Symbol:
Gabrb3
Name:
gamma-aminobutyric acid type A receptor subunit beta 3
RGD ID:
2651
Description:
Enables AP-2 adaptor complex binding activity; GABA-A receptor activity; and GABA-gated chloride ion channel activity. Involved in GABAergic synaptic transmission and response to auditory stimulus. Located in several cellular components, including inhibitory synapse; sperm head; and terminal bouton. Is active in GABA-ergic synapse and postsynaptic specialization membrane. Biomarker of fetal alcohol spectrum disorder and status epilepticus. Human ortholog(s) of this gene implicated in alcohol dependence; alcohol use disorder; childhood absence epilepsy; developmental and epileptic encephalopathy 43; and heroin dependence. Orthologous to human GABRB3 (gamma-aminobutyric acid type A receptor subunit beta3); INTERACTS WITH 1-[(4-chlorophenyl)-phenylmethyl]-4-methylpiperazine; 17alpha-ethynylestradiol; 2,2',4,4'-Tetrabromodiphenyl ether.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
GABA(A) receptor subunit beta-3; GABA-alpha receptor beta-3 subunit; GABAAR subunit beta-3; gamma-aminobutyric acid (GABA) A receptor, beta 3; gamma-aminobutyric acid (GABA-A) receptor, subunit beta 3; Gamma-aminobutyric acid receptor beta 3; gamma-aminobutyric acid receptor subunit beta-3; gamma-aminobutyric acid receptor, subunit beta 3; gamma-aminobutyric acid type A receptor beta 3 subunit; testis gamma-aminobutyric acid receptor subunit beta 3
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 117,602,772 - 117,838,230 (+) NCBI GRCr8 mRatBN7.2 1 108,467,047 - 108,702,522 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 108,296,124 - 108,698,961 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 113,838,572 - 114,068,957 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 122,311,079 - 122,541,470 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 115,559,397 - 115,789,792 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 113,034,251 - 113,265,364 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 112,976,770 - 113,265,364 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 114,042,551 - 114,275,043 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 109,047,399 - 109,277,756 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 109,125,741 - 109,356,099 (+) NCBI Celera 1 102,635,270 - 102,866,355 (+) NCBI Celera Cytogenetic Map 1 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Gabrb3 Rat (1->4)-beta-D-glucan multiple interactions ISO Gabrb3 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of GABRB3 mRNA CTD PMID:36331819 Gabrb3 Rat 1-[(4-chlorophenyl)-phenylmethyl]-4-methylpiperazine increases expression EXP 6480464 chlorcyclizine results in increased expression of GABRB3 mRNA CTD PMID:21058326 Gabrb3 Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of GABRB3 mRNA CTD PMID:29097150 Gabrb3 Rat 17beta-estradiol increases expression ISO GABRB3 (Homo sapiens) 6480464 Estradiol results in increased expression of GABRB3 mRNA CTD PMID:16000229 Gabrb3 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression EXP 6480464 2 more ... CTD PMID:21394737 Gabrb3 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Gabrb3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of GABRB3 mRNA CTD PMID:21570461 and PMID:26377647 Gabrb3 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of GABRB3 mRNA CTD PMID:32109520 Gabrb3 Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:32109520 Gabrb3 Rat 3,3-bis(trifluoromethyl)bicyclo[2.2.1]heptane-2,2-dicarbonitrile affects binding ISO GABRB3 (Homo sapiens) 6480464 3 more ... CTD PMID:16537435 Gabrb3 Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of GABRB3 mRNA CTD PMID:28522335 Gabrb3 Rat 3alpha-hydroxy-5beta-pregnan-20-one multiple interactions ISO GABRB3 (Homo sapiens) 6480464 Pregnanolone results in increased activity of [GABRA1 protein binds to GABRB3 binds to GABRG2 protein alternative form] more ... CTD PMID:29038840 Gabrb3 Rat 4,4'-sulfonyldiphenol decreases expression ISO Gabrb3 (Mus musculus) 6480464 bisphenol S results in decreased expression of GABRB3 mRNA CTD PMID:39298647 Gabrb3 Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of GABRB3 mRNA CTD PMID:36041667 Gabrb3 Rat 5-fluorouracil increases expression ISO Gabrb3 (Mus musculus) 6480464 Fluorouracil results in increased expression of GABRB3 protein CTD PMID:21296659 Gabrb3 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of GABRB3 mRNA CTD PMID:36843608 Gabrb3 Rat acetic acid affects expression ISO Gabrb3 (Mus musculus) 6480464 Acetic Acid affects the expression of GABRB3 protein CTD PMID:21296659 Gabrb3 Rat all-trans-retinoic acid decreases expression ISO GABRB3 (Homo sapiens) 6480464 Tretinoin results in decreased expression of GABRB3 mRNA CTD PMID:21934132 Gabrb3 Rat all-trans-retinol increases expression ISO GABRB3 (Homo sapiens) 6480464 Vitamin A results in increased expression of GABRB3 mRNA CTD PMID:17225872 Gabrb3 Rat alpha-hexachlorocyclohexane multiple interactions ISO GABRB3 (Homo sapiens) 6480464 alpha-hexachlorocyclohexane inhibits the reaction [tert-butylbicyclophosphorothionate binds to [GABRA1 protein binds to GABRB3 protein binds to GABRG2 protein]] and alpha-hexachlorocyclohexane promotes the reaction [gamma-Aminobutyric Acid results in increased activity of [GABRA1 protein binds to GABRB3 protein binds to GABRG2 protein]] CTD PMID:9316872 Gabrb3 Rat Alphaxolone multiple interactions EXP 6480464 alphaxalone promotes the reaction [Muscimol binds to GABRB3 protein] CTD PMID:8397295 Gabrb3 Rat amitriptyline increases expression EXP 6480464 Amitriptyline results in increased expression of GABRB3 mRNA CTD PMID:21820738 Gabrb3 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of GABRB3 mRNA CTD PMID:16483693 Gabrb3 Rat arsenous acid increases expression ISO GABRB3 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of GABRB3 mRNA CTD PMID:26705709 Gabrb3 Rat atrazine decreases expression ISO GABRB3 (Homo sapiens) 6480464 Atrazine results in decreased expression of GABRB3 mRNA CTD PMID:22378314 Gabrb3 Rat belinostat increases expression ISO GABRB3 (Homo sapiens) 6480464 belinostat results in increased expression of GABRB3 mRNA CTD PMID:26272509 Gabrb3 Rat belinostat multiple interactions ISO GABRB3 (Homo sapiens) 6480464 [NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of GABRB3 mRNA CTD PMID:27188386 Gabrb3 Rat benzamide multiple interactions ISO GABRB3 (Homo sapiens) 6480464 benzamide analog binds to and results in increased activity of [GABRA4 protein binds to GABRB3 protein binds to GABRD protein] and benzamide analog promotes the reaction [gamma-Aminobutyric Acid results in increased activity of [GABRA4 protein binds to GABRB3 protein binds to GABRD protein]] CTD PMID:18762200 Gabrb3 Rat benzo[a]pyrene affects methylation ISO GABRB3 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of GABRB3 promoter CTD PMID:27901495 Gabrb3 Rat benzo[a]pyrene increases methylation ISO GABRB3 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of GABRB3 5' UTR and Benzo(a)pyrene results in increased methylation of GABRB3 exon CTD PMID:27901495 Gabrb3 Rat bicuculline decreases expression EXP 6480464 Bicuculline results in decreased expression