKB-KW:KW-0479 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Nsf Rat nucleotide binding enables IEA UniProtKB-KW:KW-0547 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Nsf Rat PDZ domain binding enables IEA UniProtKB:P46459|ensembl:ENSP00000381293 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Nsf Rat PDZ domain binding enables ISO RGD:733160 1624291 UniProtKB:O60896 PMID:15613468 RGD PMID:15613468 Nsf Rat protein binding IPI RGD:619737 633463 RGD Nsf Rat protein binding enables ISO RGD:733161 1624291 UniProtKB:O35239|UniProtKB:Q5S006|UniProtKB:Q61006-3|UniProtKB:Q62108 PMID:15322554, PMID:18272689, PMID:19455133, PMID:21307259, PMID:24687852, PMID:28671696 RGD PMID:15322554|PMID:18272689|PMID:19455133|PMID:21307259|PMID:24687852|PMID:28671696 Nsf Rat protein binding enables IPI UniProtKB:P19491 633462 PMID:11931741 UniProt Nsf Rat protein binding enables IPI UniProtKB:P19492 8553822 PMID:9697854 UniProt Nsf Rat protein binding enables IPI UniProtKB:P19491 8553822 PMID:9697854 UniProt Nsf Rat protein binding enables ISO RGD:733160 1624291 UniProtKB:O75899|UniProtKB:P42262|UniProtKB:P43378|UniProtKB:P54920|UniProtKB:P55160|UniProtKB:Q6FHY5|UniProtKB:Q9H477|UniProtKB:Q9UBS5 PMID:15322554, PMID:16417406, PMID:16724110, PMID:20562859, PMID:28514442, PMID:30833792, PMID:32296183, PMID:33961781, PMID:35271311 RGD PMID:15322554|PMID:16417406|PMID:16724110|PMID:20562859|PMID:28514442|PMID:30833792|PMID:32296183|PMID:33961781|PMID:35271311 Nsf Rat protein kinase binding enables IEA UniProtKB:P46460|ensembl:ENSMUSP00000099364 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Nsf Rat protein kinase binding enables ISO RGD:733161 1624291 UniProtKB:Q5S007 PMID:21307259 RGD PMID:21307259 Nsf Rat protein serine/threonine kinase binding IPI RGD:620760 152995511 RGD Nsf Rat protein-containing complex binding enables IEA UniProtKB:P46459|ensembl:ENSP00000381293 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Nsf Rat protein-containing complex binding enables ISO RGD:733160 1624291 PMID:15613468 RGD PMID:15613468 Nsf Rat protein-containing complex binding enables IDA 633462 PMID:11931741 UniProt Nsf Rat protein-containing complex binding enables ISS UniProtKB:P18708 1600115 GO_REF:0000024 ParkinsonsUK-UCL GO_REF:0000024 Nsf Rat small GTPase binding IPI RGD:3529 633463 RGD Nsf Rat SNARE binding enables ISS UniProtKB:P18708 1600115 GO_REF:0000024 ParkinsonsUK-UCL GO_REF:0000024 Nsf Rat syntaxin binding enables IEA UniProtKB:P46460|ensembl:ENSMUSP00000099364 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Nsf Rat syntaxin binding enables ISO RGD:733161 1624291 PMID:14755058 RGD PMID:14755058 Nsf Rat syntaxin-1 binding enables ISO RGD:733161 1624291 PMID:21307259 RGD PMID:21307259 Nsf Rat syntaxin-1 binding enables IEA UniProtKB:P46460|ensembl:ENSMUSP00000099364 1600115 GO_REF:0000107 Ensembl GO_REF:0000107
Imported Annotations - KEGG (archival)
