Advanced Search (OLGA)

Gene: Tbk1 (TANK-binding kinase 1) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Tbk1

Name:

TANK-binding kinase 1

RGD ID:

1588588

Description:

Predicted to enable several functions, including identical protein binding activity; protein kinase activity; and protein phosphatase binding activity. Predicted to be involved in several processes, including positive regulation of defense response; protein phosphorylation; and regulation of signal transduction. Predicted to act upstream of or within defense response to Gram-positive bacterium; dendritic cell proliferation; and positive regulation of interferon-beta production. Predicted to be located in nucleoplasm. Predicted to be active in cytosol. Human ortholog(s) of this gene implicated in brain disease and frontotemporal dementia and/or amyotrophic lateral sclerosis 4. Orthologous to human TBK1 (TANK binding kinase 1); PARTICIPATES IN Toll-like receptor signaling pathway; hepatitis C pathway; influenza A pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 3H-1,2-dithiole-3-thione; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC299827; serine/threonine-protein kinase TBK1; similar to TANK-binding kinase 1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	TBK1 (TANK binding kinase 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Tbk1 (TANK-binding kinase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Tbk1 (TANK binding kinase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	TBK1 (TANK binding kinase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	TBK1 (TANK binding kinase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Tbk1 (TANK binding kinase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	TBK1 (TANK binding kinase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	TBK1 (TANK binding kinase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Tbk1 (TANK binding kinase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	TBK1 (TANK binding kinase 1)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Tbk1 (TANK-binding kinase 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	tbk1 (TANK-binding kinase 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	IKKepsilon	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	tbk1	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	58,963,319 - 58,996,357 (-)	NCBI		GRCr8
mRatBN7.2	7	57,077,830 - 57,110,868 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	57,077,830 - 57,110,892 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	58,989,079 - 59,022,620 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	61,191,956 - 61,225,497 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	60,969,664 - 61,003,205 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	63,655,247 - 63,687,978 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	63,655,247 - 63,687,978 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	63,877,567 - 63,910,298 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	60,863,099 - 60,896,131 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	7	53,819,361 - 53,852,262 (-)	NCBI		Celera
Cytogenetic Map	7	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Tbk1	Rat	amyotrophic lateral sclerosis		ISO	TBK1 (Homo sapiens)	8554872	ClinVar more ...	ClinVar	PMID:16199547 more ...
Tbk1	Rat	AUTOINFLAMMATION WITH ARTHRITIS AND VASCULITIS		ISO	TBK1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Autoinflammation with arthritis and vasculitis	ClinVar	PMID:25803835 more ...
Tbk1	Rat	ENCEPHALOPATHY, ACUTE, INFECTION-INDUCED (HERPES-SPECIFIC), 8		ISO	TBK1 (Homo sapiens)	8554872	ClinVar more ...	ClinVar	PMID:22851595 more ...
Tbk1	Rat	frontotemporal dementia and/or amyotrophic lateral sclerosis 4		ISO	TBK1 (Homo sapiens)	8554872	ClinVar more ...	ClinVar	PMID:16199547 more ...
Tbk1	Rat	genetic disease		ISO	TBK1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Inborn genetic diseases	ClinVar	PMID:28492532
Tbk1	Rat	Glaucoma 1, Open Angle, P		ISO	TBK1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Glaucoma 1 more ...	ClinVar	PMID:24033266 more ...
Tbk1	Rat	hereditary spastic paraplegia 8		ISO	TBK1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Hereditary spastic paraplegia 8	ClinVar	PMID:25741868
Tbk1	Rat	Herpes Simplex Encephalitis 1		ISO	TBK1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: HERPES SIMPLEX ENCEPHALITIS more ...	ClinVar	PMID:25700176 more ...
Tbk1	Rat	motor neuron disease		ISO	TBK1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Motor neuron disease	ClinVar	PMID:21447600 more ...
Tbk1	Rat	mucopolysaccharidosis type IIID		ISO	TBK1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Mucopolysaccharidosis and MPS-III-D	ClinVar	PMID:20232353 and PMID:28492532
Tbk1	Rat	primary open angle glaucoma		ISO	TBK1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Primary open angle glaucoma	ClinVar	PMID:25700176 more ...
Tbk1	Rat	progressive non-fluent aphasia		ISO	TBK1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Primary progressive non fluent aphasia	ClinVar
Tbk1	Rat	severe COVID-19		ISO	TBK1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Susceptibility to severe COVID-19	ClinVar	PMID:25741868 and PMID:28492532

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Tbk1	Rat	severe acute respiratory syndrome		ISO	TBK1 (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:26861016

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Tbk1	Rat	AUTOINFLAMMATION WITH ARTHRITIS AND VASCULITIS	susceptibility	ISO	TBK1 (Homo sapiens)	7240710		OMIM
Tbk1	Rat	ENCEPHALOPATHY, ACUTE, INFECTION-INDUCED (HERPES-SPECIFIC), 8	susceptibility	ISO	TBK1 (Homo sapiens)	7240710		OMIM
Tbk1	Rat	frontotemporal dementia and/or amyotrophic lateral sclerosis 4	susceptibility	ISO	TBK1 (Homo sapiens)	7240710		OMIM