of GABRB3 mRNA CTD PMID:9600394 Gabrb3 Rat bicuculline multiple interactions ISO GABRB3 (Homo sapiens) 6480464 Bicuculline results in decreased activity of [GABRA2 protein binds to GABRB3 binds to GABRG2 protein alternative form] and Bicuculline results in decreased activity of [GABRA6 protein binds to GABRB3 binds to GABRG2 protein alternative form] CTD PMID:29038840 Gabrb3 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of GABRB3 mRNA CTD PMID:25181051 and PMID:30816183 Gabrb3 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of GABRB3 mRNA CTD PMID:36041667 Gabrb3 Rat bisphenol A multiple interactions ISO GABRB3 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of GABRB3 gene CTD PMID:31601247 Gabrb3 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of GABRB3 mRNA CTD PMID:29097150 and PMID:33296240 Gabrb3 Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of GABRB3 mRNA CTD PMID:36041667 Gabrb3 Rat bromochloroacetic acid affects expression ISO Gabrb3 (Mus musculus) 6480464 bromochloroacetic acid affects the expression of GABRB3 protein CTD PMID:21296659 Gabrb3 Rat butanal decreases expression ISO GABRB3 (Homo sapiens) 6480464 butyraldehyde results in decreased expression of GABRB3 mRNA CTD PMID:26079696 Gabrb3 Rat cadmium atom increases expression ISO GABRB3 (Homo sapiens) 6480464 Cadmium results in increased expression of GABRB3 mRNA CTD PMID:23369406 Gabrb3 Rat chlorpyrifos increases expression ISO Gabrb3 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of GABRB3 mRNA CTD PMID:36113784 and PMID:37019170 Gabrb3 Rat choline multiple interactions ISO Gabrb3 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of GABRB3 mRNA CTD PMID:20938992 Gabrb3 Rat clozapine increases expression EXP 6480464 Clozapine results in increased expression of GABRB3 mRNA CTD PMID:18923069 Gabrb3 Rat cocaine affects expression EXP 6480464 Cocaine affects the expression of GABRB3 mRNA CTD PMID:20187946 Gabrb3 Rat cocaine multiple interactions EXP 6480464 Cocaine affects the phosphorylation of and affects the expression of GABRB3 protein CTD PMID:20826313 Gabrb3 Rat copper(II) sulfate decreases expression ISO GABRB3 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of GABRB3 mRNA CTD PMID:19549813 Gabrb3 Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of GABRB3 mRNA CTD PMID:26577399 Gabrb3 Rat delta-hexachlorocyclohexane multiple interactions ISO GABRB3 (Homo sapiens) 6480464 [delta-hexachlorocyclohexane co-treated with Lanthanum] promotes the reaction [gamma-Aminobutyric Acid results in increased activity of [GABRA1 protein binds to GABRB3 protein binds to GABRG2 protein]] more ... CTD PMID:9316872 Gabrb3 Rat dexamethasone multiple interactions ISO GABRB3 (Homo sapiens) 6480464 Dexamethasone results in increased activity of [GABRA1 protein binds to GABRB3 protein binds to GABRG2 protein] CTD PMID:9316872 Gabrb3 Rat diarsenic trioxide increases expression ISO GABRB3 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of GABRB3 mRNA CTD PMID:26705709 Gabrb3 Rat diazepam increases expression EXP 6480464 Diazepam results in increased expression of GABRB3 mRNA CTD PMID:15802192 Gabrb3 Rat diazepam multiple interactions ISO GABRB3 (Homo sapiens) 6480464 Diazepam results in increased activity of [GABRA1 protein binds to GABRB3 binds to GABRG2 protein alternative form] and Diazepam results in increased activity of [GABRA2 protein binds to GABRB3 binds to GABRG2 protein alternative form] CTD PMID:29038840 Gabrb3 Rat dichloroacetic acid decreases expression ISO Gabrb3 (Mus musculus) 6480464 Dichloroacetic Acid results in decreased expression of GABRB3 mRNA CTD PMID:28962523 Gabrb3 Rat dieldrin decreases expression EXP 6480464 Dieldrin results in decreased expression of GABRB3 mRNA CTD PMID:9600394 Gabrb3 Rat dieldrin increases expression EXP 6480464 Dieldrin results in increased expression of GABRB3 mRNA CTD PMID:9302086 Gabrb3 Rat diquat decreases expression ISO Gabrb3 (Mus musculus) 6480464 Diquat results in decreased expression of GABRB3 mRNA CTD PMID:36851058 Gabrb3 Rat dorsomorphin multiple interactions ISO GABRB3 (Homo sapiens) 6480464 [NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Gabrb3 Rat doxorubicin decreases expression ISO GABRB3 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of GABRB3 mRNA CTD PMID:29803840 Gabrb3 Rat endosulfan affects binding ISO GABRB3 (Homo sapiens) 6480464 Endosulfan binds to GABRB3 protein CTD PMID:11489356 and PMID:16537435 Gabrb3 Rat endosulfan multiple interactions ISO GABRB3 (Homo sapiens) 6480464 Endosulfan inhibits the reaction [1-(4-ethynylphenyl)-4-propyl-2 more ... CTD PMID:11312652 Gabrb3 Rat entinostat increases expression ISO GABRB3 (Homo sapiens) 6480464 entinostat results in increased expression of GABRB3 mRNA CTD PMID:26272509 Gabrb3 Rat entinostat multiple interactions ISO GABRB3 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of GABRB3 mRNA CTD PMID:27188386 Gabrb3 Rat entinostat decreases expression ISO GABRB3 (Homo sapiens) 6480464 entinostat results in decreased expression of GABRB3 mRNA CTD PMID:27188386 Gabrb3 Rat ethanol multiple interactions ISO Gabrb3 (Mus musculus) 6480464 Ethanol affects the expression of and affects the splicing of GABRB3 mRNA CTD PMID:30319688 Gabrb3 Rat etomidate increases response to substance ISO Gabrb3 (Mus musculus) 6480464 GABRB3 protein results in increased susceptibility to Etomidate CTD PMID:9523823 Gabrb3 Rat etomidate multiple interactions ISO GABRB3 (Homo sapiens) 6480464 Etomidate inhibits the reaction [1-(4-ethynylphenyl)-4-propyl-2 more ... CTD PMID:21111751 Gabrb3 Rat felbamate multiple interactions ISO GABRB3 (Homo sapiens) 6480464 felbamate results in decreased activity of [GABRA1 protein binds to GABRB3 protein binds to GABRG2 protein alternative form] more ... CTD PMID:17056029 Gabrb3 Rat fipronil affects binding ISO GABRB3 (Homo sapiens) 6480464 fipronil binds to GABRB3 protein CTD PMID:11489356 and PMID:16537435 Gabrb3 Rat fipronil decreases phosphorylation ISO Gabrb3 (Mus musculus) 6480464 fipronil results in decreased phosphorylation of GABRB3 protein CTD PMID:32294523 Gabrb3 Rat fipronil multiple interactions ISO GABRB3 (Homo sapiens) 6480464 fipronil inhibits the reaction [1-(4-ethynylphenyl)-4-propyl-2 more ... CTD PMID:11312652 and PMID:29038840 Gabrb3 Rat flumazenil affects binding ISO GABRB3 (Homo sapiens) 6480464 Flumazenil binds to [GABRA6 protein binds to GABRB3 protein binds to GABRG2 protein] CTD PMID:8632757 Gabrb3 Rat flumazenil multiple interactions ISO GABRB3 (Homo sapiens) 6480464 Flumazenil binds to and results in increased activity of [GABRA6 protein binds to GABRB3 protein binds to GABRG2 protein] and Flumazenil promotes the reaction [gamma-Aminobutyric Acid binds to and results in increased activity of [GABRA6 protein binds to GABRB3 protein binds to GABRG2 protein]] CTD PMID:8632757 Gabrb3 Rat flunitrazepam multiple interactions ISO GABRB3 (Homo sapiens) 6480464 2 more ... CTD PMID:22029276 and PMID:8632757 Gabrb3 Rat flunitrazepam affects binding ISO GABRB3 (Homo sapiens) 6480464 Flunitrazepam binds to [GABRA1 protein binds to GABRB3 protein binds to GABRG2 protein] CTD PMID:22029276 Gabrb3 Rat folic acid multiple interactions ISO Gabrb3 