Symbol:
MYC
Name:
MYC proto-oncogene, bHLH transcription factor
RGD ID:
14275719
Description:
ENCODES a protein that exhibits cis-regulatory region sequence-specific DNA binding (ortholog); DNA binding (ortholog); DNA-binding transcription factor activity (ortholog); INVOLVED IN acinar cell proliferation (ortholog); amino acid transport (ortholog); B cell apoptotic process (ortholog); PARTICIPATES IN ceramide signaling pathway; interleukin-2 signaling pathway; interleukin-6 signaling pathway; ASSOCIATED WITH Aberrant Crypt Foci (ortholog); acute kidney failure (ortholog); acute lymphoblastic leukemia (ortholog); FOUND IN axon (ortholog); chromatin (ortholog); euchromatin (ortholog); INTERACTS WITH 3-acetyldeoxynivalenol; bis(2-chloroethyl) sulfide; cadmium atom
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
c-Myc; c-myc proto-oncogene; c-Myc-a; c-Myc-b; myc proto-oncogene protein; proto-oncogene c-Myc; transcription factor p64; v-myc avian myelocytomatosis viral oncogene homolog; v-myc myelocytomatosis viral oncogene homolog
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
MYC (MYC proto-oncogene, bHLH transcription factor) HGNC
EggNOG, Ensembl, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Mus musculus (house mouse):
Myc (myelocytomatosis oncogene) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Rattus norvegicus (Norway rat):
Myc (MYC proto-oncogene, bHLH transcription factor) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Myc (MYC proto-oncogene, bHLH transcription factor) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
MYC (MYC proto-oncogene, bHLH transcription factor) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
MYC (MYC proto-oncogene, bHLH transcription factor) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Myc (MYC proto-oncogene, bHLH transcription factor) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
MYC (MYC proto-oncogene, bHLH transcription factor) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Myc (MYC proto-oncogene, bHLH transcription factor) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Latest Assembly:
Sscrofa11.1 - Pig Sscrofa11.1 Assembly
Position:
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 4 12,455,122 - 12,461,078 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 4 12,455,141 - 12,460,360 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 4 12,778,452 - 12,783,667 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3 Pig Cytomap 4 p13 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Imported Annotations - PID (archival)
Biological Process
acinar cell proliferation (ISO) amino acid transport (ISO) B cell apoptotic process (ISO) branching involved in ureteric bud morphogenesis (ISO) cell population proliferation (ISO) cellular response to angiotensin (ISO) cellular response to arsenite(3-) (ISO) cellular response to carbohydrate stimulus (ISO) cellular response to cycloheximide (ISO) cellular response to cytokine stimulus (ISO) cellular response to dimethyl sulfoxide (ISO) cellular response to endothelin (ISO) cellular response to epidermal growth factor stimulus (ISO) cellular response to estrogen stimulus (ISO) cellular response to fibroblast growth factor stimulus (ISO) cellular response to glucose stimulus (ISO) cellular response to growth hormone stimulus (ISO) cellular response to hydrostatic pressure (ISO) cellular response to hypoxia (IEA) cellular response to insulin stimulus (ISO) cellular response to interferon-alpha (ISO) cellular response to interleukin-1 (ISO) cellular response to lectin (ISO) cellular response to phorbol 13-acetate 12-myristate (ISO) cellular response to platelet-derived growth factor stimulus (ISO) cellular response to prolactin (ISO) cellular response to putrescine (ISO) cellular response to retinoic acid (ISO) cellular response to testosterone stimulus (ISO) cellular response to type II interferon (ISO) cellular response to UV (IEA) cellular response to xenobiotic stimulus (IEA,ISO) chromatin remodeling (IEA,ISS) chromosome organization (IEA,ISS) detection of mechanical stimulus involved in sensory perception of sound (ISO) DNA damage response (IEA,ISO,ISS) DNA-templated transcription (ISO) DNA-templated transcription initiation (ISO) ERK1 and ERK2 cascade (IEA) G0 to G1 transition (ISO) G1/S transition of mitotic cell cycle (IEA,ISS) glucose metabolic process (ISO) hypothalamus development (ISO) in utero embryonic development (ISO) inner mitochondrial membrane organization (ISO) intracellular iron ion homeostasis (IEA,ISS) intrinsic apoptotic signaling pathway (ISS) intrinsic apoptotic signaling pathway in response to DNA damage (ISO) lactic acid secretion (ISO) liver regeneration (ISO) MAPK cascade (IEA,ISS) middle ear morphogenesis (ISO) myoblast proliferation (ISO) myotube differentiation (ISO) negative regulation of apoptotic process (ISS) negative regulation of cell division (IEA,ISS) negative regulation of D-glucose import (ISO) negative regulation