(-)-epigallocatechin 3-gallate (ISO) (S)-nicotine (ISO) 1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO) 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',5,5'-tetrachlorobiphenyl (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,4'-trichlorobiphenyl (ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (EXP) 2,5-hexanedione (EXP) 2,6-dimethoxyphenol (ISO) 2-hydroxypropanoic acid (ISO) 2-methylcholine (ISO) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) acrylamide (ISO) aflatoxin B1 (ISO) ammonium chloride (EXP) antirheumatic drug (ISO) aristolochic acid A (ISO) arsenite(3-) (ISO) benzatropine (ISO) benzo[a]pyrene (ISO) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (EXP) bisphenol A (EXP) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) Brodifacoum (EXP) butanal (ISO) caffeine (ISO) calcidiol (EXP) carbon nanotube (ISO) carbonyl sulfide (EXP) CGP 52608 (ISO) chlordecone (ISO) chlorpyrifos (ISO) clozapine (ISO) cocaine (ISO) copper(II) sulfate (ISO) cyclosporin A (ISO) dibutyl phthalate (EXP) dimethylarsinous acid (ISO) dizocilpine maleate (EXP) epoxiconazole (ISO) ethanol (ISO) flavonoids (EXP) flutamide (EXP) folic acid (ISO) FR900359 (ISO) furfural (ISO) gamma-aminobutyric acid (EXP) gamma-tocopherol (ISO) genistein (EXP) haloperidol (EXP,ISO) irinotecan (ISO) ivermectin (ISO) ketamine (EXP) manganese(II) chloride (ISO) methimazole (EXP) methoxychlor (EXP) N(4)-hydroxycytidine (ISO) N,N-diethyl-m-toluamide (EXP) N-methyl-4-phenylpyridinium (ISO) N-nitrosodiethylamine (EXP) nickel atom (ISO) nicotine (ISO) nitrates (ISO) oxaliplatin (EXP) oxidopamine (EXP) paracetamol (EXP,ISO) PCB138 (EXP,ISO) permethrin (EXP) phenobarbital (EXP) potassium chromate (ISO) Propiverine (EXP) quercetin 3-O-beta-D-glucofuranoside (EXP) quercetin 3-O-beta-D-glucopyranoside (EXP) rac-lactic acid (ISO) rutin (EXP) Salinomycin (ISO) SB 431542 (ISO) sodium chloride (ISO) sulfadimethoxine (EXP) testosterone (ISO) thapsigargin (EXP) thioacetamide (EXP) tocopherol (ISO) toluene (EXP) topotecan (EXP) trichloroethene (EXP) trimellitic anhydride (ISO) valproic acid (ISO) vinclozolin (EXP)
Molecular Function
ATP binding (IEA) ATP hydrolysis activity (IBA,IDA,IEA,ISO) ATP-dependent protein binding (IPI) ATP-dependent protein disaggregase activity (ISS) D1 dopamine receptor binding (IPI) hydrolase activity (IEA) ionotropic glutamate receptor binding (IEA,IPI,ISO) metal ion binding (IEA) nucleotide binding (IEA) PDZ domain binding (IEA,ISO) protein binding (IPI,ISO) protein kinase binding (IEA,ISO) protein serine/threonine kinase binding (IPI) protein-containing complex binding (IDA,IEA,ISO,ISS) small GTPase binding (IPI) SNARE binding (ISS) syntaxin binding (IEA,ISO) syntaxin-1 binding (IEA,ISO)
1.
Role of SNAP-23 in trafficking of H+-ATPase in cultured inner medullary collecting duct cells.
Banerjee A, etal., Am J Physiol Cell Physiol. 2001 Apr;280(4):C775-81.
2.
mGluR and NMDAR activation internalize distinct populations of AMPARs.
Casimiro TM, etal., Mol Cell Neurosci. 2011 Oct;48(2):161-70. doi: 10.1016/j.mcn.2011.07.007. Epub 2011 Jul 23.
3.
Interaction of dopamine D1 receptor with N-ethylmaleimide-sensitive factor is important for the membrane localization of the receptor.
Chen S and Liu F, J Neurosci Res. 2010 Aug 15;88(11):2504-12. doi: 10.1002/jnr.22401.
4.
Plk2 attachment to NSF induces homeostatic removal of GluA2 during chronic overexcitation.