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Tbk1	Rat	1,2-dimethylhydrazine	multiple interactions	ISO	Tbk1 (Mus musculus)	6480464	Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of TBK1 mRNA]	CTD	PMID:22206623
Tbk1	Rat	1,2-dimethylhydrazine	increases expression	ISO	Tbk1 (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in increased expression of TBK1 mRNA	CTD	PMID:22206623
Tbk1	Rat	17alpha-ethynylestradiol	affects expression	ISO	Tbk1 (Mus musculus)	6480464	Ethinyl Estradiol affects the expression of TBK1 mRNA	CTD	PMID:17555576
Tbk1	Rat	17alpha-ethynylestradiol	multiple interactions	ISO	Tbk1 (Mus musculus)	6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of TBK1 mRNA	CTD	PMID:17942748
Tbk1	Rat	17alpha-ethynylestradiol	increases expression	ISO	Tbk1 (Mus musculus)	6480464	Ethinyl Estradiol results in increased expression of TBK1 mRNA	CTD	PMID:17942748
Tbk1	Rat	17beta-estradiol	increases expression	ISO	Tbk1 (Mus musculus)	6480464	Estradiol results in increased expression of TBK1 mRNA	CTD	PMID:39298647
Tbk1	Rat	2,3',4,4',5-Pentachlorobiphenyl	increases expression	ISO	Tbk1 (Mus musculus)	6480464	2 more ...	CTD	PMID:31388691
Tbk1	Rat	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	Tbk1 (Mus musculus)	6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of TBK1 mRNA	CTD	PMID:17942748
Tbk1	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of TBK1 mRNA	CTD	PMID:33387578
Tbk1	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of TBK1 mRNA	CTD	PMID:32109520
Tbk1	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Tbk1 (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of TBK1 mRNA	CTD	PMID:21570461 and PMID:24680724
Tbk1	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	Tbk1 (Mus musculus)	6480464	Tetrachlorodibenzodioxin results in increased expression of TBK1 mRNA	CTD	PMID:17942748
Tbk1	Rat	3,4-methylenedioxymethamphetamine	increases methylation	ISO	Tbk1 (Mus musculus)	6480464	N-Methyl-3 and 4-methylenedioxyamphetamine results in increased methylation of TBK1 promoter	CTD	PMID:26251327
Tbk1	Rat	3,4-methylenedioxymethamphetamine	decreases expression	ISO	Tbk1 (Mus musculus)	6480464	N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of TBK1 mRNA	CTD	PMID:26251327
Tbk1	Rat	3H-1,2-dithiole-3-thione	decreases expression	EXP		6480464	1 and 2-dithiol-3-thione results in decreased expression of TBK1 mRNA	CTD	PMID:19162173
Tbk1	Rat	4,4'-sulfonyldiphenol	increases expression	ISO	Tbk1 (Mus musculus)	6480464	bisphenol S results in increased expression of TBK1 mRNA	CTD	PMID:39298647
Tbk1	Rat	6-propyl-2-thiouracil	decreases expression	EXP		6480464	Propylthiouracil results in decreased expression of TBK1 mRNA	CTD	PMID:24780913
Tbk1	Rat	acrolein	multiple interactions	ISO	TBK1 (Homo sapiens)	6480464	[Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of TBK1 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of TBK1 mRNA	CTD	PMID:32699268
Tbk1	Rat	acrylamide	increases expression	ISO	TBK1 (Homo sapiens)	6480464	Acrylamide results in increased expression of TBK1 mRNA	CTD	PMID:32763439
Tbk1	Rat	aflatoxin B1	increases expression	ISO	Tbk1 (Mus musculus)	6480464	Aflatoxin B1 results in increased expression of TBK1 mRNA	CTD	PMID:19770486
Tbk1	Rat	all-trans-retinoic acid	increases expression	ISO	TBK1 (Homo sapiens)	6480464	Tretinoin results in increased expression of TBK1 mRNA	CTD	PMID:33167477
Tbk1	Rat	alpha-pinene	multiple interactions	ISO	TBK1 (Homo sapiens)	6480464	[Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of TBK1 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of TBK1 mRNA	CTD	PMID:32699268
Tbk1	Rat	amlexanox	multiple interactions	ISO	Tbk1 (Mus musculus)	6480464	amlexanox inhibits the reaction [Acetaminophen results in increased phosphorylation of TBK1 protein] more ...	CTD	PMID:31697998 more ...
Tbk1	Rat	amlexanox	decreases phosphorylation	ISO	Tbk1 (Mus musculus)	6480464	amlexanox results in decreased phosphorylation of TBK1 protein	CTD	PMID:31697998
Tbk1	Rat	amlexanox	decreases activity	ISO	TBK1 (Homo sapiens)	6480464	amlexanox results in decreased activity of TBK1 protein	CTD	PMID:25321315
Tbk1	Rat	aristolochic acid A	decreases expression	ISO	TBK1 (Homo sapiens)	6480464	aristolochic acid I results in decreased expression of TBK1 mRNA	CTD	PMID:33212167
Tbk1	Rat	arsane	multiple interactions	ISO	TBK1 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of TBK1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of TBK1 mRNA	CTD	PMID:39836092
Tbk1	Rat	arsenic atom	multiple interactions	ISO	TBK1 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of TBK1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of TBK1 mRNA	CTD	PMID:39836092
Tbk1	Rat	auranofin	multiple interactions	ISO	Tbk1 (Mus musculus)	6480464	Auranofin inhibits the reaction [TBK1 protein results in increased activity of IRF3 protein]	CTD	PMID:17034761
Tbk1	Rat	bafilomycin A1	multiple interactions	ISO	Tbk1 (Mus musculus)	6480464	bafilomycin A1 promotes the reaction [Lipopolysaccharides results in increased phosphorylation of TBK1 protein] and bafilomycin A1 promotes the reaction [Poly I-C results in increased phosphorylation of TBK1 protein]	CTD	PMID:25780039
Tbk1	Rat	benzo[a]pyrene	increases expression	ISO	Tbk1 (Mus musculus)	6480464	Benzo(a)pyrene results in increased expression of TBK1 mRNA	CTD	PMID:22228805
Tbk1	Rat	benzo[a]pyrene diol epoxide I	decreases expression	ISO	TBK1 (Homo sapiens)	6480464	7 more ...	CTD	PMID:19150397
Tbk1	Rat	bis(2-ethylhexyl) phthalate	multiple interactions	ISO	Tbk1 (Mus musculus)	6480464	Lycopene inhibits the reaction [Diethylhexyl Phthalate results in increased phosphorylation of TBK1 protein]	CTD	PMID:36583613
Tbk1	Rat	bis(2-ethylhexyl) phthalate	increases phosphorylation	ISO	Tbk1 (Mus musculus)	6480464	Diethylhexyl Phthalate results in increased phosphorylation of TBK1 protein	CTD	PMID:36583613
Tbk1	Rat	bisphenol A	affects expression	EXP		6480464	bisphenol A affects the expression of TBK1 mRNA	CTD	PMID:25181051
Tbk1	Rat	bisphenol A	decreases expression	ISO	Tbk1 (Mus musculus)	6480464	bisphenol A results in decreased expression of TBK1 mRNA	CTD	PMID:33221593
Tbk1	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of TBK1 mRNA	CTD	PMID:30816183 and PMID:32528016
Tbk1	Rat	cadmium dichloride	decreases expression	ISO	TBK1 (Homo sapiens)	6480464	Cadmium Chloride results in decreased expression of TBK1 mRNA	CTD	PMID:38568856
Tbk1	Rat	caffeine	increases phosphorylation	ISO	TBK1 (Homo sapiens)	6480464	Caffeine results in increased phosphorylation of TBK1 protein	CTD	PMID:35688186
Tbk1	Rat	chromium(6+)	affects expression	ISO	Tbk1 (Mus musculus)	6480464	chromium hexavalent ion affects the expression of TBK1 mRNA	CTD	PMID:28472532
Tbk1	Rat	chrysin	decreases activity	ISO	TBK1 (Homo sapiens)	6480464	chrysin results in decreased activity of TBK1 protein	CTD	PMID:19426678
Tbk1	Rat	cisplatin	multiple interactions	ISO	Tbk1 (Mus musculus)	6480464	4-methyl-N1-(3-phenylpropyl)benzene-1 and 2-diamine inhibits the reaction [Cisplatin results in increased expression of TBK1 mRNA]	CTD	PMID:26546572
Tbk1	Rat	cisplatin	increases expression	ISO	Tbk1 (Mus musculus)	6480464	Cisplatin results in increased expression of TBK1 mRNA	CTD	PMID:26546572
Tbk1	Rat	clofibrate	decreases expression	ISO	Tbk1 (Mus musculus)	6480464	Clofibrate results in decreased expression of TBK1 mRNA	CTD	PMID:17585979
Tbk1	Rat	copper(II) sulfate	increases expression	ISO	TBK1 (Homo sapiens)	6480464	Copper Sulfate results in increased expression of TBK1 mRNA	CTD	PMID:19549813
Tbk1	Rat	curcumin	multiple interactions	ISO	TBK1 (Homo sapiens)	6480464	Curcumin inhibits the reaction [Oxygen deficiency results in increased expression of TBK1 mRNA]	CTD	PMID:23452621
Tbk1	Rat	cyclosporin A	increases expression	ISO	TBK1 (Homo sapiens)	6480464	Cyclosporine results in increased expression of TBK1 mRNA	CTD	PMID:25562108
Tbk1	Rat	dicrotophos	decreases expression	ISO	TBK1 (Homo sapiens)	6480464	dicrotophos results in decreased expression of TBK1 mRNA	CTD	PMID:28302478
Tbk1	Rat	dieldrin	affects methylation	ISO	Tbk1 (Mus musculus)	6480464	Dieldrin affects the methylation of TBK1 gene	CTD	PMID:38995845
Tbk1	Rat	dioxygen	multiple interactions	ISO	TBK1 (Homo sapiens)	6480464	3 more ...	CTD	PMID:23452621
Tbk1	Rat	dioxygen	increases expression	ISO	TBK1 (Homo sapiens)	6480464	Oxygen deficiency results in increased expression of TBK1 mRNA	CTD	PMID:23452621
Tbk1	Rat	disodium selenite	multiple interactions	ISO	Tbk1 (Mus musculus)	6480464	Sodium Selenite inhibits the reaction [TBK1 protein results in increased activity of IRF3 protein]	CTD	PMID:18279804
Tbk1	Rat	eriodictyol	decreases activity	ISO	TBK1 (Homo sapiens)	6480464	eriodictyol results in decreased activity of TBK1 protein	CTD	PMID:19426678
Tbk1	Rat	ethyl methanesulfonate	increases expression	ISO	TBK1 (Homo sapiens)	6480464	Ethyl Methanesulfonate results in increased expression of TBK1 mRNA	CTD	PMID:23649840
Tbk1	Rat	fenthion	decreases expression	ISO	Tbk1 (Mus musculus)	6480464	Fenthion results in decreased expression of TBK1 mRNA	CTD	PMID:34813904
Tbk1	Rat	flutamide	increases expression	EXP		6480464	Flutamide results in increased expression of TBK1 mRNA	CTD	PMID:24136188
Tbk1	Rat	folic acid	multiple interactions	ISO	Tbk1 (Mus musculus)	6480464	Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of TBK1 mRNA]	CTD	PMID:22206623
Tbk1	Rat	formaldehyde	decreases expression	ISO	TBK1 (Homo sapiens)	6480464	Formaldehyde results in decreased expression of TBK1 mRNA	CTD	PMID:20655997
Tbk1	Rat	genistein	multiple interactions	ISO	TBK1 (Homo sapiens)	6480464	Genistein inhibits the reaction [Oxygen deficiency results in increased expression of TBK1 mRNA]	CTD	PMID:23452621
Tbk1	Rat	genistein	increases methylation	EXP		6480464	Genistein results in increased methylation of TBK1 gene	CTD	PMID:28505145
Tbk1	Rat	gentamycin	increases expression	EXP		6480464	Gentamicins results in increased expression of TBK1 mRNA	CTD	PMID:22061828
Tbk1	Rat	glyphosate	decreases expression	ISO	TBK1 (Homo sapiens)	6480464	Glyphosate results in decreased expression of TBK1 mRNA	CTD	PMID:31295307
Tbk1	Rat	graphene oxide	increases expression	ISO	Tbk1 (Mus musculus)	6480464	graphene oxide results in increased expression of TBK1 mRNA	CTD	PMID:33227293
Tbk1	Rat	hexadecanoic acid	increases phosphorylation	ISO	Tbk1 (Mus musculus)	6480464	Palmitic Acid results in increased phosphorylation of TBK1 protein	CTD	PMID:32905826
Tbk1	Rat	hexadecanoic acid	multiple interactions	ISO	Tbk1 (Mus musculus)	6480464	amlexanox inhibits the reaction [Palmitic Acid results in increased phosphorylation of TBK1 protein]	CTD	PMID:32905826
Tbk1	Rat	isoprenaline	increases expression	ISO	Tbk1 (Mus musculus)	6480464	Isoproterenol results in increased expression of TBK1 mRNA	CTD	PMID:20003209
Tbk1	Rat	isoprenaline	multiple interactions	EXP		6480464	[Isoproterenol co-treated with POSTN protein] results in decreased expression of TBK1 mRNA	CTD	PMID:30303030
Tbk1	Rat	ivermectin	decreases expression	ISO	TBK1 (Homo sapiens)	6480464	Ivermectin results in decreased expression of TBK1 protein	CTD	PMID:32959892
Tbk1	Rat	lipopolysaccharide	increases response to substance	ISO	TBK1 (Homo sapiens)	6480464	TBK1 protein results in increased susceptibility to Lipopolysaccharides	CTD	PMID:21904615
Tbk1	Rat	lipopolysaccharide	increases phosphorylation	ISO	Tbk1 (Mus musculus)	6480464	Lipopolysaccharides results in increased phosphorylation of TBK1 protein	CTD	PMID:25780039
Tbk1	Rat	lipopolysaccharide	multiple interactions	ISO	Tbk1 (Mus musculus)	6480464	APPL1 protein promotes the reaction [Lipopolysaccharides results in increased phosphorylation of TBK1 protein] more ...	CTD	PMID:25780039
Tbk1	Rat	luteolin	decreases activity	ISO	TBK1 (Homo sapiens)	6480464	Luteolin results in decreased activity of TBK1 protein	CTD	PMID:19426678
Tbk1	Rat	lycopene	multiple interactions	ISO	Tbk1 (Mus musculus)	6480464	Lycopene inhibits the reaction [Diethylhexyl Phthalate results in increased phosphorylation of TBK1 protein]	CTD	PMID:36583613
Tbk1	Rat	manganese atom	multiple interactions	ISO	TBK1 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of TBK1 mRNA	CTD	PMID:39836092
Tbk1	Rat	manganese(0)	multiple interactions	ISO	TBK1 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of TBK1 mRNA	CTD	PMID:39836092
Tbk1	Rat	manganese(II) chloride	multiple interactions	ISO	TBK1 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of TBK1 mRNA	CTD	PMID:39836092
Tbk1	Rat	mangiferin	decreases expression	ISO	Tbk1 (Mus musculus)	6480464	mangiferin results in decreased expression of TBK1 mRNA	CTD	PMID:15135318
Tbk1	Rat	methyl methanesulfonate	increases expression	ISO	TBK1 (Homo sapiens)	6480464	Methyl Methanesulfonate results in increased expression of TBK1 mRNA	CTD	PMID:23649840
Tbk1	Rat	nefazodone	increases expression	EXP		6480464	nefazodone results in increased expression of TBK1 mRNA	CTD	PMID:24136188
Tbk1	Rat	nitrates	multiple interactions	ISO	Tbk1 (Mus musculus)	6480464	[Particulate Matter results in increased abundance of Nitrates] which results in increased expression of TBK1 mRNA	CTD	PMID:35964746
Tbk1	Rat	o-anisidine	decreases expression	ISO	TBK1 (Homo sapiens)	6480464	2-anisidine results in decreased expression of TBK1 mRNA	CTD	PMID:28089782
Tbk1	Rat	oxybenzone	increases expression	ISO	TBK1 (Homo sapiens)	6480464	oxybenzone results in increased expression of TBK1 mRNA	CTD	PMID:36581016
Tbk1	Rat	ozone	multiple interactions	ISO	TBK1 (Homo sapiens)	6480464	[Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of TBK1 mRNA more ...	CTD	PMID:32699268
Tbk1	Rat	paracetamol	affects expression	ISO	Tbk1 (Mus musculus)	6480464	Acetaminophen affects the expression of TBK1 mRNA	CTD	PMID:17562736
Tbk1	Rat	paracetamol	increases phosphorylation	ISO	Tbk1 (Mus musculus)	6480464	Acetaminophen results in increased phosphorylation of TBK1 protein	CTD	PMID:31697998
Tbk1	Rat	paracetamol	multiple interactions	ISO	Tbk1 (Mus musculus)	6480464	[vadimezan affects the reaction [P2RX1 protein affects the susceptibility to Acetaminophen]] which affects the phosphorylation of TBK1 protein and amlexanox inhibits the reaction [Acetaminophen results in increased phosphorylation of TBK1 protein]	CTD	PMID:31697998 and PMID:37046119
Tbk1	Rat	paracetamol	decreases expression	ISO	TBK1 (Homo sapiens)	6480464	Acetaminophen results in decreased expression of TBK1 mRNA	CTD	PMID:27761495
Tbk1	Rat	paraquat	increases phosphorylation	ISO	Tbk1 (Mus musculus)	6480464	Paraquat results in increased phosphorylation of TBK1 protein	CTD	PMID:32763286
Tbk1	Rat	paraquat	multiple interactions	ISO	Tbk1 (Mus musculus)	6480464	amlexanox inhibits the reaction [Paraquat results in increased phosphorylation of TBK1 protein]	CTD	PMID:32763286
Tbk1	Rat	pentachlorophenol	increases expression	ISO	Tbk1 (Mus musculus)	6480464	Pentachlorophenol results in increased expression of TBK1 mRNA	CTD	PMID:23892564
Tbk1	Rat	perfluorooctane-1-sulfonic acid	decreases expression	ISO	TBK1 (Homo sapiens)	6480464	perfluorooctane sulfonic acid results in decreased expression of TBK1 mRNA	CTD	PMID:27153767
Tbk1	Rat	Phytolaccoside E	increases phosphorylation	ISO	TBK1 (Homo sapiens)	6480464	esculentoside A results in increased phosphorylation of TBK1 protein	CTD	PMID:36460195
Tbk1	Rat	poly(I:C)	increases phosphorylation	ISO	Tbk1 (Mus musculus)	6480464	Poly I-C results in increased phosphorylation of TBK1 protein	CTD	PMID:25780039
Tbk1	Rat	poly(I:C)	multiple interactions	ISO	Tbk1 (Mus musculus)	6480464	APPL1 protein promotes the reaction [Poly I-C results in increased phosphorylation of TBK1 protein] and bafilomycin A1 promotes the reaction [Poly I-C results in increased phosphorylation of TBK1 protein]	CTD	PMID:25780039
Tbk1	Rat	propiconazole	increases expression	ISO	Tbk1 (Mus musculus)	6480464	propiconazole results in increased expression of TBK1 mRNA	CTD	PMID:21278054
Tbk1	Rat	quercetin	decreases activity	ISO	TBK1 (Homo sapiens)	6480464	Quercetin results in decreased activity of TBK1 protein	CTD	PMID:19426678
Tbk1	Rat	resveratrol	multiple interactions	ISO	Tbk1 (Mus musculus)	6480464	resveratrol inhibits the reaction [TBK1 protein results in increased activity of IRF3 protein] and resveratrol inhibits the reaction [TBK1 protein results in increased phosphorylation of IRF3 protein]	CTD	PMID:16116226 and PMID:16678799
Tbk1	Rat	resveratrol	multiple interactions	ISO	TBK1 (Homo sapiens)	6480464	resveratrol inhibits the reaction [Oxygen deficiency results in increased expression of TBK1 mRNA]	CTD	PMID:23452621
Tbk1	Rat	sodium arsenite	increases expression	ISO	Tbk1 (Mus musculus)	6480464	sodium arsenite results in increased expression of TBK1 mRNA	CTD	PMID:19822182
Tbk1	Rat	sodium arsenite	multiple interactions	ISO	TBK1 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of TBK1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of TBK1 mRNA	CTD	PMID:39836092
Tbk1	Rat	sodium arsenite	decreases expression	ISO	TBK1 (Homo sapiens)	6480464	sodium arsenite results in decreased expression of TBK1 mRNA	CTD	PMID:38568856
Tbk1	Rat	sulindac	increases expression	ISO	TBK1 (Homo sapiens)	6480464	Sulindac results in increased expression of TBK1 mRNA	CTD	PMID:11093808
Tbk1	Rat	tamoxifen	affects expression	ISO	Tbk1 (Mus musculus)	6480464	Tamoxifen affects the expression of TBK1 mRNA	CTD	PMID:17555576
Tbk1	Rat	thioacetamide	increases expression	EXP		6480464	Thioacetamide results in increased expression of TBK1 mRNA	CTD	PMID:34492290
Tbk1	Rat	titanium dioxide	increases methylation	ISO	Tbk1 (Mus musculus)	6480464	titanium dioxide results in increased methylation of TBK1 promoter	CTD	PMID:35295148
Tbk1	Rat	Triptolide	increases expression	ISO	Tbk1 (Mus musculus)	6480464	triptolide results in increased expression of TBK1 mRNA and triptolide results in increased expression of TBK1 protein	CTD	PMID:36520315
Tbk1	Rat	tunicamycin	decreases expression	ISO	Tbk1 (Mus musculus)	6480464	Tunicamycin results in decreased expression of TBK1 mRNA	CTD	PMID:17127020
Tbk1	Rat	tunicamycin	decreases expression	ISO	TBK1 (Homo sapiens)	6480464	Tunicamycin results in decreased expression of TBK1 mRNA	CTD	PMID:29453283
Tbk1	Rat	vadimezan	multiple interactions	ISO	Tbk1 (Mus musculus)	6480464	[vadimezan affects the reaction [P2RX1 protein affects the susceptibility to Acetaminophen]] which affects the phosphorylation of TBK1 protein	CTD	PMID:37046119