of epithelial cell apoptotic process (ISO) negative regulation of fibroblast proliferation (IEA) negative regulation of gene expression (ISO) negative regulation of gene expression via chromosomal CpG island methylation (IEA) negative regulation of monocyte differentiation (IEA,ISS) negative regulation of stress-activated MAPK cascade (ISS) negative regulation of transcription by RNA polymerase II (IEA,ISO) negative regulation of transcription initiation by RNA polymerase II (IEA) NK T cell proliferation (ISO) ovarian follicle development (ISO) pigmentation (ISO) positive regulation of acinar cell proliferation (ISO) positive regulation of apoptotic signaling pathway (ISO) positive regulation of ATP biosynthetic process (ISO) positive regulation of B cell apoptotic process (ISO) positive regulation of catalytic activity (ISO) positive regulation of cell cycle (ISO) positive regulation of cell population proliferation (IBA,IEA,ISO,ISS) positive regulation of cellular respiration (ISO) positive regulation of DNA binding (ISO) positive regulation of DNA-templated transcription (IEA,ISS) positive regulation of epithelial cell proliferation (IEA,ISS) positive regulation of fibroblast proliferation (IEA,ISO,ISS) positive regulation of gene expression (IEA) positive regulation of glial cell proliferation (ISO) positive regulation of glycolytic process (ISO) positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator (IEA) positive regulation of mesenchymal cell proliferation (ISO) positive regulation of metanephric cap mesenchymal cell proliferation (ISO) positive regulation of miRNA transcription (IEA) positive regulation of mitochondrial membrane potential (ISO) positive regulation of oxidative phosphorylation (ISO) positive regulation of smooth muscle cell migration (ISO) positive regulation of smooth muscle cell proliferation (ISO) positive regulation of telomere maintenance (ISO) positive regulation of transcription by RNA polymerase II (IEA,ISO,ISS) positive regulation of transcription initiation by RNA polymerase II (ISO) protein processing (ISO) protein-DNA complex disassembly (IEA) pyruvate transport (ISO) re-entry into mitotic cell cycle (ISO) regulation of apoptotic process (ISO,ISS) regulation of cell cycle process (IEA) regulation of DNA-templated transcription (IEA,ISO,ISS) regulation of gene expression (IEA) regulation of mitotic cell cycle (ISO) regulation of oxidative phosphorylation (ISO) regulation of somatic stem cell population maintenance (ISS) regulation of telomere maintenance (IEA,ISS) regulation of transcription by RNA polymerase II (IBA) response to alkaloid (ISO) response to estradiol (ISO) response to ethanol (ISO) response to human chorionic gonadotropin (ISO) response to radiation (ISO,ISS) response to xenobiotic stimulus (IEA,ISS) rRNA metabolic process (IEA,ISS) skeletal muscle cell differentiation (ISO) skeletal system morphogenesis (ISO) symbiont-mediated transformation of host cell (ISO) transcription by RNA polymerase II (ISO) Wnt signaling pathway (ISO)
Molecular Function
cis-regulatory region sequence-specific DNA binding (ISO) core promoter sequence-specific DNA binding (IEA) DNA binding (IEA,ISO,ISS) DNA-binding transcription activator activity, RNA polymerase II-specific (IEA) DNA-binding transcription factor activity (IEA,ISO) DNA-binding transcription factor activity, RNA polymerase II-specific (IBA,IEA,ISS) DNA-binding transcription factor binding (IEA) DNA-binding transcription repressor activity, RNA polymerase II-specific (IEA) double-stranded DNA binding (ISO) E-box binding (IEA,ISS) eukaryotic initiation factor eIF2 binding (ISO) identical protein binding (IEA) mRNA binding (ISO) protein binding (ISO) protein dimerization activity (IEA) protein-containing complex binding (IEA,ISO,ISS) RNA polymerase II cis-regulatory region sequence-specific DNA binding (IBA,IEA) SCF ubiquitin ligase complex binding (IEA) sequence-specific DNA binding (ISO) transcription coregulator binding (IEA) transcription factor binding (ISO) transcription regulator activator activity (IEA) ubiquitin protein ligase binding (ISO)
MYC Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 4 12,455,122 - 12,461,078 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 4 12,455,141 - 12,460,360 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 4 12,778,452 - 12,783,667 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3 Pig Cytomap 4 p13 NCBI
MYC Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 8 127,735,434 - 127,742,951 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 8 127,735,434 - 127,742,951 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 8 128,747,680 - 128,755,197 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 8 128,817,498 - 128,822,856 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 8 128,817,685 - 128,822,853 NCBI Celera 8 124,928,812 - 124,934,177 (+) NCBI Celera Cytogenetic Map 8 q24.21 NCBI HuRef 8 124,069,829 - 124,075,195 (+) NCBI HuRef CHM1_1 8 128,788,551 - 128,793,916 (+) NCBI CHM1_1 T2T-CHM13v2.0 8 128,862,888 - 128,870,405 (+) NCBI T2T-CHM13v2.0
