Symbol:
F2r
Name:
coagulation factor II (thrombin) receptor
RGD ID:
2586
Description:
Predicted to enable several functions, including G-protein alpha-subunit binding activity; G-protein beta-subunit binding activity; and thrombin-activated receptor activity. Involved in several processes, including establishment of synaptic specificity at neuromuscular junction; negative regulation of glomerular filtration; and positive regulation of vasoconstriction. Located in neuromuscular junction and postsynaptic membrane. Used to study hypertension. Biomarker of brain edema and brain ischemia. Orthologous to human F2R (coagulation factor II thrombin receptor); PARTICIPATES IN G protein mediated signaling pathway; protease mediated signaling via protease-activated receptor 1; calcium/calcium-mediated signaling pathway; INTERACTS WITH 1-naphthyl isothiocyanate; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
coagulation factor II receptor; MGC93622; PAR-1; Par1; protease-activated receptor 1; proteinase-activated receptor 1; Thrombin receptor; TRGPC
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Allele / Splice:
F2rem1Mcwi
Genetic Models:
T2DN-F2rem1Mcwi
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 28,604,066 - 28,620,579 (-) NCBI GRCr8 mRatBN7.2 2 26,869,343 - 26,885,856 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 26,868,404 - 26,885,870 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 33,907,656 - 33,924,163 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 32,007,753 - 32,024,260 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 26,823,845 - 26,840,377 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 26,118,760 - 26,135,340 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 26,118,760 - 26,135,340 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 45,254,489 - 45,257,761 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 25,985,800 - 25,989,072 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 25,906,181 - 25,909,441 (-) NCBI Celera 2 22,933,182 - 22,949,696 (-) NCBI Celera RH 3.4 Map 2 13.3 RGD Cytogenetic Map 2 q12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
F2r Rat (1->4)-beta-D-glucan multiple interactions ISO RGD:10556 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of F2R mRNA CTD PMID:36331819 F2r Rat 1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene multiple interactions ISO RGD:10556 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 F2r Rat 1,2-dimethylhydrazine multiple interactions ISO RGD:10556 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of F2R mRNA CTD PMID:22206623 F2r Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of F2R mRNA CTD PMID:25380136 F2r Rat 1-naphthyl isothiocyanate multiple interactions ISO RGD:10556 6480464 F2R protein promotes the reaction [1-Naphthylisothiocyanate results in increased expression of CCL2 mRNA]; F2R protein more ... CTD PMID:21037076 F2r Rat 1-naphthyl isothiocyanate increases expression ISO RGD:10556 6480464 1-Naphthylisothiocyanate results in increased expression of F2R mRNA CTD PMID:21037076 F2r Rat 1-naphthyl isothiocyanate multiple interactions ISO RGD:735960 6480464 F2R protein promotes the reaction [1-Naphthylisothiocyanate results in increased expression of [ITGB6 protein co-treated with more ... CTD PMID:21037076 F2r Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of F2R mRNA CTD PMID:32145629 F2r Rat 17beta-estradiol affects expression ISO RGD:10556 6480464 Estradiol affects the expression of F2R mRNA CTD PMID:39298647 F2r Rat 17beta-hydroxy-5alpha-androstan-3-one decreases expression ISO RGD:10556 6480464 Dihydrotestosterone results in decreased expression of F2R mRNA CTD PMID:17023530 F2r Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO RGD:10556 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 F2r Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO RGD:735960 6480464 2,2',4,4'-tetrabromodiphenyl ether analog results in decreased expression of F2R mRNA CTD PMID:19095052 F2r Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO RGD:10556 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 F2r Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:735960 6480464 Tetrachlorodibenzodioxin results in increased expression of F2R mRNA CTD PMID:12377990 F2r Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of F2R mRNA CTD PMID:33387578 F2r Rat 2,3,7,8-tetrachlorodibenzodioxine affects response to substance ISO RGD:10556 6480464 F2R affects the susceptibility to Tetrachlorodibenzodioxin CTD PMID:27613713 F2r Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:10556 6480464 F2R gene mutant form inhibits the reaction [Tetrachlorodibenzodioxin results in increased expression of and results more ... CTD PMID:27613713 F2r Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:10556 6480464 Tetrachlorodibenzodioxin results in increased expression of F2R mRNA CTD PMID:28922406 F2r Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:735960 6480464 Tetrachlorodibenzodioxin results in decreased expression of F2R mRNA CTD PMID:23152189 F2r Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of F2R mRNA CTD PMID:22298810 F2r Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:10556 6480464 Tetrachlorodibenzodioxin results in decreased expression of F2R mRNA CTD PMID:19770486 F2r Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:10556 6480464 Tetrachlorodibenzodioxin affects the expression of F2R mRNA CTD PMID:20702594 F2r Rat 2,3,7,8-Tetrachlorodibenzofuran affects expression ISO RGD:10556 6480464 2,3,7,8-tetrachlorodibenzofuran affects the expression of F2R mRNA CTD PMID:20702594 F2r Rat 2,4,4'-trichlorobiphenyl multiple interactions ISO RGD:10556 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 F2r Rat 2-hydroxypropanoic acid increases expression ISO RGD:735960 6480464 Lactic Acid results in increased expression of F2R mRNA CTD PMID:30851411 F2r Rat 3',5'-cyclic AMP multiple interactions ISO RGD:10556 6480464 [C186 65 binds to and results in increased activity of F2R protein] inhibits the reaction more ... CTD PMID:22207716 F2r Rat 3,3',4,4',5-pentachlorobiphenyl increases expression EXP 6480464 3,4,5,3',4'-pentachlorobiphenyl results in increased expression of F2R mRNA CTD PMID:23196670 F2r Rat 3-chloropropane-1,2-diol decreases expression EXP 6480464 alpha-Chlorohydrin results in decreased expression of F2R mRNA CTD PMID:28522335 F2r Rat 4,4'-diaminodiphenylmethane increases expression EXP 6480464 4,4'-diaminodiphenylmethane results in increased expression of F2R mRNA CTD PMID:25380136|PMID:30723492 F2r Rat 4,4'-diaminodiphenylmethane increases expression ISO RGD:10556 6480464 4,4'-diaminodiphenylmethane results in increased expression of F2R mRNA CTD PMID:18648102 F2r Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:10556 6480464 bisphenol S results in increased expression of F2R mRNA CTD PMID:39298647 F2r Rat 4-hydroxynon-2-enal decreases expression ISO RGD:735960 6480464 4-hydroxy-2-nonenal results in decreased expression of F2R mRNA CTD PMID:12419474 F2r Rat 4-hydroxyphenyl retinamide increases expression ISO RGD:10556 6480464 Fenretinide results in increased expression of F2R mRNA CTD PMID:28973697 F2r Rat 5-aza-2'-deoxycytidine increases expression ISO RGD:735960 6480464 Decitabine results in increased expression of F2R mRNA CTD PMID:16367923 F2r Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of F2R mRNA CTD PMID:24780913|PMID:25825206 F2r Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of F2R mRNA CTD PMID:31881176 F2r Rat acetylsalicylic acid decreases expression ISO RGD:735960 6480464 Aspirin results in decreased expression of F2R protein CTD PMID:15140583|PMID:15381054 F2r Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of F2R mRNA CTD PMID:28959563 F2r Rat aflatoxin B1 increases expression ISO RGD:735960 6480464 Aflatoxin B1 results in increased expression of F2R mRNA CTD PMID:22100608 F2r Rat aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of F2R mRNA CTD PMID:33354967 F2r Rat aldehydo-D-glucose decreases expression ISO RGD:735960 6480464 Glucose results in decreased expression of F2R mRNA CTD PMID:31655124 F2r Rat aldosterone