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Tbk1	Rat	activation of innate immune response	involved_in	IBA	FB:FBgn0086657 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Tbk1	Rat	activation of innate immune response	acts_upstream_of_or_within	IEA	UniProtKB:Q9WUN2 and ensembl:ENSMUSP00000020316	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tbk1	Rat	activation of innate immune response	acts_upstream_of_or_within	ISO	Tbk1 (Mus musculus)	1624291	MGI:3046789 PMID:15661922	RGD	PMID:15661922
Tbk1	Rat	activation of innate immune response	involved_in	IEA	UniProtKB:Q9UHD2 and ensembl:ENSP00000329967	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tbk1	Rat	activation of innate immune response	involved_in	ISO	TBK1 (Homo sapiens)	1624291	PMID:25636800	RGD	PMID:25636800
Tbk1	Rat	antiviral innate immune response	involved_in	IEA	UniProtKB:Q9UHD2 and ensembl:ENSP00000329967	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tbk1	Rat	antiviral innate immune response	involved_in	ISO	TBK1 (Homo sapiens)	1624291	PMID:14703513 and PMID:22394562	RGD	PMID:14703513 and PMID:22394562
Tbk1	Rat	cytoplasmic pattern recognition receptor signaling pathway	involved_in	ISO	TBK1 (Homo sapiens)	1624291	PMID:29441066	RGD	PMID:29441066
Tbk1	Rat	cytoplasmic pattern recognition receptor signaling pathway	involved_in	IEA	UniProtKB:Q9UHD2 and ensembl:ENSP00000329967	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tbk1	Rat	defense response to Gram-positive bacterium	acts_upstream_of_or_within	IEA	UniProtKB:Q9WUN2 and ensembl:ENSMUSP00000020316	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tbk1	Rat	defense response to Gram-positive bacterium	acts_upstream_of_or_within	ISO	Tbk1 (Mus musculus)	1624291	MGI:3046789 PMID:15661922	RGD	PMID:15661922
Tbk1	Rat	dendritic cell proliferation	acts_upstream_of_or_within	ISO	Tbk1 (Mus musculus)	1624291	MGI:1351332 PMID:23610142	RGD	PMID:23610142
Tbk1	Rat	dendritic cell proliferation	acts_upstream_of_or_within	IEA	UniProtKB:Q9WUN2 and ensembl:ENSMUSP00000020316	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tbk1	Rat	innate immune response	involved_in	ISO	TBK1 (Homo sapiens)	1624291	PMID:25636800	RGD	PMID:25636800
Tbk1	Rat	innate immune response	involved_in	IEA	UniProtKB:Q9UHD2 and ensembl:ENSP00000329967	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tbk1	Rat	negative regulation of gene expression	involved_in	ISO	Tbk1 (Mus musculus)	1624291	PMID:18665841	RGD	PMID:18665841
Tbk1	Rat	negative regulation of gene expression	involved_in	IEA	UniProtKB:Q9WUN2 and ensembl:ENSMUSP00000020316	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tbk1	Rat	negative regulation of TORC1 signaling	involved_in	ISO	TBK1 (Homo sapiens)	1624291	PMID:31530866	RGD	PMID:31530866
Tbk1	Rat	negative regulation of TORC1 signaling	involved_in	IEA	UniProtKB:Q9UHD2 and ensembl:ENSP00000329967	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tbk1	Rat	peptidyl-serine phosphorylation	involved_in	ISO	TBK1 (Homo sapiens)	1624291	PMID:25636800 and PMID:25803835	RGD	PMID:25636800 and PMID:25803835
Tbk1	Rat	peptidyl-serine phosphorylation	involved_in	ISO	Tbk1 (Mus musculus)	1624291	PMID:21617041	RGD	PMID:21617041
Tbk1	Rat	peptidyl-threonine phosphorylation	involved_in	ISO	TBK1 (Homo sapiens)	1624291	PMID:25636800	RGD	PMID:25636800
Tbk1	Rat	positive regulation of autophagy	involved_in	ISO	TBK1 (Homo sapiens)	1624291	PMID:28871090	RGD	PMID:28871090
Tbk1	Rat	positive regulation of autophagy	involved_in	IEA	UniProtKB:Q9UHD2 and ensembl:ENSP00000329967	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tbk1	Rat	positive regulation of canonical NF-kappaB signal transduction	involved_in	ISO	TBK1 (Homo sapiens)	1624291	PMID:12761501	RGD	PMID:12761501
Tbk1	Rat	positive regulation of canonical NF-kappaB signal transduction	involved_in	IEA	UniProtKB:Q9UHD2 and ensembl:ENSP00000329967	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tbk1	Rat	positive regulation of gene expression	involved_in	IEA	ARBA:ARBA00026655	1600115	GO_REF:0000117	UniProt	GO_REF:0000117
Tbk1	Rat	positive regulation of interferon-alpha production	involved_in	ISO	TBK1 (Homo sapiens)	1624291	PMID:16127453	RGD	PMID:16127453
Tbk1	Rat	positive regulation of interferon-alpha production	involved_in	IEA	UniProtKB:Q9UHD2 and ensembl:ENSP00000329967	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tbk1	Rat	positive regulation of interferon-beta production	involved_in	ISO	TBK1 (Homo sapiens)	1624291	PMID:16127453	RGD	PMID:16127453
Tbk1	Rat	positive regulation of interferon-beta production	acts_upstream_of_or_within	IEA	UniProtKB:Q9WUN2 and ensembl:ENSMUSP00000020316	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tbk1	Rat	positive regulation of interferon-beta production	acts_upstream_of_or_within	ISO	Tbk1 (Mus musculus)	1624291	MGI:3046789 PMID:15661922	RGD	PMID:15661922
Tbk1	Rat	positive regulation of interferon-beta production	involved_in	IEA	UniProtKB:Q9UHD2 and ensembl:ENSP00000329967	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tbk1	Rat	positive regulation of macroautophagy	involved_in	ISO	TBK1 (Homo sapiens)	1624291	PMID:27103069	RGD	PMID:27103069
Tbk1	Rat	positive regulation of macroautophagy	involved_in	IEA	UniProtKB:Q9UHD2 and ensembl:ENSP00000329967	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tbk1	Rat	positive regulation of TORC1 signaling	involved_in	ISO	TBK1 (Homo sapiens)	1624291	PMID:29150432	RGD	PMID:29150432
Tbk1	Rat	positive regulation of TORC1 signaling	involved_in	IEA	UniProtKB:Q9UHD2 and ensembl:ENSP00000329967	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tbk1	Rat	positive regulation of TORC2 signaling	involved_in	ISO	Tbk1 (Mus musculus)	1624291	PMID:34245780	RGD	PMID:34245780
Tbk1	Rat	positive regulation of TORC2 signaling	involved_in	IEA	UniProtKB:Q9WUN2 and ensembl:ENSMUSP00000020316	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tbk1	Rat	positive regulation of transcription by RNA polymerase II	involved_in	ISO	TBK1 (Homo sapiens)	1624291	PMID:16127453	RGD	PMID:16127453
Tbk1	Rat	positive regulation of transcription by RNA polymerase II	involved_in	IEA	UniProtKB:Q9UHD2 and ensembl:ENSP00000329967	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tbk1	Rat	positive regulation of type I interferon production	involved_in	ISO	TBK1 (Homo sapiens)	1624291	PMID:14703513 more ...	RGD	PMID:14703513 more ...
Tbk1	Rat	positive regulation of type I interferon production	involved_in	IEA	UniProtKB:Q9UHD2 and ensembl:ENSP00000329967	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tbk1	Rat	positive regulation of type I interferon production	involved_in	IBA	MGI:1929658 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Tbk1	Rat	positive regulation of type I interferon-mediated signaling pathway	involved_in	ISO	Tbk1 (Mus musculus)	1624291	PMID:27129230	RGD	PMID:27129230
Tbk1	Rat	positive regulation of type I interferon-mediated signaling pathway	involved_in	IEA	UniProtKB:Q9WUN2 and ensembl:ENSMUSP00000020316	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tbk1	Rat	positive regulation of xenophagy	involved_in	ISO	Tbk1 (Mus musculus)	1624291	PMID:21617041	RGD	PMID:21617041
Tbk1	Rat	positive regulation of xenophagy	involved_in	IEA	UniProtKB:Q9WUN2 and ensembl:ENSMUSP00000020316	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tbk1	Rat	protein phosphorylation	involved_in	ISO	TBK1 (Homo sapiens)	1624291	PMID:27103069	RGD	PMID:27103069
Tbk1	Rat	regulation of gene expression	acts_upstream_of_or_within	IEA	UniProtKB:Q9WUN2 and ensembl:ENSMUSP00000020316	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tbk1	Rat	regulation of gene expression	acts_upstream_of_or_within	ISO	Tbk1 (Mus musculus)	1624291	MGI:1328317 more ...	RGD	PMID:23160154
Tbk1	Rat	regulation of metabolic process	acts_upstream_of_or_within	ISO	Tbk1 (Mus musculus)	1624291	MGI:1328317 PMID:28069950	RGD	PMID:28069950
Tbk1	Rat	regulation of metabolic process	acts_upstream_of_or_within	IEA	UniProtKB:Q9WUN2 and ensembl:ENSMUSP00000020316	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tbk1	Rat	regulation of type I interferon production	involved_in	ISO	TBK1 (Homo sapiens)	1624291	PMID:25636800	RGD	PMID:25636800
Tbk1	Rat	regulation of type I interferon production	involved_in	IEA	UniProtKB:Q9UHD2 and ensembl:ENSP00000329967	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tbk1	Rat	T follicular helper cell differentiation	involved_in	ISO	TBK1 (Homo sapiens)	1624291	PMID:27135603	RGD	PMID:27135603
Tbk1	Rat	T follicular helper cell differentiation	involved_in	IEA	UniProtKB:Q9UHD2 and ensembl:ENSP00000329967	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tbk1	Rat	toll-like receptor 4 signaling pathway	involved_in	IEA	UniProtKB:Q9UHD2 and ensembl:ENSP00000329967	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tbk1	Rat	toll-like receptor 4 signaling pathway	involved_in	ISO	TBK1 (Homo sapiens)	1624291	PMID:28747347	RGD	PMID:28747347