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of GABRB3 mRNA CTD PMID:20938992 Gabrb3 Rat fulvestrant multiple interactions ISO GABRB3 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of GABRB3 gene CTD PMID:31601247 Gabrb3 Rat gamma-aminobutyric acid multiple interactions ISO GABRB3 (Homo sapiens) 6480464 [delta-hexachlorocyclohexane co-treated with Lanthanum] promotes the reaction [gamma-Aminobutyric Acid results in increased activity of [GABRA1 protein binds to GABRB3 protein binds to GABRG2 protein]] more ... CTD PMID:18762200 more ... Gabrb3 Rat gamma-aminobutyric acid increases expression EXP 6480464 gamma-Aminobutyric Acid results in increased expression of GABRB3 mRNA CTD PMID:26924987 Gabrb3 Rat gamma-hexachlorocyclohexane affects binding ISO GABRB3 (Homo sapiens) 6480464 Hexachlorocyclohexane binds to GABRB3 protein CTD PMID:11489356 and PMID:16537435 Gabrb3 Rat gamma-hexachlorocyclohexane multiple interactions ISO GABRB3 (Homo sapiens) 6480464 Hexachlorocyclohexane inhibits the reaction [1-(4-ethynylphenyl)-4-propyl-2 more ... CTD PMID:11312652 and PMID:9316872 Gabrb3 Rat haloperidol increases expression EXP 6480464 Haloperidol results in increased expression of GABRB3 mRNA CTD PMID:18923069 Gabrb3 Rat kainic acid increases expression ISO Gabrb3 (Mus musculus) 6480464 Kainic Acid results in increased expression of GABRB3 mRNA CTD PMID:27386150 Gabrb3 Rat kainic acid multiple interactions ISO Gabrb3 (Mus musculus) 6480464 Quercetin inhibits the reaction [Kainic Acid results in increased expression of GABRB3 mRNA] CTD PMID:27386150 Gabrb3 Rat L-methionine multiple interactions ISO Gabrb3 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of GABRB3 mRNA CTD PMID:20938992 Gabrb3 Rat lanthanum atom multiple interactions ISO GABRB3 (Homo sapiens) 6480464 [delta-hexachlorocyclohexane co-treated with Lanthanum] promotes the reaction [gamma-Aminobutyric Acid results in increased activity of [GABRA1 protein binds to GABRB3 protein binds to GABRG2 protein]] and Lanthanum promotes the reaction [gamma-Aminobutyric Acid results in increased activity of [GABRA1 protein binds to GABRB3 protein binds to GABRG2 protein]] CTD PMID:9316872 Gabrb3 Rat manganese(II) chloride decreases expression EXP 6480464 manganese chloride results in decreased expression of GABRB3 mRNA CTD PMID:28801915 Gabrb3 Rat mercury dibromide increases expression ISO GABRB3 (Homo sapiens) 6480464 mercuric bromide results in increased expression of GABRB3 mRNA CTD PMID:26272509 Gabrb3 Rat mercury dibromide multiple interactions ISO GABRB3 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of GABRB3 mRNA CTD PMID:27188386 Gabrb3 Rat mercury dichloride multiple interactions ISO GABRB3 (Homo sapiens) 6480464 [NOG protein co-treated with Mercuric Chloride co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of GABRB3 mRNA CTD PMID:27188386 Gabrb3 Rat methylmercury chloride increases expression ISO GABRB3 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of GABRB3 mRNA CTD PMID:23179753 more ... Gabrb3 Rat methylmercury chloride multiple interactions ISO GABRB3 (Homo sapiens) 6480464 [NOG protein co-treated with methylmercuric chloride co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of GABRB3 mRNA CTD PMID:27188386 Gabrb3 Rat midazolam increases response to substance ISO Gabrb3 (Mus musculus) 6480464 GABRB3 protein results in increased susceptibility to Midazolam CTD PMID:9523823 Gabrb3 Rat muscimol multiple interactions EXP 6480464 alphaxalone promotes the reaction [Muscimol binds to GABRB3 protein] and Pentobarbital promotes the reaction [Muscimol binds to GABRB3 protein] CTD PMID:8397295 Gabrb3 Rat muscimol affects binding ISO GABRB3 (Homo sapiens) 6480464 Muscimol binds to [GABRA1 protein binds to GABRB3 protein binds to GABRG2 protein] CTD PMID:22029276 Gabrb3 Rat muscimol multiple interactions ISO GABRB3 (Homo sapiens) 6480464 2 more ... CTD PMID:22029276 Gabrb3 Rat muscimol affects binding EXP 6480464 Muscimol binds to GABRB3 protein CTD PMID:8397295 Gabrb3 Rat N-methyl-4-phenylpyridinium decreases expression EXP 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of GABRB3 mRNA CTD PMID:28801915 Gabrb3 Rat oleamide decreases response to substance ISO Gabrb3 (Mus musculus) 6480464 GABRB3 gene mutant form results in decreased susceptibility to oleylamide CTD PMID:11742254 Gabrb3 Rat p-chloromercuribenzoic acid increases expression ISO GABRB3 (Homo sapiens) 6480464 p-Chloromercuribenzoic Acid results in increased expression of GABRB3 mRNA CTD PMID:26272509 Gabrb3 Rat p-chloromercuribenzoic acid multiple interactions ISO GABRB3 (Homo sapiens) 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of GABRB3 mRNA CTD PMID:27188386 Gabrb3 Rat panobinostat multiple interactions ISO GABRB3 (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of GABRB3 mRNA CTD PMID:27188386 Gabrb3 Rat panobinostat increases expression ISO GABRB3 (Homo sapiens) 6480464 panobinostat results in increased expression of GABRB3 mRNA CTD PMID:26272509 Gabrb3 Rat pentobarbital multiple interactions EXP 6480464 Pentobarbital promotes the reaction [Muscimol binds to GABRB3 protein] CTD PMID:8397295 Gabrb3 Rat pentobarbital multiple interactions ISO GABRB3 (Homo sapiens) 6480464 [Propofol co-treated with Pentobarbital] promotes the reaction [gamma-Aminobutyric Acid results in increased activity of [GABRA1 protein binds to GABRB3 protein binds to GABRG2 protein]] more ... CTD PMID:9316872 Gabrb3 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Gabrb3 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of GABRB3 mRNA CTD PMID:36331819 Gabrb3 Rat phenobarbital multiple interactions ISO Gabrb3 (Mus musculus) 6480464 NR1I3 protein affects the reaction [Phenobarbital results in increased expression of GABRB3 mRNA] CTD PMID:19482888 Gabrb3 Rat phenobarbital increases expression ISO Gabrb3 (Mus musculus) 6480464 Phenobarbital results in increased expression of GABRB3 mRNA CTD PMID:19482888 Gabrb3 Rat phenylmercury acetate increases expression ISO GABRB3 (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of GABRB3 mRNA CTD PMID:26272509 Gabrb3 Rat phenylmercury acetate multiple interactions ISO GABRB3 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of GABRB3 mRNA CTD PMID:27188386 Gabrb3 Rat picrotoxin multiple interactions ISO GABRB3 (Homo sapiens) 6480464 delta-hexachlorocyclohexane inhibits the reaction [Picrotoxin inhibits the reaction [gamma-Aminobutyric Acid results in increased activity of [GABRA1 protein binds to GABRB3 protein binds to GABRG2 protein]]] more ... CTD PMID:9316872 Gabrb3 Rat picrotoxinin affects binding ISO GABRB3 (Homo sapiens) 6480464 picrotoxinin binds to GABRB3 protein CTD PMID:16537435 Gabrb3 Rat picrotoxinin multiple interactions ISO GABRB3 (Homo sapiens) 6480464 picrotoxinin inhibits the reaction [gamma-Aminobutyric Acid results in increased activity of [GABRA1 protein binds to GABRB3 protein binds to GABRG2 protein alternative form]] more ... CTD PMID:29038840 Gabrb3 Rat picrotoxinin increases response to substance ISO GABRB3 (Homo sapiens) 6480464 GABRB3 protein results in increased susceptibility to picrotoxinin CTD PMID:29038840 Gabrb3 Rat propofol multiple interactions ISO GABRB3 (Homo sapiens) 