multiple interactions EXP 6480464 [Aldosterone co-treated with Sodium Chloride, Dietary] results in increased expression of F2R mRNA CTD PMID:27773435 F2r Rat all-trans-retinoic acid increases expression ISO RGD:10556 6480464 Tretinoin results in increased expression of F2R mRNA CTD PMID:16604517 F2r Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of F2R mRNA CTD PMID:38685447 F2r Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of F2R mRNA CTD PMID:30047161 F2r Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of F2R mRNA CTD PMID:16483693 F2r Rat arsane affects expression ISO RGD:735960 6480464 Arsenic affects the expression of F2R mRNA CTD PMID:18414638 F2r Rat arsane multiple interactions ISO RGD:735960 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in increased expression of F2R more ... CTD PMID:32525701|PMID:39836092 F2r Rat arsenic atom affects expression ISO RGD:735960 6480464 Arsenic affects the expression of F2R mRNA CTD PMID:18414638 F2r Rat arsenic atom multiple interactions ISO RGD:735960 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in increased expression of F2R more ... CTD PMID:32525701|PMID:39836092 F2r Rat arsenous acid increases expression ISO RGD:735960 6480464 Arsenic Trioxide results in increased expression of F2R mRNA CTD PMID:22535156 F2r Rat atropine multiple interactions ISO RGD:10556 6480464 [Paraoxon co-treated with Atropine co-treated with Obidoxime Chloride] results in increased expression of F2R protein CTD PMID:30515700 F2r Rat avobenzone increases expression ISO RGD:735960 6480464 avobenzone results in increased expression of F2R mRNA CTD PMID:31016361 F2r Rat Azoxymethane multiple interactions ISO RGD:10556 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of F2R more ... CTD PMID:29950665 F2r Rat benzo[a]pyrene decreases expression ISO RGD:10556 6480464 Benzo(a)pyrene results in decreased expression of F2R mRNA CTD PMID:19770486 F2r Rat benzo[a]pyrene increases methylation ISO RGD:735960 6480464 Benzo(a)pyrene results in increased methylation of F2R promoter CTD PMID:27901495 F2r Rat benzo[a]pyrene increases expression ISO RGD:735960 6480464 Benzo(a)pyrene results in increased expression of F2R mRNA CTD PMID:20106945|PMID:21632981|PMID:22316170|PMID:32234424 F2r Rat bis(2-ethylhexyl) phthalate decreases expression EXP 6480464 Diethylhexyl Phthalate results in decreased expression of F2R mRNA CTD PMID:15620428 F2r Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of F2R mRNA CTD PMID:25181051|PMID:32145629 F2r Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of F2R gene CTD PMID:28505145 F2r Rat bivalirudin decreases activity ISO RGD:735960 6480464 bivalirudin results in decreased activity of F2R protein CTD PMID:19124943 F2r Rat butanal increases expression ISO RGD:735960 6480464 butyraldehyde results in increased expression of F2R mRNA CTD PMID:26079696 F2r Rat C60 fullerene decreases expression EXP 6480464 fullerene C60 results in decreased expression of F2R mRNA CTD PMID:19167457 F2r Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of F2R mRNA CTD PMID:25993096 F2r Rat cadmium dichloride decreases expression ISO RGD:735960 6480464 Cadmium Chloride results in decreased expression of F2R mRNA CTD PMID:38568856 F2r Rat cadmium dichloride increases expression ISO RGD:735960 6480464 Cadmium Chloride results in increased expression of F2R mRNA CTD PMID:26472689 F2r Rat cadmium sulfate multiple interactions ISO RGD:735960 6480464 [cadmium sulfate co-treated with cobaltous chloride co-treated with lead chloride] results in increased expression of more ... CTD PMID:18654764 F2r Rat calciol increases expression ISO RGD:10556 6480464 Cholecalciferol results in increased expression of F2R mRNA CTD PMID:17170073 F2r Rat calcium atom multiple interactions ISO RGD:10556 6480464 [Peptides results in increased activity of F2R protein] which results in increased abundance of Calcium CTD PMID:15086339 F2r Rat calcium(0) multiple interactions ISO RGD:10556 6480464 [Peptides results in increased activity of F2R protein] which results in increased abundance of Calcium CTD PMID:15086339 F2r Rat carbon nanotube increases expression ISO RGD:10556 6480464 Nanotubes, Carbon analog results in increased expression of F2R mRNA; Nanotubes, Carbon results in increased more ... CTD PMID:25554681 F2r Rat chloropicrin increases expression ISO RGD:735960 6480464 chloropicrin results in increased expression of F2R mRNA CTD PMID:26352163 F2r Rat chlorpyrifos decreases methylation EXP 6480464 Chlorpyrifos results in decreased methylation of F2R gene CTD PMID:32905263 F2r Rat choline multiple interactions ISO RGD:10556 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation more ... CTD PMID:20938992 F2r Rat cisplatin multiple interactions ISO RGD:10556 6480464 4-methyl-N1-(3-phenylpropyl)benzene-1,2-diamine inhibits the reaction [Cisplatin results in increased expression of F2R mRNA] CTD PMID:26546572 F2r Rat cisplatin increases expression ISO RGD:10556 6480464 Cisplatin results in increased expression of F2R mRNA CTD PMID:26546572 F2r Rat clopidogrel affects response to substance ISO RGD:735960 6480464 F2R gene SNP affects the susceptibility to clopidogrel CTD PMID:16194864 F2r Rat cobalt dichloride decreases expression ISO RGD:735960 6480464 cobaltous chloride results in decreased expression of F2R mRNA CTD PMID:19320972 F2r Rat cobalt dichloride multiple interactions ISO RGD:735960 6480464 [cadmium sulfate co-treated with cobaltous chloride co-treated with lead chloride] results in increased expression of more ... CTD PMID:18654764 F2r Rat colforsin daropate hydrochloride multiple interactions ISO RGD:10556 6480464 [C186 65 binds to and results in increased activity of F2R protein] inhibits the reaction more ... CTD PMID:22207716 F2r Rat copper atom multiple interactions ISO RGD:735960 6480464 [Chelating Agents binds to Copper] which results in decreased expression of F2R mRNA; [NSC 689534 more ... CTD PMID:20971185|PMID:30911355 F2r Rat copper(0) multiple interactions ISO RGD:735960 6480464 [Chelating Agents binds to Copper] which results in decreased expression of F2R mRNA; [NSC 689534 more ... CTD PMID:20971185|PMID:30911355 F2r Rat copper(II) chloride decreases expression ISO RGD:735960 6480464 cupric chloride results in decreased expression of F2R mRNA CTD PMID:38568856 F2r Rat copper(II) sulfate increases expression ISO RGD:735960 6480464 Copper Sulfate results in increased expression of F2R mRNA CTD PMID:19549813 F2r Rat coumestrol decreases expression ISO RGD:735960 6480464 Coumestrol results in decreased expression of F2R mRNA CTD PMID:19167446 F2r Rat crocidolite asbestos decreases expression ISO RGD:10556 6480464 Asbestos, Crocidolite results in decreased expression of F2R mRNA CTD PMID:29279043 F2r Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of F2R mRNA CTD PMID:27523638 F2r Rat curcumin multiple interactions ISO RGD:735960 6480464 Curcumin inhibits the reaction [Oxygen deficiency results in increased expression of F2R mRNA] CTD PMID:23452621 F2r Rat cyclosporin A decreases expression ISO RGD:735960 6480464 Cyclosporine results in decreased expression of F2R mRNA CTD PMID:20106945|PMID:27989131 F2r Rat cyclosporin A decreases expression ISO RGD:10556 6480464 Cyclosporine results in decreased expression of F2R mRNA CTD PMID:19770486 F2r Rat D-glucose decreases expression ISO RGD:735960 6480464 Glucose results in decreased expression of F2R mRNA CTD PMID:31655124 F2r Rat dexamethasone increases expression ISO RGD:735960 6480464 Dexamethasone results in increased expression of F2R protein CTD PMID:11733402 F2r Rat dexamethasone multiple interactions EXP 6480464 Mifepristone inhibits the reaction [Dexamethasone results in increased expression of F2R mRNA] CTD PMID:11733402 F2r Rat dexamethasone increases expression EXP 6480464 Dexamethasone results in increased expression of F2R mRNA; Dexamethasone results in increased expression of F2R more ... CTD PMID:11733402 F2r Rat dexamethasone affects expression EXP 6480464 Dexamethasone affects the expression of F2R protein CTD PMID:19969022 F2r Rat dextran sulfate multiple interactions ISO RGD:10556 