Evers DM, etal., Nat Neurosci. 2010 Oct;13(10):1199-207. doi: 10.1038/nn.2624. Epub 2010 Aug 29.
5.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.
Identification of Rab6 as an N-ethylmaleimide-sensitive fusion protein-binding protein.
Han SY, etal., Biochem J 2000 Nov 15;352 Pt 1:165-73.
7.
NSF ATPase and alpha-/beta-SNAPs disassemble the AMPA receptor-PICK1 complex.
Hanley JG, etal., Neuron 2002 Mar 28;34(1):53-67.
8.
Roles that nurses in the community can play in nursing research.
Johnson MN and Okunade AO, Int Nurs Rev. 1975 Sep-Oct;22(5):147-9.
9.
The subcellular distribution of GABARAP and its ability to interact with NSF suggest a role for this protein in the intracellular transport of GABA(A) receptors.
Kittler JT, etal., Mol Cell Neurosci. 2001 Jul;18(1):13-25. doi: 10.1006/mcne.2001.1005.
10.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
11.
Brain-derived neurotrophic factor regulates surface expression of alpha-amino-3-hydroxy-5-methyl-4-isoxazoleproprionic acid receptors by enhancing the N-ethylmaleimide-sensitive factor/GluR2 interaction in developing neocortical neurons.
Narisawa-Saito M, etal., J Biol Chem. 2002 Oct 25;277(43):40901-10. Epub 2002 Jul 18.
12.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
13.
NSF binding to GluR2 regulates synaptic transmission.
Nishimune A, etal., Neuron. 1998 Jul;21(1):87-97.
14.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
15.
GOA pipeline
RGD automated data pipeline
16.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
17.
Kainate-induced seizures alter protein composition and N-methyl-D-aspartate receptor function of rat forebrain postsynaptic densities.
Wyneken U, etal., Neuroscience. 2001;102(1):65-74.
Nsf Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 89,227,937 - 89,357,383 (-) NCBI GRCr8 mRatBN7.2 10 88,727,912 - 88,857,375 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 88,727,912 - 88,857,386 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 93,766,004 - 93,896,184 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 93,231,131 - 93,359,684 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 88,624,517 - 88,754,710 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 91,879,608 - 91,986,242 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 91,878,633 - 92,008,082 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 91,645,985 - 91,751,551 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 92,974,385 - 93,082,222 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 92,988,754 - 93,118,400 (-) NCBI Celera 10 87,428,233 - 87,533,296 (-) NCBI Celera Cytogenetic Map 10 q32.1 NCBI
NSF Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 17 46,590,669 - 46,757,464 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 17 46,590,669 - 46,757,679 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 17 44,668,035 - 44,834,830 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 17 42,023,354 - 42,190,000 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 17 42,023,397 - 42,189,993 NCBI Celera 17 41,231,619 - 41,284,321 (+) NCBI Celera Cytogenetic Map 17 q21.31 NCBI HuRef 17 40,092,157 - 40,095,514 (+) NCBI HuRef HuRef 17 40,144,350 - 40,213,196 (+) NCBI HuRef CHM1_1 17 44,732,424 - 44,898,954 (+) NCBI CHM1_1 T2T-CHM13v2.0 17 47,452,259 - 47,618,933 (+) NCBI T2T-CHM13v2.0
Nsf Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 103,712,608 - 103,844,882 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 103,712,608 - 103,844,882 (-) Ensembl GRCm39 Ensembl GRCm38 11 103,821,782 - 103,954,056 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 103,821,782 - 103,954,056 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 103,683,096 - 103,815,370 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 103,637,872 - 103,770,146 (-) NCBI MGSCv36 mm8 Celera 11 115,536,808 - 115,669,815 (-) NCBI Celera Cytogenetic Map 11 E1 NCBI cM Map 11 67.54 NCBI
Nsf Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955478 10,610,619 - 10,732,656 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955478 10,610,715 - 10,732,656 (+) NCBI ChiLan1.0 ChiLan1.0
NSF Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 19 18,259,662 - 18,426,098 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 17 20,225,947 - 20,392,295 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 17 10,746,423 - 10,912,784 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 17 10,923,875 - 11,056,565 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 17 10,923,875 - 11,057,426 (-) Ensembl panpan1.1 panPan2
NSF Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 9 9,927,149 - 10,072,656 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 9 9,927,068 - 10,071,272 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 9 10,225,793 - 10,371,295 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 9 11,518,063 - 11,663,166 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 9 11,517,317 - 11,663,164 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 9 10,528,956 - 10,674,213 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 9 16,847,857 - 16,992,907 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 9 16,795,635 - 16,941,205 (-) NCBI UU_Cfam_GSD_1.0
Nsf Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405602 17,057,557 - 17,205,506 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936541 1,987,326 - 2,137,067 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936541 1,989,092 - 2,137,006 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
NSF Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 12 17,459,077 - 17,705,351 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 12 17,458,996 - 17,624,335 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 12 17,490,697 - 17,656,813 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
NSF Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 16 60,308,000 - 60,467,596 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 16 60,308,008 - 60,465,731 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666077 31,029,330 - 31,190,857 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Nsf
.