6480464 [Propofol co-treated with Pentobarbital] promotes the reaction [gamma-Aminobutyric Acid results in increased activity of [GABRA1 protein binds to GABRB3 protein binds to GABRG2 protein]] more ... CTD PMID:22029276 more ... Gabrb3 Rat quercetin multiple interactions ISO Gabrb3 (Mus musculus) 6480464 Quercetin inhibits the reaction [Kainic Acid results in increased expression of GABRB3 mRNA] CTD PMID:27386150 Gabrb3 Rat SB 431542 multiple interactions ISO GABRB3 (Homo sapiens) 6480464 [NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Gabrb3 Rat sodium arsenite affects methylation ISO GABRB3 (Homo sapiens) 6480464 sodium arsenite affects the methylation of GABRB3 gene CTD PMID:28589171 Gabrb3 Rat sunitinib decreases expression ISO GABRB3 (Homo sapiens) 6480464 Sunitinib results in decreased expression of GABRB3 mRNA CTD PMID:31533062 Gabrb3 Rat tert-Butylbicyclophosphorothionate affects binding ISO GABRB3 (Homo sapiens) 6480464 tert-butylbicyclophosphorothionate binds to [GABRA1 protein binds to GABRB3 protein binds to GABRG2 protein] and tert-butylbicyclophosphorothionate binds to GABRB3 protein CTD PMID:16537435 and PMID:9316872 Gabrb3 Rat tert-Butylbicyclophosphorothionate multiple interactions ISO GABRB3 (Homo sapiens) 6480464 alpha-hexachlorocyclohexane inhibits the reaction [tert-butylbicyclophosphorothionate binds to [GABRA1 protein binds to GABRB3 protein binds to GABRG2 protein]] more ... CTD PMID:9316872 Gabrb3 Rat testosterone increases expression ISO GABRB3 (Homo sapiens) 6480464 Testosterone results in increased expression of GABRB3 mRNA CTD PMID:33359661 Gabrb3 Rat titanium dioxide decreases methylation ISO Gabrb3 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of GABRB3 gene CTD PMID:35295148 Gabrb3 Rat toluene affects expression EXP 6480464 Toluene affects the expression of GABRB3 mRNA CTD PMID:17108153 Gabrb3 Rat trichostatin A increases expression ISO GABRB3 (Homo sapiens) 6480464 trichostatin A results in increased expression of GABRB3 mRNA CTD PMID:24935251 and PMID:26272509 Gabrb3 Rat trichostatin A multiple interactions ISO GABRB3 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of GABRB3 mRNA CTD PMID:27188386 Gabrb3 Rat valproic acid increases methylation ISO GABRB3 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of GABRB3 gene CTD PMID:29154799 Gabrb3 Rat valproic acid increases expression ISO Gabrb3 (Mus musculus) 6480464 Valproic Acid results in increased expression of GABRB3 mRNA CTD PMID:36113784 Gabrb3 Rat valproic acid increases expression ISO GABRB3 (Homo sapiens) 6480464 Valproic Acid results in increased expression of GABRB3 mRNA CTD PMID:23179753 more ... Gabrb3 Rat valproic acid multiple interactions ISO GABRB3 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of GABRB3 mRNA CTD PMID:27188386 Gabrb3 Rat valproic acid affects expression ISO GABRB3 (Homo sapiens) 6480464 Valproic Acid affects the expression of GABRB3 mRNA CTD PMID:25979313 Gabrb3 Rat vancomycin increases expression ISO Gabrb3 (Mus musculus) 6480464 Vancomycin results in increased expression of GABRB3 mRNA CTD PMID:18930951 Gabrb3 Rat vinclozolin decreases methylation EXP 6480464 vinclozolin results in decreased methylation of GABRB3 gene CTD PMID:31682807 Gabrb3 Rat vorinostat decreases expression ISO GABRB3 (Homo sapiens) 6480464 vorinostat results in decreased expression of GABRB3 mRNA CTD PMID:27188386 Gabrb3 Rat vorinostat increases expression ISO GABRB3 (Homo sapiens) 6480464 vorinostat results in increased expression of GABRB3 mRNA CTD PMID:26272509 Gabrb3 Rat zolpidem multiple interactions ISO GABRB3 (Homo sapiens) 6480464 zolpidem binds to and results in increased activity of [GABRA1 protein binds to GABRB3 protein binds to GABRG2 protein] CTD PMID:8632757
(1->4)-beta-D-glucan (ISO) 1-[(4-chlorophenyl)-phenylmethyl]-4-methylpiperazine (EXP) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 3,3-bis(trifluoromethyl)bicyclo[2.2.1]heptane-2,2-dicarbonitrile (ISO) 3-chloropropane-1,2-diol (EXP) 3alpha-hydroxy-5beta-pregnan-20-one (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) 5-fluorouracil (ISO) 6-propyl-2-thiouracil (EXP) acetic acid (ISO) all-trans-retinoic acid (ISO) all-trans-retinol (ISO) alpha-hexachlorocyclohexane (ISO) Alphaxolone (EXP) amitriptyline (EXP) ammonium chloride (EXP) arsenous acid (ISO) atrazine (ISO) belinostat (ISO) benzamide (ISO) benzo[a]pyrene (ISO) bicuculline (EXP,ISO) bisphenol A (EXP,ISO) bisphenol F (EXP) bromochloroacetic acid (ISO) butanal (ISO) cadmium atom (ISO) chlorpyrifos (ISO) choline (ISO) clozapine (EXP) cocaine (EXP) copper(II) sulfate (ISO) Cuprizon (EXP) delta-hexachlorocyclohexane (ISO) dexamethasone (ISO) diarsenic trioxide (ISO) diazepam (EXP,ISO) dichloroacetic acid (ISO) dieldrin (EXP) diquat (ISO) dorsomorphin (ISO) doxorubicin (ISO) endosulfan (ISO) entinostat (ISO) ethanol (ISO) etomidate (ISO) felbamate (ISO) fipronil (ISO) flumazenil (ISO) flunitrazepam (ISO) folic acid (ISO) fulvestrant (ISO) gamma-aminobutyric acid (EXP,ISO) gamma-hexachlorocyclohexane (ISO) haloperidol (EXP) kainic acid (ISO) L-methionine (ISO) lanthanum atom (ISO) manganese(II) chloride (EXP) mercury dibromide (ISO) mercury dichloride (ISO) methylmercury chloride (ISO) midazolam (ISO) muscimol (EXP,ISO) N-methyl-4-phenylpyridinium (EXP) oleamide (ISO) p-chloromercuribenzoic acid (ISO) panobinostat (ISO) pentobarbital (EXP,ISO) perfluorooctane-1-sulfonic acid (ISO) phenobarbital (ISO) phenylmercury acetate (ISO) picrotoxin (ISO) picrotoxinin (ISO) propofol (ISO) quercetin (ISO) SB 431542 (ISO) sodium arsenite (ISO) sunitinib (ISO) tert-Butylbicyclophosphorothionate (ISO) testosterone (ISO) titanium dioxide (ISO) toluene (EXP) trichostatin A (ISO) valproic acid (ISO) vancomycin (ISO) vinclozolin (EXP) vorinostat (ISO) zolpidem (ISO)
Biological Process
brain development (ISO) cellular response to histamine (ISO,ISS) cellular response to zinc ion (ISO) cerebellum development (ISO) chloride transmembrane transport (IBA,IEA,ISO) chloride transport (IEA) circadian sleep/wake cycle, REM sleep (ISO) cochlea development (ISO) exploration behavior (ISO) gamma-aminobutyric acid signaling pathway (ISO,ISS,NAS) hard palate development (ISO) inhibitory postsynaptic potential (ISO) inhibitory synapse assembly (ISO,ISS) inner ear receptor cell development (ISO) innervation (ISO) learning (ISO) memory (ISO) monoatomic ion transmembrane transport (IEA) monoatomic ion transport (IEA) motor behavior (ISO) nervous system development (ISO) neuron development (ISO) reproductive behavior (ISO) response to anesthetic (ISO) response to auditory stimulus (IEP) response to xenobiotic stimulus (ISO) roof of mouth development (ISO,ISS) social behavior (ISO) synaptic transmission, GABAergic (IDA,ISO,NAS)
Cellular Component
cell surface (ISO) chloride channel complex (IEA) cytoplasm (IDA) cytoplasmic vesicle (IEA) cytoplasmic vesicle membrane (IEA) dendritic spine (ISO) GABA-A receptor complex (IBA,IPI,ISO,ISS) GABA-ergic synapse (IDA,IEA,ISO) inhibitory synapse (IDA) membrane (IEA) plasma membrane (IDA,IEA,ISO,ISS) postsynaptic membrane (IDA,IEA,ISO) postsynaptic specialization membrane (IDA) sperm head (IDA) synapse (IEA) terminal bouton (IDA)
1.