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of F2R more ... CTD PMID:29950665 F2r Rat diallyl trisulfide decreases expression ISO RGD:735960 6480464 diallyl trisulfide results in decreased expression of F2R mRNA CTD PMID:34995734 F2r Rat diarsenic trioxide increases expression ISO RGD:735960 6480464 Arsenic Trioxide results in increased expression of F2R mRNA CTD PMID:22535156 F2r Rat Dibutyl phosphate affects expression ISO RGD:735960 6480464 di-n-butylphosphoric acid affects the expression of F2R mRNA CTD PMID:37042841 F2r Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of F2R mRNA CTD PMID:21266533 F2r Rat dibutyl phthalate increases expression ISO RGD:10556 6480464 Dibutyl Phthalate results in increased expression of F2R mRNA CTD PMID:17361019|PMID:21266533 F2r Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of F2R mRNA CTD PMID:15620428|PMID:21266533 F2r Rat dioxygen multiple interactions ISO RGD:735960 6480464 3,5-bis(2-fluorobenzylidene)piperidin-4-one inhibits the reaction [Oxygen deficiency results in increased expression of F2R mRNA]; Curcumin inhibits more ... CTD PMID:22535156|PMID:23452621 F2r Rat dioxygen increases expression ISO RGD:735960 6480464 Oxygen deficiency results in increased expression of F2R mRNA CTD PMID:23452621 F2r Rat diquat decreases expression ISO RGD:10556 6480464 Diquat results in decreased expression of F2R mRNA CTD PMID:36851058 F2r Rat diuron increases expression EXP 6480464 Diuron results in increased expression of F2R mRNA CTD PMID:21551480 F2r Rat doxorubicin affects expression ISO RGD:735960 6480464 Doxorubicin affects the expression of F2R mRNA CTD PMID:29803840 F2r Rat doxorubicin increases expression ISO RGD:735960 6480464 Doxorubicin results in increased expression of F2R mRNA CTD PMID:37062353 F2r Rat elemental selenium decreases expression ISO RGD:735960 6480464 Selenium results in decreased expression of F2R mRNA CTD PMID:19244175 F2r Rat elemental selenium multiple interactions ISO RGD:735960 6480464 [Selenium co-treated with Vitamin E] results in increased expression of F2R mRNA CTD PMID:19244175 F2r Rat epoxiconazole decreases expression ISO RGD:10556 6480464 epoxiconazole results in decreased expression of F2R mRNA CTD PMID:35436446 F2r Rat ethanol increases expression EXP 6480464 Ethanol results in increased expression of F2R mRNA CTD PMID:17920746 F2r Rat ethyl methanesulfonate increases expression ISO RGD:735960 6480464 Ethyl Methanesulfonate results in increased expression of F2R mRNA CTD PMID:23649840 F2r Rat etonogestrel multiple interactions EXP 6480464 Mifepristone inhibits the reaction [etonogestrel results in increased expression of F2R mRNA] CTD PMID:11733402 F2r Rat etonogestrel increases expression EXP 6480464 etonogestrel results in increased expression of F2R mRNA CTD PMID:11733402 F2r Rat etoposide affects response to substance ISO RGD:735960 6480464 F2R protein affects the susceptibility to Etoposide CTD PMID:16217747 F2r Rat fenamidone increases expression ISO RGD:10556 6480464 fenamidone results in increased expression of F2R mRNA CTD PMID:27029645 F2r Rat folic acid multiple interactions ISO RGD:10556 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of F2R mRNA; [Methionine deficiency co-treated more ... CTD PMID:20938992|PMID:22206623 F2r Rat folpet decreases expression ISO RGD:10556 6480464 folpet results in decreased expression of F2R mRNA CTD PMID:31558096 F2r Rat formaldehyde increases expression ISO RGD:735960 6480464 Formaldehyde results in increased expression of F2R mRNA CTD PMID:23649840 F2r Rat fulvestrant increases expression ISO RGD:735960 6480464 fulvestrant results in increased expression of F2R mRNA CTD PMID:12154049 F2r Rat genistein multiple interactions ISO RGD:735960 6480464 Genistein inhibits the reaction [Oxygen deficiency results in increased expression of F2R mRNA] CTD PMID:23452621 F2r Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of F2R mRNA CTD PMID:22061828 F2r Rat gestodene increases expression EXP 6480464 Gestodene results in increased expression of F2R mRNA CTD PMID:11733402 F2r Rat glucose decreases expression ISO RGD:735960 6480464 Glucose results in decreased expression of F2R mRNA CTD PMID:31655124 F2r Rat heparin multiple interactions ISO RGD:735960 6480464 Heparin inhibits the reaction [F2 protein results in increased cleavage of F2R protein] CTD PMID:19468011 F2r Rat hydrogen peroxide affects expression ISO RGD:735960 6480464 Hydrogen Peroxide affects the expression of F2R mRNA CTD PMID:20044591 F2r Rat hydrogen peroxide increases expression ISO RGD:735960 6480464 Hydrogen Peroxide results in increased expression of F2R mRNA CTD PMID:12419474 F2r Rat hydroquinone decreases expression ISO RGD:735960 6480464 hydroquinone results in decreased expression of F2R mRNA CTD PMID:31256213 F2r Rat inulin multiple interactions ISO RGD:10556 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of F2R mRNA CTD PMID:36331819 F2r Rat L-methionine multiple interactions ISO RGD:10556 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation more ... CTD PMID:20938992 F2r Rat lead diacetate decreases expression ISO RGD:10556 6480464 lead acetate results in decreased expression of F2R mRNA CTD PMID:22613225 F2r Rat lead diacetate decreases expression ISO RGD:735960 6480464 lead acetate results in decreased expression of F2R mRNA CTD PMID:38568856 F2r Rat lead(II) chloride multiple interactions ISO RGD:735960 6480464 [cadmium sulfate co-treated with cobaltous chloride co-treated with lead chloride] results in increased expression of more ... CTD PMID:18654764 F2r Rat lenalidomide decreases expression ISO RGD:735960 6480464 lenalidomide results in decreased expression of F2R mRNA; lenalidomide results in decreased expression of F2R more ... CTD PMID:15618473 F2r Rat Licochalcone B decreases expression ISO RGD:735960 6480464 licochalcone B results in decreased expression of F2R mRNA CTD PMID:33647349 F2r Rat lipopolysaccharide multiple interactions ISO RGD:735960 6480464 [S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of F2R mRNA; [S-(1,2-dichlorovinyl)cysteine more ... CTD PMID:35811015 F2r Rat medroxyprogesterone acetate increases expression ISO RGD:735960 6480464 Medroxyprogesterone Acetate results in increased expression of F2R protein CTD PMID:11733402 F2r Rat medroxyprogesterone acetate multiple interactions EXP 6480464 Mifepristone inhibits the reaction [Medroxyprogesterone Acetate results in increased expression of F2R mRNA] CTD PMID:11733402 F2r Rat medroxyprogesterone acetate increases expression EXP 6480464 Medroxyprogesterone Acetate results in increased expression of F2R mRNA; Medroxyprogesterone Acetate results in increased expression more ... CTD PMID:11733402 F2r Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of F2R mRNA CTD PMID:30047161 F2r Rat methylparaben decreases expression ISO RGD:735960 6480464 methylparaben results in decreased expression of F2R mRNA CTD PMID:31745603 F2r Rat mifepristone multiple interactions EXP 6480464 Mifepristone inhibits the reaction [Dexamethasone results in increased expression of F2R mRNA]; Mifepristone inhibits the more ... CTD PMID:11733402 F2r Rat mitomycin C affects response to substance ISO RGD:735960 6480464 F2R protein affects the susceptibility to Mitomycin CTD PMID:16217747 F2r Rat N-nitrosodimethylamine increases expression EXP 6480464 Dimethylnitrosamine results in increased expression of F2R mRNA CTD PMID:25380136 F2r Rat nicotinic acid increases expression ISO RGD:735960 6480464 Niacin results in increased expression of F2R protein CTD PMID:20539903 F2r Rat okadaic acid decreases expression ISO RGD:735960 6480464 Okadaic Acid results in decreased expression of F2R mRNA CTD PMID:38832940 F2r Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of F2R mRNA CTD PMID:25729387 F2r Rat ozone multiple interactions ISO RGD:10556 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased more ... CTD PMID:34911549 F2r Rat paracetamol increases response to substance ISO RGD:10556 6480464 F2R protein results in increased susceptibility to Acetaminophen CTD PMID:17654741 F2r Rat paraoxon multiple interactions ISO RGD:10556 6480464 [Paraoxon co-treated with