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Tbk1	Rat	cytoplasm	is_active_in	ISO	TBK1 (Homo sapiens)	1624291	PMID:14703513	RGD	PMID:14703513
Tbk1	Rat	cytoplasm	located_in	IEA	UniProtKB-SubCell:SL-0086	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Tbk1	Rat	cytoplasm	is_active_in	IBA	FB:FBgn0024222 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Tbk1	Rat	cytoplasm	located_in	ISO	TBK1 (Homo sapiens)	1624291	PMID:21813773 and PMID:29251827	RGD	PMID:21813773 and PMID:29251827
Tbk1	Rat	cytoplasm	located_in	IEA	UniProtKB:Q9UHD2 and ensembl:ENSP00000329967	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tbk1	Rat	cytosol	is_active_in	ISO	TBK1 (Homo sapiens)	1624291	PMID:21813773	RGD	PMID:21813773
Tbk1	Rat	cytosol	is_active_in	IEA	UniProtKB:Q9UHD2 and ensembl:ENSP00000329967	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tbk1	Rat	intracellular membrane-bounded organelle	located_in	ISO	TBK1 (Homo sapiens)	1624291		RGD	GO_REF:0000052
Tbk1	Rat	intracellular membrane-bounded organelle	located_in	IEA	UniProtKB:Q9UHD2 and ensembl:ENSP00000329967	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tbk1	Rat	nucleoplasm	located_in	IEA	UniProtKB:Q9UHD2 and ensembl:ENSP00000329967	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tbk1	Rat	nucleoplasm	located_in	ISO	TBK1 (Homo sapiens)	1624291		RGD	GO_REF:0000052