Atomic force microscopy reveals the stoichiometry and subunit arrangement of the alpha4beta3delta GABA(A) receptor.
Barrera NP, etal., Mol Pharmacol. 2008 Mar;73(3):960-7. doi: 10.1124/mol.107.042481. Epub 2007 Dec 13.
2.
Slow phases of GABA(A) receptor desensitization: structural determinants and possible relevance for synaptic function.
Bianchi MT and Macdonald RL, J Physiol 2002 Oct 1;544(Pt 1):3-18.
3.
Functional characterization of the new human GABA(A) receptor mutation beta3(R192H).
Buhr A, etal., Hum Genet. 2002 Aug;111(2):154-60. Epub 2002 Jul 16.
4.
The brefeldin A-inhibited GDP/GTP exchange factor 2, a protein involved in vesicular trafficking, interacts with the beta subunits of the GABA receptors.
Charych EI, etal., J Neurochem 2004 Jul;90(1):173-89.
5.
Association analysis of GABRB3 promoter variants with heroin dependence.
Chen CH, etal., PLoS One. 2014 Jul 15;9(7):e102227. doi: 10.1371/journal.pone.0102227. eCollection 2014.
6.
GABAA Receptors and the Diversity in their Structure and Pharmacology.
Chua HC and Chebib M, Adv Pharmacol. 2017;79:1-34. doi: 10.1016/bs.apha.2017.03.003. Epub 2017 May 2.
7.
Association of gephyrin with synaptic and extrasynaptic GABAA receptors varies during development in cultured hippocampal neurons.
Danglot L, etal., Mol Cell Neurosci. 2003 Jun;23(2):264-78.
8.
Association of GABRG3 with alcohol dependence.
Dick DM, etal., Alcohol Clin Exp Res. 2004 Jan;28(1):4-9. doi: 10.1097/01.ALC.0000108645.54345.98.
9.
Proton modulation of alpha 1 beta 3 delta GABAA receptor channel gating and desensitization.
Feng HJ and Macdonald RL, J Neurophysiol 2004 Sep;92(3):1577-85. Epub 2004 May 19.
10.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
11.
GABAA receptors: structure, function, pharmacology, and related disorders.
Ghit A, etal., J Genet Eng Biotechnol. 2021 Aug 21;19(1):123. doi: 10.1186/s43141-021-00224-0.
12.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
13.
Quantitative localisation of synaptic and extrasynaptic GABAA receptor subunits on hippocampal pyramidal cells by freeze-fracture replica immunolabelling.
Kasugai Y, etal., Eur J Neurosci. 2010 Dec;32(11):1868-88. doi: 10.1111/j.1460-9568.2010.07473.x. Epub 2010 Nov 14.
14.
Phospho-dependent binding of the clathrin AP2 adaptor complex to GABAA receptors regulates the efficacy of inhibitory synaptic transmission.
Kittler JT, etal., Proc Natl Acad Sci U S A. 2005 Oct 11;102(41):14871-6. Epub 2005 Sep 28.
15.
Cryo-EM structure of the human α1β3γ2 GABAA receptor in a lipid bilayer.
Laverty D, etal., Nature. 2019 Jan;565(7740):516-520. doi: 10.1038/s41586-018-0833-4. Epub 2019 Jan 2.
16.
Heroin addiction in African Americans: a hypothesis-driven association study.
Levran O, etal., Genes Brain Behav. 2009 Jul;8(5):531-40. Epub 2009 Jun 20.
17.
Identification and characterization of a novel splice variant of beta3 subunit of GABA(A) receptor in rat testis and spermatozoa.
Li SF, etal., Int J Biochem Cell Biol. 2005 Feb;37(2):350-60.
18.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
19.
Changes in excitatory and inhibitory receptor expression and network activity during induction and establishment of epilepsy in the rat Reduced Intensity Status Epilepticus (RISE) model.
Needs HI, etal., Neuropharmacology. 2019 Nov 1;158:107728. doi: 10.1016/j.neuropharm.2019.107728. Epub 2019 Jul 26.
20.
Incorporation of the pi subunit into functional gamma-aminobutyric Acid(A) receptors.
Neelands TR and Macdonald RL, Mol Pharmacol. 1999 Sep;56(3):598-610. doi: 10.1124/mol.56.3.598.
21.
D2 dopamine receptor and GABA(A) receptor beta3 subunit genes and alcoholism.
Noble EP, etal., Psychiatry Res. 1998 Nov 16;81(2):133-47. doi: 10.1016/s0165-1781(98)00084-5.
22.
Segregation of different GABAA receptors to synaptic and extrasynaptic membranes of cerebellar granule cells.
Nusser Z, etal., J Neurosci. 1998 Mar 1;18(5):1693-703.
23.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
24.
Online Mendelian Inheritance in Man, OMIM (TM).
Online Mendelian Inheritance in Man, OMIM (TM).
25.
Tactile allodynia can occur in the spared nerve injury model in the rat without selective loss of GABA or GABA(A) receptors from synapses in laminae I-II of the ipsilateral spinal dorsal horn.
Polgár E and Todd AJ, Neuroscience. 2008 Sep 22;156(1):193-202. doi: 10.1016/j.neuroscience.2008.07.009. Epub 2008 Jul 10.
26.
GOA pipeline
RGD automated data pipeline
27.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
28.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
29.
Gamma-aminobutyric acid receptor (GABA(A)) subunits in rat nucleus tractus solitarii (NTS) revealed by polymerase chain reaction (PCR) and immunohistochemistry.PG - 241-57
Saha S, etal., Mol Cell Neurosci 2001 Jan;17(1):241-57.