Atropine co-treated with Obidoxime Chloride] results in increased expression of F2R protein CTD PMID:30515700 F2r Rat PCB138 multiple interactions ISO RGD:10556 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 F2r Rat pentachlorophenol decreases expression ISO RGD:10556 6480464 Pentachlorophenol results in decreased expression of F2R mRNA CTD PMID:23892564 F2r Rat perfluorononanoic acid decreases expression ISO RGD:735960 6480464 perfluoro-n-nonanoic acid results in decreased expression of F2R mRNA CTD PMID:32588087 F2r Rat perfluorooctane-1-sulfonic acid decreases expression EXP 6480464 perfluorooctane sulfonic acid results in decreased expression of F2R mRNA CTD PMID:20136073 F2r Rat perfluorooctane-1-sulfonic acid multiple interactions ISO RGD:10556 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of F2R mRNA; [perfluorooctane sulfonic more ... CTD PMID:36331819 F2r Rat phenobarbital multiple interactions ISO RGD:10556 6480464 NR1I3 protein affects the reaction [Phenobarbital results in increased expression of F2R mRNA] CTD PMID:19482888 F2r Rat phenobarbital affects expression ISO RGD:10556 6480464 Phenobarbital affects the expression of F2R mRNA CTD PMID:23091169 F2r Rat phenobarbital increases expression ISO RGD:10556 6480464 Phenobarbital results in increased expression of F2R mRNA CTD PMID:19482888 F2r Rat PhIP decreases expression ISO RGD:735960 6480464 2-amino-1-methyl-6-phenylimidazo(4,5-b)pyridine results in decreased expression of F2R mRNA CTD PMID:20816883 F2r Rat pirinixic acid decreases expression ISO RGD:10556 6480464 pirinixic acid results in decreased expression of F2R mRNA CTD PMID:17950772 F2r Rat pirinixic acid multiple interactions ISO RGD:10556 6480464 PPARA protein promotes the reaction [pirinixic acid results in decreased expression of F2R mRNA] CTD PMID:17950772 F2r Rat progesterone affects expression ISO RGD:10556 6480464 Progesterone affects the expression of F2R mRNA CTD PMID:17251523 F2r Rat progesterone increases expression EXP 6480464 Progesterone results in increased expression of F2R mRNA CTD PMID:11733402|PMID:21770760 F2r Rat progesterone multiple interactions ISO RGD:10556 6480464 [N3-cyclopropyl-7-((4-(1-methylethyl)phenyl)methyl)-7H-pyrrolo(3, 2-f)quinazoline-1,3-diamine binds to and results in decreased activity of F2R protein] which results in more ... CTD PMID:22207716 F2r Rat progesterone multiple interactions ISO RGD:735960 6480464 [C186 65 binds to and results in increased activity of F2R protein] inhibits the reaction more ... CTD PMID:22207716 F2r Rat propanal increases expression ISO RGD:735960 6480464 propionaldehyde results in increased expression of F2R mRNA CTD PMID:26079696 F2r Rat quercetin increases expression ISO RGD:735960 6480464 Quercetin results in increased expression of F2R mRNA CTD PMID:21632981 F2r Rat quinoline multiple interactions ISO RGD:735960 6480464 quinoline analog binds to and results in decreased activity of F2R protein CTD PMID:16380251 F2r Rat rac-lactic acid increases expression ISO RGD:735960 6480464 Lactic Acid results in increased expression of F2R mRNA CTD PMID:30851411 F2r Rat raloxifene increases expression ISO RGD:735960 6480464 Raloxifene Hydrochloride results in increased expression of F2R mRNA CTD PMID:12154049 F2r Rat rebaudioside A decreases expression ISO RGD:735960 6480464 rebaudioside A results in decreased expression of F2R mRNA CTD PMID:31655124 F2r Rat resveratrol multiple interactions ISO RGD:735960 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of F2R mRNA; Resveratrol inhibits the more ... CTD PMID:23452621|PMID:23557933 F2r Rat rotenone increases expression ISO RGD:10556 6480464 Rotenone results in increased expression of F2R mRNA CTD PMID:32937126 F2r Rat S-(1,2-dichlorovinyl)-L-cysteine decreases expression ISO RGD:735960 6480464 S-(1,2-dichlorovinyl)cysteine results in decreased expression of F2R mRNA CTD PMID:33725128|PMID:35811015 F2r Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO RGD:735960 6480464 [S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of F2R mRNA; [S-(1,2-dichlorovinyl)cysteine more ... CTD PMID:35811015 F2r Rat selenium atom decreases expression ISO RGD:735960 6480464 Selenium results in decreased expression of F2R mRNA CTD PMID:19244175 F2r Rat selenium atom multiple interactions ISO RGD:735960 6480464 [Selenium co-treated with Vitamin E] results in increased expression of F2R mRNA CTD PMID:19244175 F2r Rat silicon dioxide decreases expression EXP 6480464 Silicon Dioxide results in decreased expression of F2R mRNA CTD PMID:32721576 F2r Rat sodium arsenate increases expression ISO RGD:10556 6480464 sodium arsenate results in increased expression of F2R mRNA CTD PMID:21795629 F2r Rat sodium arsenate multiple interactions ISO RGD:735960 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in increased expression of F2R more ... CTD PMID:32525701 F2r Rat sodium arsenite increases expression ISO RGD:735960 6480464 sodium arsenite results in increased expression of F2R mRNA CTD PMID:12760830 F2r Rat sodium arsenite multiple interactions ISO RGD:735960 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of F2R more ... CTD PMID:39836092 F2r Rat sodium arsenite decreases expression ISO RGD:735960 6480464 sodium arsenite results in decreased expression of F2R mRNA CTD PMID:38568856 F2r Rat sodium fluoride increases expression ISO RGD:10556 6480464 Sodium Fluoride results in increased expression of F2R mRNA CTD PMID:27862939 F2r Rat steviol decreases expression ISO RGD:735960 6480464 steviol results in decreased expression of F2R mRNA CTD PMID:31655124 F2r Rat stevioside decreases expression ISO RGD:735960 6480464 stevioside results in decreased expression of F2R mRNA CTD PMID:31655124 F2r Rat sunitinib decreases expression ISO RGD:735960 6480464 Sunitinib results in decreased expression of F2R mRNA CTD PMID:31533062 F2r Rat tacrolimus hydrate decreases expression ISO RGD:10556 6480464 Tacrolimus results in decreased expression of F2R mRNA CTD PMID:25270620 F2r Rat tamoxifen multiple interactions ISO RGD:735960 6480464 ESR1 protein affects the reaction [Tamoxifen results in decreased expression of F2R mRNA] CTD PMID:14699072 F2r Rat tamoxifen affects expression ISO RGD:735960 6480464 Tamoxifen affects the expression of F2R mRNA CTD PMID:14699072 F2r Rat testosterone increases expression ISO RGD:10556 6480464 Testosterone results in increased expression of F2R mRNA CTD PMID:21669218 F2r Rat tetrachloromethane increases expression ISO RGD:10556 6480464 Carbon Tetrachloride results in increased expression of F2R mRNA CTD PMID:17484886 F2r Rat tetrachloromethane multiple interactions ISO RGD:10556 6480464 F2R protein affects the reaction [Carbon Tetrachloride results in increased expression of COL1A1 mRNA]; F2R more ... CTD PMID:17962354 F2r Rat thalidomide decreases expression ISO RGD:735960 6480464 Thalidomide results in decreased expression of F2R mRNA; Thalidomide results in decreased expression of F2R more ... CTD PMID:15618473 F2r Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of F2R mRNA CTD PMID:34492290 F2r Rat thiram decreases expression ISO RGD:735960 6480464 Thiram results in decreased expression of F2R mRNA CTD PMID:38568856 F2r Rat Thrombin multiple interactions ISO RGD:735960 6480464 Thrombin binds to and results in increased activity of [F2R protein binds to F2RL3 protein] CTD PMID:16505172 F2r Rat titanium dioxide multiple interactions ISO RGD:10556 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of F2R more ... CTD PMID:29950665 F2r Rat titanium dioxide affects methylation ISO RGD:10556 6480464 titanium dioxide affects the methylation of F2R gene CTD PMID:35295148 F2r Rat titanium dioxide decreases methylation ISO RGD:10556 6480464 titanium dioxide results in decreased methylation of F2R promoter CTD PMID:35295148 F2r Rat topotecan increases expression EXP 6480464 Topotecan results in increased expression of F2R mRNA CTD PMID:25729387 F2r Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of F2R mRNA CTD PMID:25729387 F2r Rat trichostatin A increases expression ISO RGD:735960 6480464 trichostatin A results in increased expression of F2R mRNA CTD