Predicted Target Of
Count of predictions: 135 Count of miRNA genes: 115 Interacting mature miRNAs: 128 Transcripts: ENSRNOT00000006361 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
1549846 Scl47 Serum cholesterol level QTL 47 3.6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 10 50574707 95574707 Rat 1298069 Bp168 Blood pressure QTL 168 5.5 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 10 26521957 98003205 Rat 61449 Ciaa2 CIA Autoantibody QTL 2 7.1 blood autoantibody amount (VT:0003725) calculated serum anti-type 2 collagen antibody titer (CMO:0001279) 10 63221094 107211142 Rat 631555 Bp134 Blood pressure QTL 134 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 80515287 91230079 Rat 61325 Aia5 Adjuvant induced arthritis QTL 5 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1298078 Stresp5 Stress response QTL 5 2.99 0.00025 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 42045676 104670812 Rat 1549831 Bss6 Bone structure and strength QTL 6 4 lumbar vertebra strength trait (VT:0010574) vertebra ultimate force (CMO:0001678) 10 57576521 102576521 Rat 70164 Bw21 Body weight QTL 21 4.36 0.00005 body mass (VT:0001259) body weight (CMO:0000012) 10 53797494 98952626 Rat 4889948 Bss91 Bone structure and strength QTL 91 4 tibia area (VT:1000281) tibia midshaft total cross-sectional area (CMO:0001715) 10 82564856 92369470 Rat 2298548 Neuinf7 Neuroinflammation QTL 7 3.4 nervous system integrity trait (VT:0010566) spinal cord RT1-B protein level (CMO:0002132) 10 72224939 107211142 Rat 1579919 Bp281 Blood pressure QTL 281 0.01 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 74372084 94965338 Rat 1302404 Cia27 Collagen induced arthritis QTL 27 2.6 0.0045 joint integrity trait (VT:0010548) experimental arthritis severity measurement (CMO:0001459) 10 76452683 107211142 Rat 1300107 Rf18 Renal function QTL 18 3.41 urine output (VT:0003620) timed urine volume (CMO:0000260) 10 78775516 98279596 Rat 8694173 Bw149 Body weight QTL 149 4.38 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 10 44441699 89441699 Rat 2300218 Hpcl2 Hepatic cholesterol level QTL 2 liver cholesterol amount (VT:0010498) liver cholesterol level (CMO:0001597) 10 45029650 95600334 Rat 2317754 Glom25 Glomerulus QTL 25 3.5 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 10 82685200 107211142 Rat 1554317 Bmd4 Bone mineral density QTL 4 9.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 19816042 99406971 Rat 70171 Cari1 Carrageenan-induced inflammation QTL 1 4.9 0.0005 hypodermis integrity trait (VT:0010550) inflammatory exudate volume (CMO:0001429) 10 53797385 107211142 Rat 10450495 Bp383 Blood pressure QTL 383 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 76246085 94965338 Rat 2313856 Bp342 Blood pressure QTL 342 4.4 0.0001 life span trait (VT:0005372) age at time of death (CMO:0001193) 10 87307617 96121100 Rat 61354 Pia10 Pristane induced arthritis QTL 10 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2292617 Ept18 Estrogen-induced pituitary tumorigenesis QTL 18 3.9 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 10 73453136 96120911 Rat 2301967 Cm73 Cardiac mass QTL 73 4.55 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 10 14487011 89062041 Rat 2313103 Bss80 Bone structure and strength QTL 80 2 0.0001 tibia strength trait (VT:1000284) tibia midshaft endosteal cross-sectional area (CMO:0001716) 10 62057807 107057807 Rat 2293646 Bss25 Bone structure