30.
Deletion of TLR-4 attenuates fetal alcohol exposure-induced gene expression and social interaction deficits.
Shukla PK, etal., Alcohol. 2018 Dec;73:73-78. doi: 10.1016/j.alcohol.2018.04.004. Epub 2018 Apr 18.
31.
Identification and characterisation of a Maf1/Macoco protein complex that interacts with GABAA receptors in neurons.
Smith KR, etal., Mol Cell Neurosci. 2010 Aug;44(4):330-41. doi: 10.1016/j.mcn.2010.04.004. Epub 2010 Apr 22.
32.
Low-dose thyroxine attenuates autism-associated adverse effects of fetal alcohol in male offspring's social behavior and hippocampal gene expression.
Tunc-Ozcan E, etal., Alcohol Clin Exp Res. 2013 Nov;37(11):1986-95. doi: 10.1111/acer.12183. Epub 2013 Jun 13.
33.
A GABRB3 promoter haplotype associated with childhood absence epilepsy impairs transcriptional activity.
Urak L, etal., Hum Mol Genet. 2006 Aug 15;15(16):2533-41. Epub 2006 Jul 11.
34.
The GABAA receptor beta 3 subunit gene: characterization of a human cDNA from chromosome 15q11q13 and mapping to a region of conserved synteny on mouse chromosome 7.
Wagstaff J, etal., Genomics 1991 Dec;11(4):1071-8.
35.
Early continuous white noise exposure alters l-alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionic acid receptor subunit glutamate receptor 2 and gamma-aminobutyric acid type a receptor subunit beta3 protein expression in rat auditory cortex.
Xu J, etal., J Neurosci Res. 2010 Feb 15;88(3):614-9. doi: 10.1002/jnr.22232.
36.
GARLH Family Proteins Stabilize GABAA Receptors at Synapses.
Yamasaki T, etal., Neuron. 2017 Mar 8;93(5):1138-1152.e6. doi: 10.1016/j.neuron.2017.02.023.
37.
GABAA receptor beta subunit heterogeneity: functional expression of cloned cDNAs.
Ymer S, etal., EMBO J 1989 Jun;8(6):1665-70.
Gabrb3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 117,602,772 - 117,838,230 (+) NCBI GRCr8 mRatBN7.2 1 108,467,047 - 108,702,522 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 108,296,124 - 108,698,961 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 113,838,572 - 114,068,957 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 122,311,079 - 122,541,470 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 115,559,397 - 115,789,792 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 113,034,251 - 113,265,364 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 112,976,770 - 113,265,364 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 114,042,551 - 114,275,043 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 109,047,399 - 109,277,756 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 109,125,741 - 109,356,099 (+) NCBI Celera 1 102,635,270 - 102,866,355 (+) NCBI Celera Cytogenetic Map 1 q22 NCBI
GABRB3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 15 26,543,552 - 26,773,763 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 15 26,543,552 - 26,939,539 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 15 26,788,699 - 27,018,910 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 15 24,339,786 - 24,570,020 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 15 24,342,555 - 24,570,020 NCBI Celera 15 4,950,603 - 5,179,865 (-) NCBI Celera Cytogenetic Map 15 q12 NCBI HuRef 15 4,917,779 - 5,148,361 (-) NCBI HuRef CHM1_1 15 26,738,348 - 26,968,576 (-) NCBI CHM1_1 T2T-CHM13v2.0 15 24,283,987 - 24,515,087 (-) NCBI T2T-CHM13v2.0
Gabrb3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 57,240,266 - 57,478,550 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 57,069,440 - 57,478,550 (+) Ensembl GRCm39 Ensembl GRCm38 7 57,590,518 - 57,828,802 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 57,419,692 - 57,828,802 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 64,845,904 - 65,084,172 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 57,458,398 - 57,696,666 (+) NCBI MGSCv36 mm8 Celera 7 54,911,328 - 55,150,383 (+) NCBI Celera Cytogenetic Map 7 B5 NCBI cM Map 7 33.53 NCBI
Gabrb3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955533 2,573,599 - 2,938,952 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955533 2,879,437 - 2,938,952 (+) NCBI ChiLan1.0 ChiLan1.0
GABRB3 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 16 8,504,014 - 8,732,012 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 15 12,144,864 - 12,373,305 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 15 3,129,481 - 3,357,495 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 15 23,981,359 - 24,201,975 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 15 23,981,359 - 24,058,357 (-) Ensembl panpan1.1 panPan2
GABRB3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 3 33,878,948 - 34,101,987 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 3 33,878,904 - 34,097,764 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 3 36,567,998 - 36,799,821 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 3 34,213,315 - 34,437,878 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 3 34,213,156 - 34,436,244 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 3 33,753,749 - 33,985,358 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 3 34,016,414 - 34,241,830 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 3 34,163,761 - 34,395,684 (+) NCBI UU_Cfam_GSD_1.0
Gabrb3 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 122,077,313 - 122,344,190 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936471 39,791,613 - 40,187,923 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936471 39,791,633 - 40,193,049 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
GABRB3
GABRB3 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 26 55,319,667 - 55,543,116 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 26 55,471,907 - 55,538,855 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666054 38,152,669 - 38,377,691 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Gabrb3
.
Predicted Target Of
Count of predictions: 144 Count of miRNA genes: 45 Interacting mature miRNAs: 60 Transcripts: ENSRNOT00000020099, ENSRNOT00000065223 Prediction methods: Miranda, Targetscan Result types: miRGate_prediction
631688 Hcas2 Hepatocarcinoma susceptibility QTL 2 3 0.0001 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 5925874 115540829 Rat 1582234 Gluco18 Glucose level QTL 18 3.4 0.0003 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 78479925 123479925 Rat 1358359 Sradr1 Stress Responsive Adrenal Weight QTL 1 4.74 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 30882023 123479925 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 1578654 Bss10 Bone structure and strength QTL 10 4 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 1 49393172 159356837 Rat 1300121 Hrtrt1 Heart rate QTL 1 3.7 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 65789093 115540829 Rat 9590300 Scort16 Serum corticosterone level QTL 16 4.39 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 1 103111621 148111621 Rat 2298545 Neuinf8 Neuroinflammation QTL 8 4.6 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 1 57336763 151090257 Rat 1302788 Scl19 Serum cholesterol QTL 19 4.6 0.001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 1 90532338 123479925 Rat 631569 Bp93 Blood pressure QTL 93 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 106047847 121834139 Rat 2313402 Anxrr24 Anxiety related response QTL 24 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 1 48963584 144267916 Rat 61344 Bp29 Blood pressure QTL 29 7.