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Tbk1	Rat	ATP binding	enables	IEA	UniRule:UR001503341	1600115	GO_REF:0000104	UniProt	GO_REF:0000104
Tbk1	Rat	ATP binding	enables	IEA	UniProtKB-KW:KW-0067	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Tbk1	Rat	ATP binding	enables	IEA	InterPro:IPR000719 and InterPro:IPR017441	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Tbk1	Rat	identical protein binding	enables	ISO	Tbk1 (Mus musculus)	1624291	UniProtKB:Q9WUN2 more ...	RGD	PMID:22728658 and PMID:23746807
Tbk1	Rat	identical protein binding	enables	IEA	UniProtKB:Q9WUN2 and ensembl:ENSMUSP00000020316	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tbk1	Rat	kinase activity	enables	IEA	UniProtKB-KW:KW-0418	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Tbk1	Rat	nucleic acid binding	enables	ISO	Tbk1 (Mus musculus)	1624291	PMID:19158679	RGD	PMID:19158679
Tbk1	Rat	nucleic acid binding	enables	IEA	UniProtKB:Q9WUN2 and ensembl:ENSMUSP00000020316	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tbk1	Rat	nucleotide binding	enables	IEA	UniRule:UR001503341	1600115	GO_REF:0000104	UniProt	GO_REF:0000104
Tbk1	Rat	nucleotide binding	enables	IEA	UniProtKB-KW:KW-0547	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Tbk1	Rat	phosphoprotein binding	enables	ISO	TBK1 (Homo sapiens)	1624291	UniProtKB:Q8IUC6 and PMID:14530355	RGD	PMID:14530355
Tbk1	Rat	phosphoprotein binding	enables	IEA	UniProtKB:Q9UHD2 and ensembl:ENSP00000329967	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tbk1	Rat	protein binding	enables	ISO	Tbk1 (Mus musculus)	1624291	UniProtKB:A2A9T0 more ...	RGD	PMID:10581243 more ...
Tbk1	Rat	protein binding	enables	ISO	TBK1 (Homo sapiens)	1624291	UniProtKB:A7MCY6 more ...	RGD	PMID:14743216 more ...
Tbk1	Rat	protein kinase activity	enables	IEA	InterPro:IPR000719	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Tbk1	Rat	protein phosphatase binding	enables	IEA	UniProtKB:Q9WUN2 and ensembl:ENSMUSP00000020316	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tbk1	Rat	protein phosphatase binding	enables	ISO	Tbk1 (Mus musculus)	1624291	UniProtKB:P35235 and PMID:17954568	RGD	PMID:17954568
Tbk1	Rat	protein serine kinase activity	enables	IEA	UniProtKB:Q9UHD2 and ensembl:ENSP00000329967	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tbk1	Rat	protein serine kinase activity	enables	ISO	TBK1 (Homo sapiens)	1624291	PMID:22412986	RGD	PMID:22412986
Tbk1	Rat	protein serine/threonine kinase activity	enables	ISO	Tbk1 (Mus musculus)	1624291	PMID:21617041 and PMID:34245780	RGD	PMID:21617041 and PMID:34245780
Tbk1	Rat	protein serine/threonine kinase activity	enables	IEA	UniProtKB-KW:KW-0723	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Tbk1	Rat	protein serine/threonine kinase activity	enables	IEA	UniProtKB:Q9WUN2 and ensembl:ENSMUSP00000020316	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tbk1	Rat	protein serine/threonine kinase activity	enables	IBA	FB:FBgn0024222 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Tbk1	Rat	protein serine/threonine kinase activity	enables	ISO	TBK1 (Homo sapiens)	1624291	PMID:14703513 more ...	RGD	PMID:14703513 more ...
Tbk1	Rat	protein serine/threonine kinase activity	enables	IEA	UniProtKB:Q9UHD2 and ensembl:ENSP00000329967	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tbk1	Rat	RNA polymerase II-specific DNA-binding transcription factor binding	enables	ISO	TBK1 (Homo sapiens)	1624291	UniProtKB:Q13568 and PMID:22412986	RGD	PMID:22412986
Tbk1	Rat	RNA polymerase II-specific DNA-binding transcription factor binding	enables	IEA	UniProtKB:Q9UHD2 and ensembl:ENSP00000329967	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tbk1	Rat	transferase activity	enables	IEA	UniProtKB-KW:KW-0808	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