and strength QTL 25 10.96 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 10 69738412 107211142 Rat 2303118 Mamtr7 Mammary tumor resistance QTL 7 0.003 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 9658275 104670812 Rat 2300172 Bmd57 Bone mineral density QTL 57 9.8 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 10 69738412 107211142 Rat 70193 Mcs7 Mammary carcinoma susceptibility QTL 7 2.38 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 10 72224939 107211142 Rat 2313105 Bss79 Bone structure and strength QTL 79 1.8 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 10 62057807 107057807 Rat 61363 Oia3 Oil induced arthritis QTL 3 0.001 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 87307617 107211142 Rat 9589030 Epfw9 Epididymal fat weight QTL 9 19.24 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 10 44441699 89441699 Rat 1357344 Bp249 Blood pressure QTL 249 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 66743655 98003205 Rat 2316949 Gluco60 Glucose level QTL 60 3.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 14487011 107057807 Rat 2306970 Anxrr22 Anxiety related response QTL 22 5.95 fear/anxiety-related behavior trait (VT:1000241) number of periods of voluntary immobility (CMO:0001045) 10 61345276 98211570 Rat 1359017 Hrtrt21 Heart rate QTL 21 2.4 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 10 51772940 96772940 Rat 2293663 Bss33 Bone structure and strength QTL 33 9.34 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 10 69738412 107211142 Rat 7387312 Bw125 Body weight QTL 125 3 0.0047 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight (CMO:0000356) 10 64890616 107211142 Rat 2312672 Insul15 Insulin level QTL 15 0.01 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 10 57134272 102134272 Rat 6893357 Bw102 Body weight QTL 102 0.5 0.36 body mass (VT:0001259) body weight (CMO:0000012) 10 80515287 101325465 Rat 2317029 Aia19 Adjuvant induced arthritis QTL 19 2.98 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 10 66978955 107211142 Rat 2303589 Bw87 Body weight QTL 87 2 body mass (VT:0001259) body weight (CMO:0000012) 10 81285008 107211142 Rat 724556 Pur2 Proteinuria QTL 2 5.5 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 10 22427500 90627625 Rat 2306793 Ean5 Experimental allergic neuritis QTL 5 4.7 nervous system integrity trait (VT:0010566) IFNG-secreting splenocyte count (CMO:0002122) 10 72552416 93995749 Rat 61387 Bp1 Blood pressure QTL 1 5.1 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 10 51770177 107211142 Rat 2306792 Ean4 Experimental allergic neuritis QTL 4 4 nervous system integrity trait (VT:0010566) IFNG-secreting splenocyte count (CMO:0002122) 10 84022321 93995963 Rat 2317039 Aia6 Adjuvant induced arthritis QTL 6 4.31 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 10 66978955 107211142 Rat 61396 Bp9 Blood pressure QTL 9 4.8 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 68420376 107211142 Rat 634320 Niddm49 Non-insulin dependent diabetes mellitus QTL 49 4.41 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 10 88539139 107211142 Rat 1331791 Cm31 Cardiac mass QTL 31 3.84606 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 29299504 107211142 Rat 70364 Bp72 Blood pressure QTL 72 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 51121100 96121100 Rat 10450498 Bp384 Blood pressure QTL 384 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 