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 78350581 123350581 Rat 724521 Uae1 Urinary albumin excretion QTL 1 3.8 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 90508614 173018436 Rat 1358902 Bw47 Body weight QTL 47 1.67 body mass (VT:0001259) body weight (CMO:0000012) 1 90508614 180359386 Rat 61346 Rf2 Renal disease susceptibility QTL 2 3.7 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 1 99267916 144267916 Rat 2313094 Bss58 Bone structure and strength QTL 58 3.7 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 1 43284731 118944897 Rat 8655649 Arrd1 Age-related retinal degeneration QTL 1 4.89 retinal layer morphology trait (VT:0003727) percentage of study population developing retinopathy during a period of time (CMO:0002453) 1 100357752 183970443 Rat 2313099 Bss56 Bone structure and strength QTL 56 2.4 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 1 43284731 118944897 Rat 2313098 Bmd70 Bone mineral density QTL 70 3.6 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 1 43284731 118944897 Rat 1300153 Bp171 Blood pressure QTL 171 3.37 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 90664883 143200202 Rat 2317833 Alcrsp19 Alcohol response QTL 19 12.4 0.001 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 1 100979852 145979852 Rat 731168 Bp154 Blood pressure QTL 154 3.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94642644 214537671 Rat 1641897 Alcrsp1 Alcohol response QTL 1 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 1 100979852 145979852 Rat 1331749 Hrtrt11 Heart rate QTL 11 2.973 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 94494440 198211706 Rat 1331751 Bp199 Blood pressure QTL 199 3.60022 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 94494440 181830018 Rat 2293142 Bp314 Blood pressure QTL 314 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 92184926 137184926 Rat 724529 Cm16 Cardiac mass QTL 16 2.7 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 1 87580395 150700247 Rat 61370 Mcs3 Mammary carcinoma susceptibility QTL 3 2.15 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 1 102268556 147268556 Rat 2313059 Bss55 Bone structure and strength QTL 55 3.2 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 70209 Niddm23 Non-insulin dependent diabetes mellitus QTL 23 2.82 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 94494440 198324465 Rat 631496 Bp97 Blood pressure QTL 97 3.08 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 106047847 151047847 Rat 634314 Niddm44 Non-insulin dependent diabetes mellitus QTL 44 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 49393289 199050459 Rat 2303591 Gluco41 Glucose level QTL 41 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 102168504 147168504 Rat 1331793 Bp200 Blood pressure QTL 200 3.71601 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94494440 172949803 Rat 1354591 Cm36 Cardiac mass QTL 36 4.1 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 102813953 201278233 Rat 1331800 Scl25 Serum cholesterol level QTL 25 3.013 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 1 94494440 117601394 Rat 7421628 Bp361 Blood pressure QTL 361 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 66023617 118608521 Rat 70225 Bp58 Blood pressure QTL 58 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32356093 162846471 Rat 2313072 Bss53 Bone structure and strength QTL 53 4.3 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 1 43284731 118944897 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 2313078 Bss54 Bone structure and strength QTL 54 3.5 0.0001 tibia area (VT:1000281) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 61399 Tcat1 Tongue tumor resistance QTL 1 3.3 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 5 mm (CMO:0001879) 1 99267916 144267916 Rat 2313083 Bmd74 Bone mineral density QTL 74 4 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 1 82174743 118944897 Rat 4889494 Scort2 Serum corticosterone level QTL 2 4.2 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 1 80592172 125592172 Rat 724567 Tcas6 Tongue tumor susceptibility QTL 6 6.85 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 1 92948896 144267916 Rat 1354615 Cm32 Cardiac mass QTL 32 5.2 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 1 102813953 201278233 Rat 1358192 Ept13 Estrogen-induced pituitary tumorigenesis QTL 13 3.4 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 1 77494165 122494165 Rat 8694370 Bw154 Body weight QTL 154 8.91 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 1 103111621 148111621 Rat 1354623 Rf46 Renal function QTL 46 3.8 blood creatinine amount (VT:0005328) plasma creatinine level (CMO:0000537) 1 102813953 151162766 Rat 738022 Anxrr13 Anxiety related response QTL 13 4.6 0.00039 locomotor behavior trait (VT:0001392) number of 20 x 20 cm floor squares crossed into, out of or within a discrete space in an experimental apparatus (CMO:0001514) 1 83547917 128547917 Rat 10054135 Gmadr2 Adrenal mass QTL 2 1.97 0.0129 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 77857876 122857876 Rat 7411712 Strs4 Sensitivity to stroke QTL 4 8.7 cerebrum integrity trait (VT:0010549) percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932) 1 78430536 123430536 Rat 2313051 Bss57 Bone structure and strength QTL 57 3.7 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 1 43284731 118944897 Rat 1354606 Bp246 Blood pressure QTL 246 3.6 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 102813953 218753816 Rat
D1Arb10
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 1 117,834,041 - 117,834,434 (+) Marker Load Pipeline mRatBN7.2 1 108,698,333 - 108,698,726 (+) MAPPER mRatBN7.2 Rnor_6.0 1 113,264,737 - 113,265,129 NCBI Rnor6.0 Rnor_5.0 1 114,274,416 - 114,274,808 UniSTS Rnor5.0 RGSC_v3.4 1 109,277,128 - 109,277,521 RGD RGSC3.4 RGSC_v3.4 1 109,277,129 - 109,277,521 UniSTS RGSC3.4 RGSC_v3.1 1 109,355,471 - 109,355,864 RGD Celera 1 102,865,724 - 102,866,120 UniSTS FHH x ACI Map 1 55.58 RGD FHH x ACI Map 1 55.58 UniSTS Cytogenetic Map 1 q22 UniSTS
D1Rat268
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 1 117,823,451 - 117,823,600 (+) Marker Load Pipeline mRatBN7.2 1 108,687,741 - 108,687,892 (+) MAPPER mRatBN7.2 Rnor_6.0 1 113,254,147 - 113,254,295 NCBI Rnor6.0 Rnor_5.0 1 114,263,826 - 114,263,974 UniSTS Rnor5.0 RGSC_v3.4 1 109,266,538 - 109,266,687 RGD RGSC3.4 RGSC_v3.4 1 109,266,539 - 109,266,687 UniSTS RGSC3.4 RGSC_v3.1 1 109,344,881 - 109,345,030 RGD Celera 1 102,855,134 - 102,855,282 UniSTS SHRSP x BN Map 1 53.79 UniSTS SHRSP x BN Map 1 53.79 RGD Cytogenetic Map 1 q22 UniSTS
D1Mco65
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 108,687,678 - 108,687,892 (+) MAPPER mRatBN7.2 Rnor_6.0 1 113,254,084 - 113,254,295 NCBI Rnor6.0 Rnor_5.0 1 114,263,763 - 114,263,974 UniSTS Rnor5.0 RGSC_v3.4 1 109,266,476 - 109,266,687 UniSTS RGSC3.4 Celera 1 102,855,071 - 102,855,282 UniSTS Cytogenetic Map 1 q22 UniSTS
D1Mco64