RGD Manual Annotations

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Tbk1	Rat	Toll-like receptor signaling pathway		ISO	TBK1 (Homo sapiens)	5685014		RGD

Imported Annotations - KEGG (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Tbk1	Rat	hepatitis C pathway		IEA		6907045		KEGG	rno:05160
Tbk1	Rat	influenza A pathway		IEA		6907045		KEGG	rno:05164
Tbk1	Rat	measles pathway		IEA		6907045		KEGG	rno:05162
Tbk1	Rat	Retinoic acid-inducible gene (RIG) I-like receptor signaling pathway		IEA		6907045		KEGG	rno:04622
Tbk1	Rat	Toll-like receptor signaling pathway		IEA		6907045		KEGG	rno:04620

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Pathogen recognition by the innate immune system.	Kumar H, etal., Int Rev Immunol. 2011 Feb;30(1):16-34.
3.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
4.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:12761501	PMID:14530355	PMID:14743216	PMID:15661922	PMID:16127453	PMID:17599067	PMID:17954568	PMID:18665841	PMID:19158679	PMID:19375882	PMID:21617041	PMID:21813773
PMID:22728658	PMID:23160154	PMID:23610142	PMID:23746807	PMID:24380861	PMID:25636800	PMID:25803835	PMID:27103069	PMID:27129230	PMID:27797401	PMID:28069950	PMID:29251827
PMID:32757223	PMID:33168920	PMID:36805078	PMID:37935918

Tbk1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	58,963,319 - 58,996,357 (-)	NCBI		GRCr8
mRatBN7.2	7	57,077,830 - 57,110,868 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	57,077,830 - 57,110,892 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	58,989,079 - 59,022,620 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	61,191,956 - 61,225,497 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	60,969,664 - 61,003,205 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	63,655,247 - 63,687,978 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	63,655,247 - 63,687,978 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	63,877,567 - 63,910,298 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	60,863,099 - 60,896,131 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	7	53,819,361 - 53,852,262 (-)	NCBI		Celera
Cytogenetic Map	7	q22	NCBI

TBK1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	12	64,452,120 - 64,502,114 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	12	64,452,090 - 64,502,114 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	12	64,845,900 - 64,895,894 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	63,132,204 - 63,182,158 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	12	63,132,203 - 63,182,158	NCBI
Celera	12	64,510,375 - 64,560,181 (+)	NCBI		Celera
Cytogenetic Map	12	q14.2	NCBI
HuRef	12	61,898,186 - 61,948,226 (+)	NCBI		HuRef
CHM1_1	12	64,812,935 - 64,863,007 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	12	64,430,747 - 64,480,735 (+)	NCBI		T2T-CHM13v2.0

Tbk1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	10	121,382,360 - 121,422,699 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	10	121,382,360 - 121,422,692 (-)	Ensembl		GRCm39 Ensembl
GRCm38	10	121,546,455 - 121,586,794 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	10	121,546,455 - 121,586,787 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	10	120,983,511 - 121,023,850 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	10	120,949,520 - 120,989,807 (-)	NCBI		MGSCv36	mm8
Celera	10	123,931,313 - 123,970,044 (-)	NCBI		Celera
Cytogenetic Map	10	D2	NCBI
cM Map	10	69.84	NCBI

Tbk1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955458	11,211,398 - 11,263,867 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955458	11,210,120 - 11,263,632 (+)	NCBI	ChiLan1.0	ChiLan1.0

TBK1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	10	29,864,914 - 29,915,549 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	12	29,861,685 - 29,912,320 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	12	24,419,271 - 24,469,164 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	12	24,919,412 - 24,968,587 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	12	24,917,246 - 24,968,587 (-)	Ensembl	panpan1.1		panPan2

TBK1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	10	7,169,664 - 7,208,890 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	10	7,168,007 - 7,208,899 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	10	7,102,668 - 7,144,367 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	10	7,276,927 - 7,318,803 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	10	7,276,875 - 7,318,755 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	10	7,142,851 - 7,184,688 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	10	7,395,493 - 7,437,313 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	10	7,526,057 - 7,567,705 (+)	NCBI		UU_Cfam_GSD_1.0

Tbk1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	51,300,898 - 51,346,375 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936545	2,763,596 - 2,809,709 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936545	2,763,755 - 2,809,229 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TBK1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	5	28,880,205 - 28,929,963 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	5	28,880,210 - 28,929,964 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

TBK1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	11	60,136,162 - 60,182,354 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	11	60,136,232 - 60,182,344 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666037	185,623,292 - 185,669,524 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Tbk1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624802	3,862,709 - 3,914,028 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624802	3,861,821 - 3,914,061 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Tbk1
145 total Variants

Assembly: mRatBN7.2

Chromosome	Start Pos	End Pos	Reference Nucleotide	Variant Nucleotide	Variant Type	Strain	Variant Page
7	57082339	57082340	T	G	snv	European Variation Archive Release 3, FXLE12/StmMcwi (2023), European Variation Archive Release 6, FXLE18/Stm (2020), LEXF11/Stm (2020), LEXF1C/Stm (2019), LEXF4/Stm (2020), LE/Stm (2019), FXLE12/StmMcwi (2021), FXLE12/Stm (2019NG), FXLE20/Stm (2019NG), FXLE23/Stm (2022), FXLE25/Stm (2022), LEXF1C/StmMcwi (2021), LEXF2A/Stm (2022), LEXF5/Stm (2019NG), LEXF8A/StmMcwi (2021), LEXF8D/Stm (2022), LEXF2A/StmMcwi (2023), LEXF5/StmMcwi (2023), FXLE20/StmMcwi (2023), LEXF8D/StmMcwi (2023), FXLE23/StmMcwi (2023), FXLE25/StmMcwi (2023), European Variation Archive Release 4	View more Information

Assembly: RGSC_v3.4

Chromosome	Start Pos	End Pos	Reference Nucleotide	Variant Nucleotide	Variant Type	Strain	Variant Page
7	60867602	60867603	T	G	snv	LE/Stm (ICL), LE/Stm (KNAW)	View more Information

Assembly: Rnor_5.0

Chromosome	Start Pos	End Pos	Reference Nucleotide	Variant Nucleotide	Variant Type	Strain	Variant Page
7	63882070	63882071	T	G	snv	LE/Stm (Illumina) (KNAW), LE/Stm (SOLiD) (KNAW), LE/Stm (KyushuU), Crl:SD (UDEL), NIG-III/Hok (KyushuU), LE/OrlBarth (UDEL)	View more Information

Assembly: Rnor_6.0

Chromosome	Start Pos	End Pos	Reference Nucleotide	Variant Nucleotide	Variant Type	Strain	Variant Page
7	63659750	63659751	T	G	snv	LE/Stm (RGD), FXLE18/Stm (2020), LE/Stm (2019), LEXF1C/Stm (2019), LEXF4/Stm (2020), LEXF11/Stm (2020)	View more Information