67750049 107211142 Rat 4889492 Pancm2 Pancreatic morphology QTL 2 3.2 pancreatic beta cell morphology trait (VT:0005217) ratio of insulin-positive cell area to total area of splenic region of pancreas (CMO:0001814) 10 76748906 107211142 Rat 6893366 Bw106 Body weight QTL 106 0.3 0.47 body mass (VT:0001259) body weight (CMO:0000012) 10 70199100 107211142 Rat 2293698 Bss43 Bone structure and strength QTL 43 5.33 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 10 59209888 104209888 Rat 631530 Tls3 T-lymphoma susceptibility QTL 3 0 0.0001 thymus integrity trait (VT:0010555) percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911) 10 51774612 95600334 Rat 1354608 Cm33 Cardiac mass QTL 33 2.8 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 10 54809292 99809292 Rat 1558643 Cm44 Cardiac mass QTL 44 4.8 0.0000368 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 61345276 99703528 Rat 631535 Cm51 Cardiac mass QTL 51 3 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 10 51786282 91669536 Rat 631267 Cia20 Collagen induced arthritis QTL 20 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1576308 Schws1 Schwannoma susceptibility QTL 1 0.0041 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 10 40035094 102359817 Rat 631269 Cia22 Collagen induced arthritis QTL 22 8.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 631268 Cia21 Collagen induced arthritis QTL 21 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 14487011 104060283 Rat 631270 Cia23 Collagen induced arthritis QTL 23 3.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 7411614 Foco18 Food consumption QTL 18 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 10 44441699 89441699 Rat 6893336 Cm75 Cardiac mass QTL 75 0.1 0.87 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 10 61345276 99703528 Rat 631547 Bp87 Blood pressure QTL 87 4.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 47369470 92369470 Rat 61427 Cia16 Collagen induced arthritis QTL 16 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 6357896 96121100 Rat 12880055 Am11 Aortic mass QTL 11 0.004 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 10 84007272 95933025 Rat 2292438 Bp311 Blood pressure QTL 311 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 76246085 107211142 Rat 2312662 Slep8 Serum leptin concentration QTL 8 0.05 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 10 57134272 102134272 Rat 2301398 Kidm38 Kidney mass QTL 38 0.002 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 10 84007272 95933025 Rat 1600367 Mcs15 Mammary carcinoma susceptibility QTL 15 4.5 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 10 85565469 103884409 Rat 1358188 Ept9 Estrogen-induced pituitary tumorigenesis QTL 9 3.9 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 10 73453136 96120911 Rat 631538 Oia5 Oil induced arthritis QTL 5 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 87055121 107211142 Rat 1642980 Bp300 Blood pressure QTL 300 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 68383129 107211142 Rat 631542 Bp82 Blood pressure QTL 82 6.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 26521957 98952741 Rat 2312668 Scl65 Serum cholesterol level QTL 65 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 10 57134272 102134272 Rat
AW531537