PMID:24935251 F2r Rat triphenyl phosphate affects expression ISO RGD:735960 6480464 triphenyl phosphate affects the expression of F2R mRNA CTD PMID:37042841 F2r Rat troglitazone decreases expression ISO RGD:10556 6480464 troglitazone results in decreased expression of F2R mRNA CTD PMID:28973697 F2r Rat tropan-3alpha-yl 3-hydroxy-2-phenylpropanoate multiple interactions ISO RGD:10556 6480464 [Paraoxon co-treated with Atropine co-treated with Obidoxime Chloride] results in increased expression of F2R protein CTD PMID:30515700 F2r Rat tunicamycin decreases expression ISO RGD:735960 6480464 Tunicamycin results in decreased expression of F2R mRNA CTD PMID:22378314 F2r Rat valproic acid decreases expression ISO RGD:10556 6480464 Valproic Acid analog results in decreased expression of F2R mRNA; Valproic Acid results in decreased more ... CTD PMID:20546886|PMID:21427059 F2r Rat valproic acid increases expression ISO RGD:735960 6480464 Valproic Acid results in increased expression of F2R mRNA CTD PMID:24935251|PMID:27188386 F2r Rat valproic acid affects expression ISO RGD:735960 6480464 Valproic Acid affects the expression of F2R mRNA CTD PMID:25979313 F2r Rat vancomycin decreases expression ISO RGD:10556 6480464 Vancomycin results in decreased expression of F2R mRNA CTD PMID:18930951 F2r Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of F2R mRNA CTD PMID:22570695 F2r Rat vitamin E decreases expression ISO RGD:735960 6480464 Vitamin E results in decreased expression of F2R mRNA CTD PMID:19244175 F2r Rat vitamin E multiple interactions ISO RGD:735960 6480464 [Selenium co-treated with Vitamin E] results in increased expression of F2R mRNA CTD PMID:19244175
Imported Annotations - KEGG (archival)
(1->4)-beta-D-glucan (ISO) 1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO) 1,2-dimethylhydrazine (ISO) 1-naphthyl isothiocyanate (EXP,ISO) 17beta-estradiol (EXP,ISO) 17beta-hydroxy-5alpha-androstan-3-one (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (ISO) 2,4,4'-trichlorobiphenyl (ISO) 2-hydroxypropanoic acid (ISO) 3',5'-cyclic AMP (ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP) 3-chloropropane-1,2-diol (EXP) 4,4'-diaminodiphenylmethane (EXP,ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxynon-2-enal (ISO) 4-hydroxyphenyl retinamide (ISO) 5-aza-2'-deoxycytidine (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) acetylsalicylic acid (ISO) acrylamide (EXP) aflatoxin B1 (EXP,ISO) aldehydo-D-glucose (ISO) aldosterone (EXP) all-trans-retinoic acid (ISO) amitrole (EXP) ammonium chloride (EXP) arsane (ISO) arsenic atom (ISO) arsenous acid (ISO) atropine (ISO) avobenzone (ISO) Azoxymethane (ISO) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (EXP) bisphenol A (EXP) bivalirudin (ISO) butanal (ISO) C60 fullerene (EXP) cadmium dichloride (EXP,ISO) cadmium sulfate (ISO) calciol (ISO) calcium atom (ISO) calcium(0) (ISO) carbon nanotube (ISO) chloropicrin (ISO) chlorpyrifos (EXP) choline (ISO) cisplatin (ISO) clopidogrel (ISO) cobalt dichloride (ISO) colforsin daropate hydrochloride (ISO) copper atom (ISO) copper(0) (ISO) copper(II) chloride (ISO) copper(II) sulfate (ISO) coumestrol (ISO) crocidolite asbestos (ISO) Cuprizon (EXP) curcumin (ISO) cyclosporin A (ISO) D-glucose (ISO) dexamethasone (EXP,ISO) dextran sulfate (ISO) diallyl trisulfide (ISO) diarsenic trioxide (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP,ISO) dioxygen (ISO) diquat (ISO) diuron (EXP) doxorubicin (ISO) elemental selenium (ISO) epoxiconazole (ISO) ethanol (EXP) ethyl methanesulfonate (ISO) etonogestrel (EXP) etoposide (ISO) fenamidone (ISO) folic acid (ISO) folpet (ISO) formaldehyde (ISO) fulvestrant (ISO) genistein (ISO) gentamycin (EXP) gestodene (EXP) glucose (ISO) heparin (ISO) hydrogen peroxide (ISO) hydroquinone (ISO) inulin (ISO) L-methionine (ISO) lead diacetate (ISO) lead(II) chloride (ISO) lenalidomide (ISO) Licochalcone B (ISO) lipopolysaccharide (ISO) medroxyprogesterone acetate (EXP,ISO) methimazole (EXP) methylparaben (ISO) mifepristone (EXP) mitomycin C (ISO) N-nitrosodimethylamine (EXP) nicotinic acid (ISO) okadaic acid (ISO) oxaliplatin (EXP) ozone (ISO) paracetamol (ISO) paraoxon (ISO) PCB138 (ISO) pentachlorophenol (ISO) perfluorononanoic acid (ISO) perfluorooctane-1-sulfonic acid (EXP,ISO) phenobarbital (ISO) PhIP (ISO) pirinixic acid (ISO) progesterone (EXP,ISO) propanal (ISO) quercetin (ISO) quinoline (ISO) rac-lactic acid (ISO) raloxifene (ISO) rebaudioside A (ISO) resveratrol (ISO) rotenone (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) selenium atom (ISO) silicon dioxide (EXP) sodium arsenate (ISO) sodium arsenite (ISO) sodium fluoride (ISO) steviol (ISO) stevioside (ISO) sunitinib (ISO) tacrolimus hydrate (ISO) tamoxifen (ISO) testosterone (ISO) tetrachloromethane (ISO) thalidomide (ISO) thioacetamide (EXP) thiram (ISO) Thrombin (ISO) titanium dioxide (ISO) topotecan (EXP) trichostatin A (ISO) triphenyl phosphate (ISO) troglitazone (ISO) tropan-3alpha-yl 3-hydroxy-2-phenylpropanoate (ISO) tunicamycin (ISO) valproic acid (ISO) vancomycin (ISO) vinclozolin (EXP) vitamin E (ISO)
Biological Process
blood coagulation (IEA) cell-cell junction maintenance (IEA,ISO) connective tissue replacement involved in inflammatory response wound healing (IEA,ISO,ISS) dendritic cell homeostasis (IEA,ISO) establishment of synaptic specificity at neuromuscular junction (IDA) G protein-coupled receptor signaling pathway (IDA,IEA) hemostasis (IEA) homeostasis of number of cells within a tissue (IEA,ISO,ISS) inflammatory response (IEA,ISO,ISS) negative regulation of cell population proliferation (IEA,ISO,ISS) negative regulation of glomerular filtration (IDA) negative regulation of neuron apoptotic process (IMP) negative regulation of renin secretion into blood stream (IEA,ISO,ISS) phospholipase C-activating G protein-coupled receptor signaling pathway (IBA,IEA,IMP,ISO) platelet activation (IEA,ISO,ISS) positive regulation of apoptotic process (IEA,ISO,ISS) positive regulation of blood coagulation (IBA,IEA,ISO,ISS) positive regulation of calcium ion transport (IMP) positive regulation of canonical NF-kappaB signal transduction (IEA,ISO,ISS) positive regulation of cell migration (IEA,ISO,ISS) positive regulation of cell population proliferation (IDA) positive regulation of collagen biosynthetic process (IEA,ISO,ISS) positive regulation of cytosolic calcium ion concentration (IEA,ISO,ISS) positive regulation of DNA-templated transcription (IEA,ISO,ISS) positive regulation of ERK1 and ERK2 cascade (IEA,ISO,ISS) positive regulation of interleukin-6 production (IEA,ISO,ISS) positive regulation of interleukin-8 production (IEA,ISO,ISS) positive regulation of MAPK cascade (IEA,IMP,ISO,ISS) positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction (IEA,ISO,ISS) positive regulation of receptor signaling pathway via JAK-STAT (ISS) positive regulation of release of sequestered calcium ion into cytosol (IEA,ISO,ISS) positive regulation of Rho protein signal transduction (IEA,ISO,ISS) positive regulation of smooth muscle contraction (IDA) positive regulation of vasoconstriction (IDA,IEA,ISO) regulation of biological quality (IEA) regulation of blood coagulation (IEA,ISO) regulation of interleukin-1 beta production (IEA,ISO,ISS) regulation of synaptic plasticity (IEA,ISO,ISS) release of sequestered calcium ion into cytosol (IMP) response to lipopolysaccharide (IEA,ISO,ISS) response to wounding (IEA,ISO,ISS) signal transduction (IEA) thrombin-activated receptor signaling pathway (IEA,ISO,ISS) trans-synaptic signaling by endocannabinoid, modulating synaptic transmission (IEA,ISO)
Cellular Component
caveola (IEA,ISO,ISS) cell surface (IEA,ISO) early endosome (IEA,ISO) late endosome (IEA,ISO) membrane (IEA) neuromuscular junction (IDA) plasma membrane (IBA,IDA,IEA,ISO) platelet dense tubular network (IEA,ISO,ISS) postsynaptic membrane (IDA) synapse (IEA)
Molecular Function
G protein-coupled receptor activity (IEA,ISO,ISS) G-protein alpha-subunit binding (IEA,ISO,ISS) G-protein beta-subunit binding (IEA,ISO,ISS) protein binding (ISO) signaling receptor binding (IEA,ISO) thrombin-activated receptor activity (IBA,IEA,ISO,ISS,TAS)
1.