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 108,580,284 - 108,580,484 (+) MAPPER mRatBN7.2 Rnor_6.0 1 113,146,686 - 113,146,883 NCBI Rnor6.0 Rnor_5.0 1 114,156,365 - 114,156,562 UniSTS Rnor5.0 RGSC_v3.4 1 109,159,076 - 109,159,273 UniSTS RGSC3.4 Celera 1 102,747,697 - 102,747,894 UniSTS Cytogenetic Map 1 q22 UniSTS
D1Wox53
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 1 117,834,215 - 117,834,459 (+) Marker Load Pipeline mRatBN7.2 1 108,698,507 - 108,698,751 (+) MAPPER mRatBN7.2 Rnor_6.0 1 113,264,911 - 113,265,154 NCBI Rnor6.0 Rnor_5.0 1 114,274,590 - 114,274,833 UniSTS Rnor5.0 RGSC_v3.4 1 109,277,303 - 109,277,546 UniSTS RGSC3.4 Celera 1 102,865,898 - 102,866,145 UniSTS Cytogenetic Map 1 q22 UniSTS
RH138257
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 108,682,588 - 108,682,830 (+) MAPPER mRatBN7.2 Rnor_6.0 1 113,248,993 - 113,249,234 NCBI Rnor6.0 Rnor_5.0 1 114,258,672 - 114,258,913 UniSTS Rnor5.0 RGSC_v3.4 1 109,261,385 - 109,261,626 UniSTS RGSC3.4 Celera 1 102,849,987 - 102,850,228 UniSTS Cytogenetic Map 1 q22 UniSTS
AW531506
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 108,653,215 - 108,653,385 (+) MAPPER mRatBN7.2 Rnor_6.0 1 113,219,620 - 113,219,789 NCBI Rnor6.0 Rnor_5.0 1 114,229,299 - 114,229,468 UniSTS Rnor5.0 RGSC_v3.4 1 109,232,012 - 109,232,181 UniSTS RGSC3.4 Celera 1 102,820,616 - 102,820,785 UniSTS RH 3.4 Map 1 967.01 UniSTS Cytogenetic Map 1 q22 UniSTS
BE113547
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 108,661,984 - 108,662,136 (+) MAPPER mRatBN7.2 Rnor_6.0 1 113,228,389 - 113,228,540 NCBI Rnor6.0 Rnor_5.0 1 114,238,068 - 114,238,219 UniSTS Rnor5.0 RGSC_v3.4 1 109,240,781 - 109,240,932 UniSTS RGSC3.4 Celera 1 102,829,385 - 102,829,536 UniSTS RH 3.4 Map 1 965.91 UniSTS Cytogenetic Map 1 q22 UniSTS
GDB:192789
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 108,698,188 - 108,698,446 (+) MAPPER mRatBN7.2 Rnor_6.0 1 113,264,592 - 113,264,849 NCBI Rnor6.0 Rnor_5.0 1 114,274,271 - 114,274,528 UniSTS Rnor5.0 RGSC_v3.4 1 109,276,984 - 109,277,241 UniSTS RGSC3.4 Celera 1 102,865,579 - 102,865,836 UniSTS Cytogenetic Map 1 q22 UniSTS
RH11160
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 108,698,508 - 108,698,648 (+) MAPPER mRatBN7.2 Rnor_6.0 1 113,264,912 - 113,265,051 NCBI Rnor6.0 Rnor_5.0 1 114,274,591 - 114,274,730 UniSTS Rnor5.0 RGSC_v3.4 1 109,277,304 - 109,277,443 UniSTS RGSC3.4 Celera 1 102,865,899 - 102,866,042 UniSTS Cytogenetic Map 1 q22 UniSTS
D1Wox53
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 1 117,834,215 - 117,834,458 (+) Marker Load Pipeline mRatBN7.2 1 108,698,507 - 108,698,750 (+) MAPPER mRatBN7.2 Rnor_6.0 1 113,264,911 - 113,265,153 NCBI Rnor6.0 Rnor_5.0 1 114,274,590 - 114,274,832 UniSTS Rnor5.0 RGSC_v3.4 1 109,277,303 - 109,277,545 UniSTS RGSC3.4 Celera 1 102,865,898 - 102,866,144 UniSTS Cytogenetic Map 1 q22 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
9
44
112
64
61
32
25
32
5
180
91
93
41
60
29
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000077594 ⟹ ENSRNOP00000071680
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 108,455,915 - 108,698,961 (+) Ensembl Rnor_6.0 Ensembl 1 113,034,266 - 113,265,364 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000077877 ⟹ ENSRNOP00000073384
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 108,296,124 - 108,698,961 (+) Ensembl Rnor_6.0 Ensembl 1 113,034,266 - 113,264,982 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000079348 ⟹ ENSRNOP00000070416
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 108,410,949 - 108,455,986 (+) Ensembl Rnor_6.0 Ensembl 1 112,976,770 - 113,021,942 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000081831 ⟹ ENSRNOP00000071478
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 108,467,112 - 108,698,961 (+) Ensembl Rnor_6.0 Ensembl 1 113,034,227 - 113,265,364 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000082310 ⟹ ENSRNOP00000069990
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 1 113,033,098 - 113,033,228 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000113752 ⟹ ENSRNOP00000085111
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 108,467,741 - 108,698,961 (+) Ensembl
RefSeq Acc Id:
NM_017065 ⟹ NP_058761
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 117,603,460 - 117,834,669 (+) NCBI mRatBN7.2 1 108,467,741 - 108,698,961 (+) NCBI Rnor_6.0 1 113,034,251 - 113,265,364 (+) NCBI Rnor_5.0 1 114,042,551 - 114,275,043 (+) NCBI RGSC_v3.4 1 109,047,399 - 109,277,756 (+) RGD Celera 1 102,635,270 - 102,866,355 (+) RGD
Sequence:
GCAGCACCCCGGCTCGGGGTCGCGACGGCGGCGGGGCGCCCCCTCCCCCGTGCCGGGGCGCGGCGAAGGGATGTGGGGCTTTGCGGGAGGAAGGCTTTTCGGCATCTTCTCGGCCCCGGTGCTGGTGG
hide sequence
RefSeq Acc Id:
XM_039101122 ⟹ XP_038957050
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 117,602,772 - 117,838,230 (+) NCBI mRatBN7.2 1 108,467,047 - 108,702,522 (+) NCBI
RefSeq Acc Id:
XM_039101126 ⟹ XP_038957054
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 117,603,736 - 117,838,230 (+) NCBI mRatBN7.2 1 108,468,017 - 108,702,522 (+) NCBI
RefSeq Acc Id:
NP_058761 ⟸ NM_017065
- Peptide Label:
precursor
- UniProtKB:
P63079 (UniProtKB/Swiss-Prot), A6KD41 (UniProtKB/TrEMBL), A0A0G2K131 (UniProtKB/TrEMBL)
- Sequence:
MWGFAGGRLFGIFSAPVLVAVVCCAQSVNDPGNMSFVKETVDKLLKGYDIRLRPDFGGPPVCVGMNIDIASIDMVSEVNMDYTLTMYFQQYWRDKRLAYSGIPLNLTLDNRVADQLWVPDTYFLNDKK
hide sequence
Ensembl Acc Id:
ENSRNOP00000070416 ⟸ ENSRNOT00000079348
Ensembl Acc Id:
ENSRNOP00000069990 ⟸ ENSRNOT00000082310
Ensembl Acc Id:
ENSRNOP00000071680 ⟸ ENSRNOT00000077594
Ensembl Acc Id:
ENSRNOP00000073384 ⟸ ENSRNOT00000077877
Ensembl Acc Id:
ENSRNOP00000071478 ⟸ ENSRNOT00000081831
RefSeq Acc Id:
XP_038957050 ⟸ XM_039101122
- Peptide Label:
isoform X1
- UniProtKB:
A0A0G2K0J9 (UniProtKB/TrEMBL), A6KD40 (UniProtKB/TrEMBL), A0A0G2K131 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038957054 ⟸ XM_039101126
- Peptide Label:
isoform X2
- UniProtKB:
A0A0G2K131 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000085111 ⟸ ENSRNOT00000113752
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2019-12-06
Gabrb3
gamma-aminobutyric acid type A receptor subunit beta 3
Gabrb3
gamma-aminobutyric acid type A receptor beta 3 subunit
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2016-02-11
Gabrb3
gamma-aminobutyric acid type A receptor beta 3 subunit
Gabrb3
gamma-aminobutyric acid (GABA) A receptor, beta 3
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-11-04
Gabrb3
gamma-aminobutyric acid (GABA) A receptor, beta 3
Gabrb3
gamma-aminobutyric acid (GABA-A) receptor, subunit beta 3
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-03-30
Gabrb3
gamma-aminobutyric acid (GABA-A) receptor, subunit beta 3
gamma-aminobutyric acid receptor, subunit beta 3
Name updated
1299863 APPROVED
2002-06-10
Gabrb3
Gamma-aminobutyric acid receptor beta 3
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_cellular_localization
localizes to both cytoplasmic and subsynaptic sites of NTS neurons
625528
gene_expression
mRNA is expressed in high amounts in nucleus tractus solitarii and protein expression is seen in many areas of the medulla like cuneate, gracile, olivary and spinal trigeminal nuclei
625528
gene_process
may mediate inhibitory GABA responses in nucleus tractus solitarii (NTS) in the brain
625528