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 88,814,326 - 88,814,446 (+) MAPPER mRatBN7.2 Rnor_6.0 10 91,965,052 - 91,965,171 NCBI Rnor6.0 Rnor_5.0 10 91,730,647 - 91,730,766 UniSTS Rnor5.0 RGSC_v3.4 10 93,061,076 - 93,061,195 UniSTS RGSC3.4 Celera 10 87,512,119 - 87,512,238 UniSTS RH 3.4 Map 10 917.0 UniSTS Cytogenetic Map 10 q32.1 UniSTS
RH134933
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 88,728,846 - 88,729,060 (+) MAPPER mRatBN7.2 Rnor_6.0 10 91,879,584 - 91,879,797 NCBI Rnor6.0 Rnor_5.0 10 91,645,961 - 91,646,174 UniSTS Rnor5.0 RGSC_v3.4 10 92,974,361 - 92,974,574 UniSTS RGSC3.4 Celera 10 87,428,209 - 87,428,422 UniSTS RH 3.4 Map 10 922.3 UniSTS Cytogenetic Map 10 q32.1 UniSTS
AU049932
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 88,827,568 - 88,827,774 (+) MAPPER mRatBN7.2 Rnor_6.0 10 91,978,293 - 91,978,496 NCBI Rnor6.0 Rnor_5.0 10 91,743,602 - 91,743,805 UniSTS Rnor5.0 RGSC_v3.4 10 93,074,273 - 93,074,476 UniSTS RGSC3.4 Celera 10 87,525,347 - 87,525,550 UniSTS Cytogenetic Map 10 q32.1 UniSTS
NSF-1
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 10 89,275,228 - 89,275,882 (+) Marker Load Pipeline mRatBN7.2 10 88,775,207 - 88,775,861 (+) MAPPER mRatBN7.2 Rnor_6.0 10 91,925,940 - 91,926,593 NCBI Rnor6.0 Rnor_5.0 10 91,692,223 - 91,692,876 UniSTS Rnor5.0 RGSC_v3.4 10 93,021,152 - 93,021,805 UniSTS RGSC3.4 Celera 10 87,474,297 - 87,474,950 UniSTS Cytogenetic Map 10 q32.1 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000006361 ⟹ ENSRNOP00000006361
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 88,727,912 - 88,857,386 (-) Ensembl Rnor_6.0 Ensembl 10 91,878,633 - 92,008,082 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000087824 ⟹ ENSRNOP00000073942
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 88,727,912 - 88,835,940 (-) Ensembl Rnor_6.0 Ensembl 10 91,880,120 - 91,986,632 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000099576 ⟹ ENSRNOP00000095949
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 88,727,912 - 88,835,912 (-) Ensembl
RefSeq Acc Id:
NM_021748 ⟹ NP_068516
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 89,227,937 - 89,357,383 (-) NCBI mRatBN7.2 10 88,727,912 - 88,857,375 (-) NCBI Rnor_6.0 10 91,879,608 - 91,986,242 (-) NCBI Rnor_5.0 10 91,645,985 - 91,751,551 (-) NCBI RGSC_v3.4 10 92,974,385 - 93,082,222 (-) RGD Celera 10 87,428,233 - 87,533,296 (-) RGD
Sequence:
GAAGATGGCGGGCCGGACTATGCAAGCTGCGAGATGCCCTACTGATGAATTGTCTCTAAGCAACTGTGCAGTTGTGAACGAAAAGGATTACCAGTCTGGCCAGCATGTGATGGTGAGGACGTCCCCCA
hide sequence
RefSeq Acc Id:
NP_068516 ⟸ NM_021748
- UniProtKB:
Q9QUL6 (UniProtKB/Swiss-Prot), F1LQ81 (UniProtKB/TrEMBL), A6HJT3 (UniProtKB/TrEMBL)
- Sequence:
MAGRTMQAARCPTDELSLSNCAVVNEKDYQSGQHVMVRTSPNHKYIFTLRTHPSVVPGCIAFSLPQRKWAGLSIGQDIEVALYSFDKAKQCIGTMTIEIDFLQKKNIDSNPYDTDKMAAEFIQQFNHQ
hide sequence
Ensembl Acc Id:
ENSRNOP00000006361 ⟸ ENSRNOT00000006361
Ensembl Acc Id:
ENSRNOP00000073942 ⟸ ENSRNOT00000087824
Ensembl Acc Id:
ENSRNOP00000095949 ⟸ ENSRNOT00000099576
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-07-07
Nsf
N-ethylmaleimide sensitive factor, vesicle fusing ATPase
Nsf
N-ethylmaleimide-sensitive factor
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-11-12
Nsf
N-ethylmaleimide-sensitive factor
Nsf
N-ethylmaleimide sensitive fusion protein
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-01-20
Nsf
N-ethylmaleimide sensitive fusion protein
N-ethylmaleimide sensitive factor
Name updated
1299863 APPROVED
2002-08-07
Nsf
N-ethylmaleimide sensitive factor
Symbol and Name status set to provisional
70820 PROVISIONAL