Development of proteinase-activated receptor 1 antagonists as therapeutic agents for thrombosis, restenosis and inflammatory diseases.
Ahn HS, etal., Curr Pharm Des. 2003;9(28):2349-65.
2.
Proteinase-activated receptor-1 agonists attenuate nociception in response to noxious stimuli.
Asfaha S, etal., Br J Pharmacol. 2002 Mar;135(5):1101-6.
3.
Mechanisms of anticoagulant and cytoprotective actions of the protein C pathway.
Bouwens EA, etal., J Thromb Haemost. 2013 Jun;11 Suppl 1:242-53. doi: 10.1111/jth.12247.
4.
Vascular thrombin receptor regulation in hypertensive rats.
Capers Q 4th, etal., Circ Res. 1997 Jun;80(6):838-44.
5.
Protease-activated receptor 1 suppresses Helicobacter pylori gastritis via the inhibition of macrophage cytokine secretion and interferon regulatory factor 5.
Chionh YT, etal., Mucosal Immunol. 2015 Jan;8(1):68-79. doi: 10.1038/mi.2014.43. Epub 2014 May 28.
6.
Thrombin inhibits NMDA-mediated nociceptive activity in the mouse: possible mediation by endothelin.
Fang M, etal., J Physiol. 2003 Jun 15;549(Pt 3):903-17. Epub 2003 Apr 25.
7.
Cross Talk Pathways Between Coagulation and Inflammation.
Foley JH and Conway EM, Circ Res. 2016 Apr 29;118(9):1392-408. doi: 10.1161/CIRCRESAHA.116.306853.
8.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
9.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
10.
Bidirectional regulation of renal hemodynamics by activation of PAR1 and PAR2 in isolated perfused rat kidney.
Gui Y, etal., Am J Physiol Renal Physiol. 2003 Jul;285(1):F95-104. Epub 2003 Mar 18.
11.
Thrombin-receptor activation and thrombin-induced brain tolerance.
Jiang Y, etal., J Cereb Blood Flow Metab. 2002 Apr;22(4):404-10.
12.
A protective role of protease-activated receptor 1 in rat gastric mucosa.
Kawabata A, etal., Gastroenterology. 2004 Jan;126(1):208-19.
13.
Receptor-activating peptides for PAR-1 and PAR-2 relax rat gastric artery via multiple mechanisms.
Kawabata A, etal., Life Sci. 2004 Oct 15;75(22):2689-702.
14.
The PAR-1-activating peptide attenuates carrageenan-induced hyperalgesia in rats.
Kawabata A, etal., Peptides. 2002 Jun;23(6):1181-3.
15.
High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.
Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
16.
Role and expression of thrombin receptor PAR-1 in muscle cells and neuromuscular junctions during the synapse elimination period in the neonatal rat.
Lanuza MA, etal., J Neurosci Res. 2003 Jul 1;73(1):10-21.
17.
Thrombin receptor: An endogenous inhibitor of inflammatory pain, activating opioid pathways.
Martin L, etal., Pain. 2009 Nov;146(1-2):121-9. doi: 10.1016/j.pain.2009.07.016. Epub 2009 Aug 11.
18.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
19.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
20.
Thrombin receptor expression in normal and atherosclerotic human arteries.
Nelken NA, etal., J Clin Invest. 1992 Oct;90(4):1614-21.
21.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
22.
GOA pipeline
RGD automated data pipeline
23.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
24.
Increase of prothrombin-mRNA after global cerebral ischemia in rats, with constant expression of protease nexin-1 and protease-activated receptors.
Riek-Burchardt M, etal., Neurosci Lett 2002 Aug 30;329(2):181-4.
25.
Protease-activated receptor subtype expression in developing eye and adult retina of the rat after optic nerve crush.
Rohatgi T, etal., J Neurosci Res 2003 Jul 15;73(2):246-54.
26.
Transient focal ischemia in rat brain differentially regulates mRNA expression of protease-activated receptors 1 to 4.
Rohatgi T, etal., J Neurosci Res 2004 Jan 15;75(2):273-9.
27.
Proteinase-activated receptor (PAR)-1 and -2 agonists induce mediator release from mast cells by pathways distinct from PAR-1 and PAR-2.
Stenton GR, etal., J Pharmacol Exp Ther 2002 Aug;302(2):466-74.
28.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
29.
Thrombin (PAR-1)-induced proliferation in astrocytes via MAPK involves multiple signaling pathways.
Wang H, etal., Am J Physiol Cell Physiol 2002 Nov;283(5):C1351-64.
30.
Deficiency of microvascular thrombomodulin and up-regulation of protease-activated receptor-1 in irradiated rat intestine: possible link between endothelial dysfunction and chronic radiation fibrosis.
Wang J, etal., Am J Pathol 2002 Jun;160(6):2063-72.
31.
Expression of thrombin receptors in endothelial cells and neutrophils from normal and preeclamptic pregnancies.
Wang Y, etal., J Clin Endocrinol Metab. 2002 Aug;87(8):3728-34.
32.
Expression of protease-activated receptors (PARs) in OLN-93 oligodendroglial cells and mechanism of PAR-1-induced calcium signaling.
Wang Y, etal., Neuroscience. 2004;126(1):69-82.
33.
Time course of upregulation of inflammatory mediators in the hemorrhagic brain in rats: correlation with brain edema.
Wu H, etal., Neurochem Int. 2010 Oct;57(3):248-53. Epub 2010 Jun 10.
34.
Molecular cloning of the rat vascular smooth muscle thrombin receptor. Evidence for in vitro regulation by basic fibroblast growth factor.
Zhong C, etal., J Biol Chem 1992 Aug 25;267(24):16975-9.
F2r (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 28,604,066 - 28,620,579 (-) NCBI GRCr8 mRatBN7.2 2 26,869,343 - 26,885,856 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 26,868,404 - 26,885,870 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 33,907,656 - 33,924,163 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 32,007,753 - 32,024,260 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 26,823,845 - 26,840,377 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 26,118,760 - 26,135,340 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 26,118,760 - 26,135,340 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 45,254,489 - 45,257,761 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 25,985,800 - 25,989,072 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 25,906,181 - 25,909,441 (-) NCBI Celera 2 22,933,182 - 22,949,696 (-) NCBI Celera RH 3.4 Map 2 13.3 RGD Cytogenetic Map 2 q12 NCBI
F2R (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 5 76,716,126 - 76,735,770 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 5 76,716,126 - 76,735,770 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 5 76,011,951 - 76,031,595 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 5 76,047,542 - 76,067,054 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 5 76,047,546 - 76,067,054 NCBI Celera 5 71,905,802 - 71,925,529 (+) NCBI Celera Cytogenetic Map 5 q13.3 NCBI HuRef 5 71,219,384 - 71,239,536 (+) NCBI HuRef CHM1_1 5 75,445,069 - 75,464,798 (+) NCBI CHM1_1 T2T-CHM13v2.0 5 77,198,009 - 77,217,657 (+) NCBI T2T-CHM13v2.0
F2r (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 13 95,738,288 - 95,754,974 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 13 95,738,311 - 95,754,995 (-) Ensembl GRCm39 Ensembl GRCm38 13 95,601,780 - 95,618,466 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 13 95,601,803 - 95,618,487 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 13 96,371,744 - 96,388,388 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 13 96,702,488 - 96,719,132 (-) NCBI MGSCv36 mm8 Celera 13 99,218,583 - 99,235,265 (-) NCBI Celera Cytogenetic Map 13 D1 NCBI cM Map 13 50.21 NCBI
F2r (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955425 24,144,905 - 24,164,498 (-) NCBI ChiLan1.0 ChiLan1.0
F2R (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 3 29,870,159 - 29,889,837 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 3 29,872,155 - 29,889,687 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 3 31,109,597 - 31,128,481 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 3 29,789,482 - 29,809,069 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 3 29,789,492 - 29,813,913 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 3 29,726,270 - 29,745,147 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 3 29,706,677 - 29,725,998 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 3 30,076,456 - 30,095,361 (-) NCBI UU_Cfam_GSD_1.0
F2r (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
F2R (Sus scrofa - pig)
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 2 85,641,474 - 85,656,636 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 2 85,642,794 - 85,659,133 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 2 87,279,785 - 87,296,140 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
F2R (Chlorocebus sabaeus - green monkey)
Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 4 70,992,406 - 71,010,512 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 4 70,992,477 - 71,009,456 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666049 19,823,537 - 19,842,658 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
F2r (Heterocephalus glaber - naked mole-rat)
.