Predicted Target Of

	Summary Value
Count of predictions:	330
Count of miRNA genes:	212
Interacting mature miRNAs:	250
Transcripts:	ENSRNOT00000009260
Prediction methods:	Microtar, Miranda, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
7411569	Bw137	Body weight QTL 137		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	7	21921195	66921195	Rat
1300179	Kidm5	Kidney mass QTL 5	3.51		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	43747012	135012528	Rat
2293667	Bss42	Bone structure and strength QTL 42	7.25	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra cross-sectional area (CMO:0001689)	7	47651439	92651439	Rat
10053722	Scort27	Serum corticosterone level QTL 27	2.41	0.0083	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	7	43228750	88228750	Rat
1578652	Bmd15	Bone mineral density QTL 15	5.2		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	7	9866467	60460686	Rat
1641885	Alcrsp9	Alcohol response QTL 9			alcohol metabolism trait (VT:0015089)	blood ethanol level (CMO:0000535)	7	24099606	69099606	Rat
1549840	Bss5	Bone structure and strength QTL 5	9.8		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	7	24751841	69751841	Rat
1300127	Srn1	Serum renin concentration QTL 1	3.87		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	7	29409683	84928080	Rat
10059605	Kidm47	Kidney mass QTL 47	2.91	0.05	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	7	47251783	65728867	Rat
2293678	Bss24	Bone structure and strength QTL 24	6.71	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	7	47651439	92651439	Rat
1358361	Sradr5	Stress Responsive Adrenal Weight QTL 5	5.55		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	7	43747012	108555253	Rat
2298547	Neuinf5	Neuroinflammation QTL 5	3.7		nervous system integrity trait (VT:0010566)	spinal cord Cd74 protein level (CMO:0002131)	7	9462246	58265113	Rat
631513	Scl7	Serum cholesterol level QTL 7	4.1		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	7	37960569	82960569	Rat
2293685	Bmd21	Bone mineral density QTL 21	4.2	0.0003	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	7	47651439	92651439	Rat
10755453	Coatc12	Coat color QTL 12		0	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	7	31112832	76112832	Rat
631504	Cm27	Cardiac mass QTL 27	3.45		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	7	44421311	118198041	Rat
10755451	Coatc11	Coat color QTL 11		0	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	7	17944357	62944357	Rat
634326	Hc3	Hypercalciuria QTL 3	2.1		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	7	42787314	87787314	Rat
2317059	Aia15	Adjuvant induced arthritis QTL 15	2.46		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	7	17004598	62004598	Rat
2293696	Bmd32	Bone mineral density QTL 32	5.1	0.0001	femur strength trait (VT:0010010)	femoral neck polar moment of inertia (CMO:0001670)	7	47651439	92651439	Rat
7411605	Foco14	Food consumption QTL 14	24.1	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	34293282	79293282	Rat
1300151	Bp181	Blood pressure QTL 181	3.36		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	7	53612714	103945643	Rat
1643004	Pain2	Pain QTL 2	1		mechanical nociception trait (VT:0002734)	self mutilation severity score (CMO:0002145)	7	9462246	98011544	Rat
738030	Anxrr8	Anxiety related response QTL 8	4.1		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	46590070	91590070	Rat
1300149	Cm6	Cardiac mass QTL 6	4.09		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	7	43747099	102228765	Rat
631534	Lnnr1	Liver neoplastic nodule remodeling QTL 1	3.85	0.001	liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number to liver total tumorous lesion number ratio (CMO:0001705)	7	34293282	79293282	Rat
634336	Anxrr17	Anxiety related response QTL 17	3.66		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	924703	115097879	Rat
2293707	Bss32	Bone structure and strength QTL 32	7.64	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	7	47651439	92651439	Rat
61357	Bp38	Blood pressure QTL 38	1.6	0.052	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	41333674	119109060	Rat
2293644	Bmd29	Bone mineral density QTL 29	5.4	0.0001	femur size trait (VT:1000369)	femoral neck cross-sectional area (CMO:0001697)	7	47651439	92651439	Rat
70190	Mcs6	Mammary carcinoma susceptibility QTL 6	2.29		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	7	26737401	63902784	Rat
2300178	Bmd54	Bone mineral density QTL 54	5.3	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	7	47651439	92651439	Rat
61428	Scl3	Serum cholesterol level QTL 3	3.2		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	7	44867533	89867533	Rat
1300132	Bp182	Blood pressure QTL 182	3.49		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	7	19654317	84928080	Rat
10402855	Bp379	Blood pressure QTL 379		0.21	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	29409683	74409683	Rat
738033	Anxrr6	Anxiety related response QTL 6	4.1		exploratory behavior trait (VT:0010471)	percentage of entries into a discrete space in an experimental apparatus (CMO:0000961)	7	15573889	60573889	Rat

AW048562

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	57,078,149 - 57,078,295 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	63,655,561 - 63,655,706	NCBI	Rnor6.0
Rnor_5.0	7	63,877,881 - 63,878,026	UniSTS	Rnor5.0
RGSC_v3.4	7	60,863,413 - 60,863,558	UniSTS	RGSC3.4
Celera	7	53,819,675 - 53,819,820	UniSTS
Cytogenetic Map	7	q22	UniSTS

RH137867

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	7	58,967,778 - 58,968,020 (+)	Marker Load Pipeline
mRatBN7.2	7	57,082,289 - 57,082,531 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	63,659,701 - 63,659,942	NCBI	Rnor6.0
Rnor_5.0	7	63,882,021 - 63,882,262	UniSTS	Rnor5.0
RGSC_v3.4	7	60,867,553 - 60,867,794	UniSTS	RGSC3.4
Celera	7	53,823,815 - 53,824,056	UniSTS
RH 3.4 Map	7	500.5	UniSTS
Cytogenetic Map	7	q22	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001106786	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039078743	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473960	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ213563	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000009260 ⟹ ENSRNOP00000009260

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	57,077,830 - 57,110,892 (-)	Ensembl
Rnor_6.0 Ensembl	7	63,655,247 - 63,687,978 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000111412 ⟹ ENSRNOP00000081507

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	57,081,296 - 57,110,892 (-)	Ensembl

RefSeq Acc Id:

NM_001106786 ⟹ NP_001100256

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	58,963,325 - 58,996,357 (-)	NCBI
mRatBN7.2	7	57,077,836 - 57,110,868 (-)	NCBI
Rnor_6.0	7	63,655,247 - 63,687,978 (-)	NCBI
Rnor_5.0	7	63,877,567 - 63,910,298 (-)	NCBI
RGSC_v3.4	7	60,863,099 - 60,896,131 (-)	RGD
Celera	7	53,819,361 - 53,852,262 (-)	RGD

Sequence:

show sequence

GCCCGGGAGCCGCGGGCTGTACGCGGCGGACGCTCGCTGGCGTACATGCAAATCTCTTCTTCCCCCTTATCGTGAGGAGAAGCGTCTGACCAAGCCGAGATGCAGAGCACTTCCAACCATCTGTGGCT
TTTGTCTGATATCCTAGGCCAAGGGGCTACTGCAAATGTCTTCCGAGGAAGGCATAAGAAAACTGGTGATCTCTATGCTGTCAAAGTATTTAATAACATAAGCTTCCTTCGCCCAGTGGATGTTCAAA
TGAGAGAATTTGAAGTGTTAAAAAAGCTCAATCACAAAAACATTGTCAAATTATTTGCTATTGAAGAAGAGACAACAACAAGACATAAAGTACTTATCATGGAGTTCTGTCCCTGTGGGAGTTTATAC
ACTGTGTTAGAGGAGCCATCCAATGCCTATGGACTGCCAGAATCAGAGTTTTTAATTGTTTTACGAGATGTGGTGGGCGGAATGAATCATCTCCGAGAGAACGGCATAGTGCACCGTGATATCAAGCC
AGGGAACATCATGCGCGTCATAGGAGAAGACGGACAGTCTGTGTACAAACTCACAGACTTTGGTGCCGCTAGAGAGTTAGAGGACGATGAGCAGTTCGTGTCTCTGTATGGCACAGAAGAGTATTTGC
ACCCGGACATGTATGAGAGGGCAGTGCTAAGGAAGGACCATCAGAAGAAGTACGGAGCCACCGTTGATCTGTGGAGTGTCGGAGTCACATTCTACCACGCAGCCACGGGGTCGCTGCCCTTTAGACCC
TTCGAGGGGCCTCGGAGGAACAAAGAAGTAATGTATAAAATAATCACTGGGAAGCCTTCTGGTGCAATATCTGGAGTACAGAAAGCAGAAAACGGACCAATTGACTGGAGTGGAGACATGCCTCTTTC
TTGTAGTCTTTCTCAGGGTCTTCAGGCACTGCTTACCCCAGTTCTTGCAAACATACTTGAAGCTGATCAGGAGAAGTGCTGGGGCTTTGACCAGTTCTTTGCAGAGACTAGTGATGTGCTGCACCGAA
TGGTAATCCATGTTTTCTCGCTACAGCACATGACAGCGCTTAAGATCTATATTCATAGCTATAACACAGCTGCTGTGTTCCATGAACTGGTCTATAAACAAACCAAGATTATTTCTTCAAATCAAGAA
CTTATCTACGAAGGACGACGCTTGGTCCTAGAACTTGGAAGACTAGCCCAGCATTTCCCTAAAACCACAGAAGAAAATCCTATCTTTGTCACAAGCCGGGAACAACTCAATTCCATAGGTCTGAGATA
TGAAAAAATTTCCCTACCTAAAATACATCCACGCTATGACCTGGACGGGGACGCCAGCATGGCCAAGGCAGTGACCGGGGTTGTGTGCTACGCCTGCAGAACTGCTGGCACCCTGCTGCTCTATCAAG
AACTAATGCGGAAGGGGGTGCGGTGGCTGATTGAACTAGTTAAAGACGACTACAATGAGACTGTCCACAAGAAGACAGAAGTTGTGATCACACTGGATTTCTGCATCAGAAACATTGAGAAGACTGTG
AAAGTATATGAGAAGTTGATGAAGGTCAGCCTGGACGCCGCAGAGCTGGGTGAGATTTCAGACATACACACCAAGCTGCTGAGACTTTCCAGCTCTCAGGGAACAATAGAGAGCAGTCTTCAGGACAT
CAACAGCAGGCTGTCCCCAGGGGGATCGCTGGCTGACACCTGGGCACATCAGGAAGGCACTCATCCAAGAGACAGGAATGTAGAAAAGCTACAAGTCTTGTTGAATTGCATCACAGAGATTTACTATC
AGTTTAAAAAGGACAAGGCAGAGCGCAGACTAGCGTATAATGAAGAACAGATCCACAAGTTTGATAAACAAAAATTGTATTACCATGCAACAAAAGCAATGACCCACTTTACCGATGAATGTGTCAGG
AAGTATGAAGCATTTAAAGACACGTCTGAAGAATGGATGCGAAAGATGCTTCATCTTCGGAAACAGCTGCTATCACTGACTAATCAGTGTTTTGACATCGAAGAGGAGGTGTCCAAGTATCAAGACTA
CACTAACGAGTTACAAGAAACTCTGCCTCAGAAAATGCTTGCAGCCTCCAGTGGAATCAAGCACACCGTGGCCCCGATCTACCCCAGTTCTAACACCTTAGTGGAGATGACTCTCGGTATGAAGAAGC
TGAAGGAGGAGATGGAGGGCGTGGTCAAGGAGCTGGCCGAAAACAATCATATTTTAGAAAGGTTTGGGTCTTTGACAATGGATGGTGGCCTCCGCAATGTGGACTGTCTTTAGCTTCTTCGGGAGTCT
GGGAAGTTCTAGTTTGCACAAGAAGATGACACTGGGGCACGAAGTGAATGCCTTTATGAATGGCATTCTTATTTCTACAATTCAGTATTTGATGAGGTCGTGTAAATATGTACAGTTTGTAAATACAT
ATACATATATATATATGAATTTTTGGCTGCTGTAAGTAAACAAGACAGATTGACCTCAGTGAGCTGTAGAAGAAAGCCATGACCAGCCAATGCTTTGGGGTGCTCTCCCTAATTCTTCACATGAGGCT
GGAGAAATCTATGCTTGGTGCCTAAAGAAAGTATTTTTTGAATTGGCGTCCTTAAAATTTTGAAAGGACTGATAGTTGACACAGTTGTGAATGGAGGAGACACAGGGCTTTGTGATAGGAACCGAACC
ACGGTTTTACTAGGGTCAGTTCCTCTGACAAGGATGAAGCGGCATTATTTCATTTGACGAGGTGCCCAAATCTGTTTTCCTCGTATGTTTCATTTCAGGTGAATTATTGAGCAAAAACTTTAAAGTGA
ATTCATTGTTTAAACTATTCATTTTTCGTTTGGTCACAATGTGTAATTGTCATTCAGATCCTCGTATCATTTCAATTGTCTTAAGATGTATATTTCTGTACTTTAATTCTGCTGTTTCATGAAAAATT
CTGCCTACTATTTCATGAAAAATAAATTTCTCAATTTTAATGT

hide sequence

RefSeq Acc Id:

XM_039078743 ⟹ XP_038934671

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	58,963,319 - 58,987,796 (-)	NCBI
mRatBN7.2	7	57,077,830 - 57,102,308 (-)	NCBI


Protein RefSeqs	NP_001100256	(Get FASTA)	NCBI Sequence Viewer
	XP_038934671	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM16548	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000009260
	ENSRNOP00000009260.4
	ENSRNOP00000081507.1

RefSeq Acc Id:

NP_001100256 ⟸ NM_001106786

- UniProtKB:

D4A7D3 (UniProtKB/TrEMBL), A6IH00 (UniProtKB/TrEMBL), A0A8I5ZSX1 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLYAVKVFNNISFLRPVDVQMREFEVLKKLNHKNIVKLFAIEEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGMNHLRE
NGIVHRDIKPGNIMRVIGEDGQSVYKLTDFGAARELEDDEQFVSLYGTEEYLHPDMYERAVLRKDHQKKYGATVDLWSVGVTFYHAATGSLPFRPFEGPRRNKEVMYKIITGKPSGAISGVQKAENGP
IDWSGDMPLSCSLSQGLQALLTPVLANILEADQEKCWGFDQFFAETSDVLHRMVIHVFSLQHMTALKIYIHSYNTAAVFHELVYKQTKIISSNQELIYEGRRLVLELGRLAQHFPKTTEENPIFVTSR
EQLNSIGLRYEKISLPKIHPRYDLDGDASMAKAVTGVVCYACRTAGTLLLYQELMRKGVRWLIELVKDDYNETVHKKTEVVITLDFCIRNIEKTVKVYEKLMKVSLDAAELGEISDIHTKLLRLSSSQ
GTIESSLQDINSRLSPGGSLADTWAHQEGTHPRDRNVEKLQVLLNCITEIYYQFKKDKAERRLAYNEEQIHKFDKQKLYYHATKAMTHFTDECVRKYEAFKDTSEEWMRKMLHLRKQLLSLTNQCFDI
EEEVSKYQDYTNELQETLPQKMLAASSGIKHTVAPIYPSSNTLVEMTLGMKKLKEEMEGVVKELAENNHILERFGSLTMDGGLRNVDCL

hide sequence

Ensembl Acc Id:

ENSRNOP00000009260 ⟸ ENSRNOT00000009260

RefSeq Acc Id:	XP_038934671 ⟸ XM_039078743
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I5ZSX1 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000081507 ⟸ ENSRNOT00000111412

Protein Domains

Protein kinase

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4A7D3-F1-model_v2	AlphaFold	D4A7D3	1-729	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13695227

Promoter ID:

EPDNEW_R5751

Type:

multiple initiation site

Name:

Tbk1_1

Description:

TANK-binding kinase 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	7	63,687,981 - 63,688,041	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-33871	BioCyc
Ensembl Genes	ENSRNOG00000005528	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000009260	ENTREZGENE
	ENSRNOT00000009260.6	UniProtKB/TrEMBL
	ENSRNOT00000111412.1	UniProtKB/TrEMBL
Gene3D-CATH	1.20.1270.420	UniProtKB/TrEMBL
	Phosphatidylinositol 3-kinase Catalytic Subunit, Chain A, domain 1	UniProtKB/TrEMBL
	Phosphorylase Kinase, domain 1	UniProtKB/TrEMBL
	Transferase(Phosphotransferase) domain 1	UniProtKB/TrEMBL
InterPro	IKK	UniProtKB/TrEMBL
	Kinase-like_dom	UniProtKB/TrEMBL
	Prot_kinase_cat_dom	UniProtKB/TrEMBL
	Protein_kinase_ATP_BS	UniProtKB/TrEMBL
	TBK1_CCD1	UniProtKB/TrEMBL
	TBK1_ULD	UniProtKB/TrEMBL
KEGG Report	rno:299827	UniProtKB/TrEMBL
NCBI Gene	299827	ENTREZGENE
PANTHER	IKB KINASE	UniProtKB/TrEMBL
	SERINE/THREONINE-PROTEIN KINASE TBK1	UniProtKB/TrEMBL
Pfam	Pkinase	UniProtKB/TrEMBL
	TBK1_CCD1	UniProtKB/TrEMBL
	TBK1_ULD	UniProtKB/TrEMBL
PhenoGen	Tbk1	PhenoGen
PROSITE	PROTEIN_KINASE_ATP	UniProtKB/TrEMBL
	PROTEIN_KINASE_DOM	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000005528	RatGTEx
SMART	S_TKc	UniProtKB/TrEMBL
Superfamily-SCOP	Kinase_like	UniProtKB/TrEMBL
UniProt	A0A8I5ZSX1	ENTREZGENE, UniProtKB/TrEMBL
	A6IH00	ENTREZGENE, UniProtKB/TrEMBL
	D4A7D3	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-03-04	Tbk1	TANK-binding kinase 1	LOC299827	similar to TANK-binding kinase 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-11-19	LOC299827	similar to TANK-binding kinase 1			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)