Myc Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 15 61,857,190 - 61,862,210 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 15 61,857,240 - 61,862,223 (+) Ensembl GRCm39 Ensembl GRCm38 15 61,985,341 - 61,990,361 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 15 61,985,391 - 61,990,374 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 15 61,816,896 - 61,821,916 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 15 61,815,052 - 61,820,027 (+) NCBI MGSCv36 mm8 Celera 15 63,490,745 - 63,495,748 (+) NCBI Celera Cytogenetic Map 15 D1 NCBI cM Map 15 26.19 NCBI
Myc Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 95,483,105 - 95,488,031 (+) NCBI GRCr8 mRatBN7.2 7 93,593,705 - 93,598,633 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 93,593,705 - 93,598,630 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 95,416,828 - 95,421,746 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 97,619,124 - 97,624,042 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 97,498,652 - 97,503,571 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 102,586,313 - 102,591,240 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 102,586,313 - 102,591,240 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 103,157,452 - 103,162,379 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 98,953,142 - 98,958,060 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 98,987,371 - 98,992,287 (+) NCBI Celera 7 90,263,903 - 90,268,823 (+) NCBI Celera Cytogenetic Map 7 q33 NCBI
Myc Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955461 2,714,022 - 2,718,982 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955461 2,714,022 - 2,718,872 (+) NCBI ChiLan1.0 ChiLan1.0
MYC Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 7 145,127,238 - 145,132,177 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 8 120,636,992 - 120,641,918 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 8 124,387,561 - 124,393,551 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 8 127,130,877 - 127,136,861 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 8 127,131,512 - 127,136,863 (+) Ensembl panpan1.1 panPan2
MYC Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 13 25,200,772 - 25,205,309 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 13 25,200,577 - 25,205,309 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 13 25,169,176 - 25,173,718 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 13 25,544,697 - 25,549,239 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 13 25,539,647 - 25,549,749 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 13 25,260,451 - 25,264,991 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 13 25,374,618 - 25,379,158 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 13 25,629,077 - 25,633,621 (+) NCBI UU_Cfam_GSD_1.0
Myc Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405303 13,054,869 - 13,059,826 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936470 20,480,829 - 20,485,965 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936470 20,480,844 - 20,485,955 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
MYC Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 8 122,282,989 - 122,288,392 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 8 122,282,630 - 122,288,384 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666039 17,837,088 - 17,843,111 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Myc
.
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
10
4
23
3
2
5
14
12
23
3
6
3
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSSSCT00000006548 ⟹ ENSSSCP00000006374
Type:
CODING
Position:
Pig Assembly Chr Position (strand) Source Sscrofa11.1 Ensembl 4 12,455,600 - 12,457,745 (-) Ensembl
Ensembl Acc Id:
ENSSSCT00000067375 ⟹ ENSSSCP00000074218
Type:
CODING
Position:
Pig Assembly Chr Position (strand) Source Sscrofa11.1 Ensembl 4 12,455,130 - 12,461,078 (-) Ensembl
Ensembl Acc Id:
ENSSSCT00000068933 ⟹ ENSSSCP00000063543
Type:
CODING
Position:
Pig Assembly Chr Position (strand) Source Sscrofa11.1 Ensembl 4 12,455,122 - 12,458,471 (-) Ensembl
RefSeq Acc Id:
NM_001005154 ⟹ NP_001005154
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Pig Assembly Chr Position (strand) Source Sscrofa11.1 4 12,455,141 - 12,460,360 (-) NCBI
Sequence:
TATAGGCGAGGGTCTGCGCGGCTGGGGACCCTCCGGCTGCGCATCTCTCGGCTGCCGCCGCCTTTGCCGCACCCCGGCCACCGCTAGGCTCCCCACTGCCTCTGGAAGGGCAGGGCTATACAGAGGCT
hide sequence
RefSeq Acc Id:
NP_001005154 ⟸ NM_001005154
- UniProtKB:
Q29031 (UniProtKB/Swiss-Prot), C4P6P7 (UniProtKB/TrEMBL)
- Sequence:
MDFLRIVENPAAAMPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVASFSPRGDDDGGGGSFSTADQLEMVTELLGGDMVNQSF
hide sequence
Ensembl Acc Id:
ENSSSCP00000063543 ⟸ ENSSSCT00000068933
Ensembl Acc Id:
ENSSSCP00000006374 ⟸ ENSSSCT00000006548
Ensembl Acc Id:
ENSSSCP00000074218 ⟸ ENSSSCT00000067375