Predicted Target Of
Count of predictions: 102 Count of miRNA genes: 85 Interacting mature miRNAs: 90 Transcripts: ENSRNOT00000074626 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
10755430 Coatc6 Coat color QTL 6 0.02576 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 2 11591100 56591100 Rat 7387318 Stl32 Serum triglyceride level QTL 32 3.2 0.0003 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 2 22384627 67384627 Rat 631682 Bp115 Blood pressure QTL 115 4.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 1 37410502 Rat 10755499 Bp389 Blood pressure QTL 389 2.61 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 18960362 228801039 Rat 738010 Lnnr3 Liver neoplastic nodule remodeling QTL 3 2.94 liver integrity trait (VT:0010547) liver remodeling tumorous lesion number (CMO:0001461) 2 1 41244106 Rat 1358917 Cm42 Cardiac mass QTL 42 2.82 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 731167 Glom4 Glomerulus QTL 4 2.4 0.0082 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002) 2 20304672 65304672 Rat 1358913 Cm41 Cardiac mass QTL 41 2.73 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 738012 Anxrr3 Anxiety related response QTL 3 3.8 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 2 9023519 54023519 Rat 1302794 Stl27 Serum triglyceride level QTL 27 4.4 0.0001 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 2 25413423 143657569 Rat 10402051 Gdil2 Gastrointestinal dilation QTL 2 enteric ganglion morphology trait (VT:0001045) length of intestine affected by colonic aganglionosis to total length of colon ratio (CMO:0001836) 2 24903853 74786777 Rat 1358901 Cm38 Cardiac mass QTL 38 2 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 157142209 Rat 1600379 Mcs18 Mammary carcinoma susceptibility QTL 18 2.6 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 2 7887772 42804738 Rat 1358899 Kidm23 Kidney mass QTL 23 3.88 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 1358908 Bw49 Body weight QTL 49 3.36 body mass (VT:0001259) body weight (CMO:0000012) 2 25413652 157142078 Rat 1358910 Kidm27 Kidney mass QTL 27 5.77 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 61355 Bp36 Blood pressure QTL 36 2.9 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 2 5873687 102844969 Rat 2300168 Bmd47 Bone mineral density QTL 47 6.6 0.0001 femur mineral mass (VT:0010011) bone mineral density (CMO:0001226) 2 20662448 65662448 Rat 1358911 Kidm28 Kidney mass QTL 28 5.42 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 1358904 Cm39 Cardiac mass QTL 39 2.26 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 157142209 Rat 1578664 Bmd9 Bone mineral QTL density 9 5 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 2 11852062 49003364 Rat 1357990 Ael1 Aortic elastin QTL 1 3.1 0.00091 aorta elastin amount (VT:0003905) aortic elastin 2 19076825 64076825 Rat 1358887 Bw50 Body weight QTL 50 2.39 body mass (VT:0001259) body weight (CMO:0000012) 2 25413652 157142078 Rat 1358894 Kidm24 Kidney mass QTL 24 4.03 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 731184 Mamtr4 Mammary tumor resistance QTL 4 0.0003 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 2 16491740 61491740 Rat
RH94524
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 26,870,257 - 26,870,436 (+) MAPPER mRatBN7.2 Rnor_6.0 2 26,119,675 - 26,119,853 NCBI Rnor6.0 Rnor_5.0 2 45,255,404 - 45,255,582 UniSTS Rnor5.0 RGSC_v3.4 2 25,986,715 - 25,986,893 UniSTS RGSC3.4 Celera 2 22,934,097 - 22,934,275 UniSTS RH 3.4 Map 2 13.3 UniSTS Cytogenetic Map 2 q12 UniSTS
RH140970
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 26,869,682 - 26,869,867 (+) MAPPER mRatBN7.2 Rnor_6.0 2 26,119,100 - 26,119,284 NCBI Rnor6.0 Rnor_5.0 2 45,254,829 - 45,255,013 UniSTS Rnor5.0 RGSC_v3.4 2 25,986,140 - 25,986,324 UniSTS RGSC3.4 Celera 2 22,933,522 - 22,933,706 UniSTS RH 3.4 Map 2 13.3 UniSTS Cytogenetic Map 2 q12 UniSTS
PMC156147P9
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 26,871,915 - 26,872,025 (+) MAPPER mRatBN7.2 Rnor_6.0 2 26,121,333 - 26,121,442 NCBI Rnor6.0 Rnor_5.0 2 45,257,062 - 45,257,171 UniSTS Rnor5.0 RGSC_v3.4 2 25,988,373 - 25,988,482 UniSTS RGSC3.4 Celera 2 22,935,755 - 22,935,864 UniSTS Cytogenetic Map 2 q12 UniSTS
This gene F2r is modified in the following models/strains:
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000074626 ⟹ ENSRNOP00000065624
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 26,868,404 - 26,885,870 (-) Ensembl Rnor_6.0 Ensembl 2 26,118,760 - 26,135,340 (-) Ensembl
RefSeq Acc Id:
NM_012950 ⟹ NP_037082
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 28,604,066 - 28,620,579 (-) NCBI mRatBN7.2 2 26,869,343 - 26,885,856 (-) NCBI Rnor_6.0 2 26,118,760 - 26,135,340 (-) NCBI Rnor_5.0 2 45,254,489 - 45,257,761 (-) NCBI RGSC_v3.4 2 25,985,800 - 25,989,072 (-) RGD Celera 2 22,933,182 - 22,949,696 (-) RGD
Sequence:
GAACGAGCTGCTCCTAAGAAAGTAGGCGACCGCGGTCGCCGGGCCGCGCGGGCAGCCTCGGGACAATGGGGCCCCGGCGCTTGCTGCTCGTCGCGGTCGGCCTCAGCCTGTGCGGTCCTTTGCTGTCT TCCCGCGTTCCTATGAGACAGCCAGAATCTGAGAGGATGTATGCTACGCCGTATGCTACGCCAAACCCCCGCTCATTTTTTCTCAGGAATCCCAGTGAAGATACATTTGAACAGTTCCCCCTAGGGGA TGAGGAGGAGAAAAATGAAAGCATACCGCTCGAGGGCAGGGCAGTCTACTTAAATAAAAGCCGTTTTCCTCCCATGCCGCCTCCTCCCTTCATCTCCGAGGACGCCTCCGGATATCTGACCAGCCCCT GGCTGACGCTCTTCATACCCTCCGTGTACACGTTTGTGTTCATAGTCAGCCTTCCCCTGAACATCCTGGCCATCGCTGTGTTTGTCTTTCGGATGAAGGTCAAGAAGCCGGCCGTGGTGTACATGCTG CACCTGGCCATGGCCGATGTCCTCTTCGTGTCCGTGCTCCCCTTCAAGATCAGCTACTACTTCTCCGGCACCGATTGGCAGTTCGGGTCCGGAATGTGTCGCTTCGCCACCGCAGCGTTTTATTGTAA CATGTACGCCTCCATCATGCTCATGACAGTCATAAGCATTGACCGGTTCCTGGCAGTGGTGTACCCCATCCAGTCCCTGTCCTGGCGCACTCTGGGCCGAGCCAACTTCACCTGCGTGGTCATCTGGG TGATGGCCATCATGGGGGTGGTGCCCCTCCTCCTCAAAGAGCAGACCACCCAGGTTCCGGGGCTCAACATCACCACCTGCCACGACGTCCTCAACGAGACCCTGCTGCATGGCTTTTACTCGTACTAT TTCTCCGCCTTCTCCGCCATCTTCTTTCTTGTGCCGTTGATCATTTCCACAGTCTGCTACACGTCCATCATCCGATGCCTCAGCTCCTCCGCGGTGGCGAACCGGAGCAAGAAGTCGCGGGCTTTGTT CCTGTCCGCCGCCGTGTTCTGCATCTTCATCGTCTGCTTTGGGCCCACCAACGTCCTCCTGATTGTGCACTACCTGCTCCTCTCCGACAGTCCTGGCACAGAGACGGCCTATTTTGCTTACCTCCTCT GCGTCTGCGTGAGCAGCGTGAGCTGCTGCATCGACCCCTTGATTTACTACTATGCCTCCTCCGAGTGCCAGAAGCACCTTTACAGCATTTTGTGCTGCAGAGAAAGCTCTGATTCCAACAGTTGCAAC AGCACCGGCCAGCTGATGCCCAGTAAGATGGATACCTGCTCTAGCCACCTGAATAATAGCATATACAAAAAGCTACTAGCTTAGGGAAAGGGTGGCTGGAAGGTTCCATGAAGAAAAGGTTGGAAAGT GAACAGCTGGGGAACCCCCATCAGTCCCTGGCAAGAACTGTATTGACTTCAACGCCTTAAGAAAACCGCCAACGTCTGATTTGCATGCATACTTCTTACAAGTGCTATCAAGTGTATAGATTGGATAA TCACCAGCAAGGTGATGGGAACGGAGTCAAGGTTTCCAGTGTTGCTTAGTGCTGGGATAGTAGTTGAGCGTCACCTCTTCTATATCTAGGTGACTTTAACATACAGGTGGTGTGCACACACACAGTGG CAGTGCAGGGTGGATTCTGCGCTTTGACGCTTTCTTGTTTATTCCCTGGCAGTTGCTATAGAAATAATCTGATTCTCTGACTTAATAAAGTCTGGGTTGGTGGATGCTAGCCCTGGGCAGCTGAAGAC CCCAGTGATAGGGAAGAAGCCCATAGTTTAGACTTAAGACAGCTTTTGCCTATGTGTCTATATTTATATATTTTCAAATTATTTGATAGTAATGTTTAGTGATGGAAGGATGAGACAGTATTACCTGT GTAGGGGAAGGTCTTGAACAACCACAGTTTAAGAATTATCAAAGCAGTTGAAAAGCCCCGTTTTGATACGCAATTTACTTACAAAATACGTGGACCAAGACTGAGCATAAGACTCGCCAGGAATGTAA GAAACCTTTCAAAGCAGCCAAGCCTGATAACTAGACACAGCCATCTGCATGGAGGCCTCTGAGCATGAGGTATATCATACCCCTTCAGCTATGCCTCCCAGAGAGCAGAGATGAGGACCACCAGGCCC ACTCCACCCTGCTAGGGGTCTCATTTGCTGTGAACTGATTATGTCAATTAGAAATTGGCAAGGGAGGGGATGCCATCTTGGGAGGCAATAACACCTGCACATCTGACAATCGGAGAAAGGTGTGTTTA CATCCAGCAGCTGTCCCGCAAGGCTGGCCCTTGCACAGACAGACACACCCATGTGCCCTGGTCACACTGTTGGATAGTGGGCCGTAGACTGACTGACTGTCGGAGAATAGCTGAGTCCTGCCCTTACT CAGGCAGCGCAGAGAGCTGGCACACGGTCAGCTGTGACGTATGCGCTGCAAACCATCGCACATAGAAGTTGTCATTAGCTGGATGTCACCAAGCATATGTCACACAAGCACGGCCTATCAGCTAAACC GCTTTGGATATCTGAGTCTCTGCTTCCGGTAACTATAGATTGGGATAAAGACACAATACAAGATGTATATTTTTAATACATAAGCCCTTCAGTCTACAATAATTAGATGCTATTTATTTACAAATGTT TTGTTAAAAATTACTCAGATCAGCCTGGCATTTTGTCGCATGCCTTTAAGCCCAGTAGGTGGGAGGCAGAGGCAGTCAGATGGTAAACAACTTTTTTTTTTTTGTTCTTTTTTTCAGAGCTGGGGACC GAACCCAGGACCTTGTGCTTGCTCGGCAAGTGCTCTACCACTGAGCTAAATCCCCAACCCCGGTAAACAACTTTTTTAAGAAGCAAGCAAACACACTGAAGTCCAGTTTTAAGAAATATATAGGTCAG TTTGGTTAAAAATAATAATAATGAAAGGAAATTTCATTGATTGAAATTGATTGCAATGTAGGAAAATTAGCCTGTATTTCTCTCAAGAGTTACTGAAGTTGTTTTTAAAGTCTTTTAATGCCACAGTG ACTAACAAGCATATAAAAATCTTCATGCCTTTGACAAATTAATTTAGAAGTTAATTTAAAACATATCCTTTTCCTGGTTAAAAAAATATGTTGGCATTTTAAGCAGATAAGACTAGAAAGTATTTAAG AAAACAAAGTATTTCCCAATACTGTAGAATAGCTTCCATGAAACTCCCCTAGTTGTCTGGTTAACTCTGTTCCTGTGTTGATTTATCTAAATCATTGACTCCCTGTCCTGTGCTCTGTGACTTAACGT AACTGTTACCACTGCACTTGTGAACTTTCGTGTCATTGTTTTGTGTTCACCCTCTTTTTTTAAAAAATATATTAATAAACTAAAAACCTGCTTGGAAAAAAAAAAAAAAAAAAA
hide sequence
RefSeq Acc Id:
NP_037082 ⟸ NM_012950
- Peptide Label:
precursor
- UniProtKB:
P26824 (UniProtKB/Swiss-Prot), Q5U324 (UniProtKB/TrEMBL), M0R834 (UniProtKB/TrEMBL), A0A9K3Y7Y4 (UniProtKB/TrEMBL)
- Sequence:
MGPRRLLLVAVGLSLCGPLLSSRVPMRQPESERMYATPYATPNPRSFFLRNPSEDTFEQFPLGDEEEKNESIPLEGRAVYLNKSRFPPMPPPPFISEDASGYLTSPWLTLFIPSVYTFVFIVSLPLNI LAIAVFVFRMKVKKPAVVYMLHLAMADVLFVSVLPFKISYYFSGTDWQFGSGMCRFATAAFYCNMYASIMLMTVISIDRFLAVVYPIQSLSWRTLGRANFTCVVIWVMAIMGVVPLLLKEQTTQVPGL NITTCHDVLNETLLHGFYSYYFSAFSAIFFLVPLIISTVCYTSIIRCLSSSAVANRSKKSRALFLSAAVFCIFIVCFGPTNVLLIVHYLLLSDSPGTETAYFAYLLCVCVSSVSCCIDPLIYYYASSE CQKHLYSILCCRESSDSNSCNSTGQLMPSKMDTCSSHLNNSIYKKLLA
hide sequence
Ensembl Acc Id:
ENSRNOP00000065624 ⟸ ENSRNOT00000074626
RGD ID: 13691077
Promoter ID: EPDNEW_R1602
Type: multiple initiation site
Name: F2r_1
Description: coagulation factor II receptor
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Experiment Methods: Single-end sequencing.
Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 2 26,135,365 - 26,135,425 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2004-09-10
F2r
coagulation factor II (thrombin) receptor
coagulation factor II receptor
Name updated
1299863
APPROVED
2002-11-06
F2r
coagulation factor II receptor
Coagulation factor II (thrombin) receptor
Name updated
625702
APPROVED
2001-10-23
F2r
Coagulation factor II (thrombin) receptor
Name updated to reflect Human and Mouse nomenclature
68913
APPROVED
2001-10-23
F2r
Thrombin receptor
Name withdrawn
68913
WITHDRAWN